F264850

General Info

Members Datasets Scaffolds Average Seq Length
174 98 174 131

Family's Representative Sequence

Representative Sequence 3300031995|Ga0307409_100235874|Ga0307409_1002358742
Length 139
Sequence VNRRDGSRTGPPVRRRADEIVARARALVGTRFRPQGRSVANGLDCIGVAALALDVADTPRDYRLRGGCVRRLAQGLAEAGLVPTGAMAAGDVLLLQPGPAQLHLGIFTGTGLVHGDAGLRRVVERPLPFLWPILGIWRS

Samples

Sample ID Description Type Environment
1 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
21 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
27 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
28 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
31 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
33 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
34 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
35 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
36 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
37 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
38 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
39 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
40 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
41 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
42 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
43 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
67 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
68 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
69 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
70 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
71 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
72 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
73 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
74 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
75 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
76 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
77 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
78 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
79 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
80 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
81 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
82 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
83 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
84 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
85 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
86 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
87 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
88 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
89 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
90 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
91 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
92 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
93 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
94 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
95 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
96 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
97 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
98 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.85
Metatranscriptomes 1.15
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.15
Nodule 0
Rhizoplane 1.15
Rhizosphere 94.25
Stem 0
Stem Tuber 0
Unclassified 3.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24750J21931_1037975 3300002070 Bacteria 725
2 Ga0070658_10000002 3300005327 Bacteria 637290
3 Ga0070658_10018673 3300005327 Bacteria 5553
4 Ga0070658_10025402 3300005327 Bacteria 4749
5 Ga0070658_10070814 3300005327 Bacteria 2855
6 Ga0070658_10224967 3300005327 Bacteria 1587
7 Ga0070658_10371147 3300005327 Unclassified 1227
8 Ga0070658_10569176 3300005327 Bacteria 981
9 Ga0070670_100761310 3300005331 Unclassified 873
10 Ga0070666_10120835 3300005335 Bacteria 1816
11 Ga0070680_100000503 3300005336 Bacteria 26874
12 Ga0070660_100002243 3300005339 Bacteria 13286
13 Ga0070660_100013835 3300005339 Bacteria 5804
14 Ga0070660_100098685 3300005339 Bacteria 2312
15 Ga0070661_100000042 3300005344 Bacteria 99327
16 Ga0070661_100208552 3300005344 Bacteria 1495
17 Ga0070661_100438650 3300005344 Unclassified 1037
18 Ga0070661_100938790 3300005344 Unclassified 715
19 Ga0070661_101236329 3300005344 Bacteria 625
20 Ga0070692_10000859 3300005345 Bacteria 10202
21 Ga0070692_10639665 3300005345 Bacteria 709
22 Ga0070692_10956415 3300005345 Bacteria 596
23 Ga0070668_101145310 3300005347 Bacteria 703
24 Ga0070675_100006289 3300005354 Bacteria 9113
25 Ga0070659_100021116 3300005366 Bacteria 4953
26 Ga0070659_100039019 3300005366 Bacteria 3706
27 Ga0070667_100021842 3300005367 Bacteria 5311
28 Ga0070663_100270079 3300005455 Unclassified 1352
29 Ga0070663_100381554 3300005455 Bacteria 1148
30 Ga0070662_100253456 3300005457 Unclassified 1416
31 Ga0070681_10151874 3300005458 Bacteria 2242
32 Ga0070681_10392180 3300005458 Bacteria 1299
33 Ga0070679_100000002 3300005530 Bacteria 312066
34 Ga0070679_100601344 3300005530 Bacteria 1043
35 Ga0070686_100394367 3300005544 Bacteria 1051
36 Ga0070665_100336505 3300005548 Bacteria 1514
37 Ga0068855_100185337 3300005563 Viruses 2351
38 Ga0068855_100412557 3300005563 Bacteria 1478
39 Ga0070664_100511263 3300005564 Bacteria 1108
40 Ga0068854_100836683 3300005578 Unclassified 805
41 Ga0068856_102558487 3300005614 Bacteria 517
42 Ga0068852_100096499 3300005616 Bacteria 2657
43 Ga0068852_100216249 3300005616 Bacteria 1820
44 Ga0068852_102474988 3300005616 Bacteria 539
45 Ga0068859_100054100 3300005617 Bacteria 4037
46 Ga0068859_100095578 3300005617 Bacteria 3024
47 Ga0068858_100003810 3300005842 Bacteria 14908
48 Ga0068862_100061815 3300005844 Bacteria 3220
49 Ga0081539_10077068 3300005985 Bacteria 1764
50 Ga0097620_100054099 3300006931 Bacteria 4037
51 Ga0097620_100095579 3300006931 Bacteria 3024
52 Ga0111539_10890323 3300009094 Unclassified 1035
53 Ga0111539_11369870 3300009094 Unclassified 821
54 Ga0105245_10020432 3300009098 Bacteria 5808
55 Ga0114129_10574288 3300009147 Bacteria 1464
56 Ga0114129_11643500 3300009147 Bacteria 785
57 Ga0105243_11928897 3300009148 Bacteria 624
58 Ga0105248_10046168 3300009177 Bacteria 4882
59 Ga0105249_10059336 3300009553 Bacteria 3509
60 Ga0157373_10142755 3300013100 Bacteria 1684
61 Ga0157371_10217504 3300013102 Bacteria 1372
62 Ga0157371_10572054 3300013102 Bacteria 839
63 Ga0157369_10050322 3300013105 Viruses 4513
64 Ga0157369_10301443 3300013105 Bacteria 1667
65 Ga0206354_10926119 3300020081 Bacteria 1417
66 Ga0206353_11051854 3300020082 Bacteria 877
67 Ga0213874_10071144 3300021377 Unclassified 1110
68 Ga0213876_10000980 3300021384 Bacteria 18784
69 Ga0213875_10000897 3300021388 Bacteria 21712
70 Ga0207705_10000008 3300025909 Bacteria 589717
71 Ga0207705_10042705 3300025909 Viruses 3256
72 Ga0207705_10170095 3300025909 Bacteria 1640
73 Ga0207705_10206437 3300025909 Bacteria 1489
74 Ga0207705_10635177 3300025909 Unclassified 830
75 Ga0207705_10808901 3300025909 Bacteria 727
76 Ga0207707_10023714 3300025912 Bacteria 5366
77 Ga0207660_10000036 3300025917 Bacteria 65280
78 Ga0207660_10000199 3300025917 Bacteria 38427
79 Ga0207657_10007497 3300025919 Bacteria 11183
80 Ga0207657_10008812 3300025919 Bacteria 10205
81 Ga0207657_10024233 3300025919 Bacteria 5630
82 Ga0207649_10000047 3300025920 Bacteria 110856
83 Ga0207649_10201903 3300025920 Bacteria 1405
84 Ga0207649_10454683 3300025920 Unclassified 967
85 Ga0207652_10000001 3300025921 Bacteria 1006643
86 Ga0207652_10000002 3300025921 Bacteria 878035
87 Ga0207687_10040332 3300025927 Bacteria 3200
88 Ga0207690_10011098 3300025932 Bacteria 5374
89 Ga0207690_10012858 3300025932 Bacteria 5015
90 Ga0207690_10502140 3300025932 Bacteria 981
91 Ga0207706_10038993 3300025933 Bacteria 4214
92 Ga0207711_10118799 3300025941 Bacteria 2359
93 Ga0207661_10029364 3300025944 Viruses 4223
94 Ga0207679_10194373 3300025945 Bacteria 1690
95 Ga0207712_10086406 3300025961 Unclassified 2297
96 Ga0207668_10845163 3300025972 Bacteria 812
97 Ga0207658_10590190 3300025986 Bacteria 997
98 Ga0207703_10039048 3300026035 Bacteria 3792
99 Ga0207639_10145619 3300026041 Bacteria 1978
100 Ga0207639_10741281 3300026041 Bacteria 913
101 Ga0207678_10197127 3300026067 Bacteria 1721
102 Ga0207702_10084501 3300026078 Bacteria 2764
103 Ga0207674_11238000 3300026116 Unclassified 716
104 Ga0207698_10438539 3300026142 Unclassified 1258
105 Ga0207698_11580033 3300026142 Bacteria 671
106 Ga0207698_12185907 3300026142 Unclassified 566
107 Ga0268265_10143210 3300028380 Bacteria 2004
108 Ga0268264_11603411 3300028381 Unclassified 661
109 Ga0307408_100491344 3300031548 Bacteria 1073
110 Ga0307408_102031264 3300031548 Bacteria 553
111 Ga0307405_10391870 3300031731 Bacteria 1085
112 Ga0307410_10980081 3300031852 Unclassified 728
113 Ga0307412_10281976 3300031911 Bacteria 1305
114 Ga0307409_100074332 3300031995 Bacteria 2716
115 Ga0307409_100083134 3300031995 Bacteria 2595
116 Ga0307409_100099135 3300031995 Bacteria 2412
117 Ga0307409_100235874 3300031995 Bacteria 1662
118 Ga0307409_101439300 3300031995 Unclassified 716
119 Ga0307416_100662291 3300032002 Bacteria 1130
120 Ga0307416_100750142 3300032002 Unclassified 1069
121 Ga0307416_100810198 3300032002 Unclassified 1033
122 Ga0307416_101396588 3300032002 Bacteria 806
123 Ga0307414_10118374 3300032004 Bacteria 2032
124 Ga0307414_10720124 3300032004 Unclassified 905
125 Ga0307414_10757753 3300032004 Bacteria 883
126 Ga0307411_10491778 3300032005 Bacteria 1035
127 Ga0307415_100239618 3300032126 Bacteria 1466
128 Ga0307415_101629622 3300032126 Bacteria 621
129 Ga0395899_0384195 3300037312 Bacteria 932
130 Ga0395900_0136668 3300037418 Bacteria 2511
131 Ga0395900_0319086 3300037418 Bacteria 1534
132 Ga0395900_1055357 3300037418 Unclassified 731
133 Ga0395900_1130705 3300037418 Bacteria 700
134 Ga0395898_0303229 3300037466 Viruses 1523
135 Ga0395898_0361362 3300037466 Bacteria 1384
136 Ga0395898_0604288 3300037466 Unclassified 1039
137 Ga0395905_0007794 3300037471 Bacteria 10620
138 Ga0395905_0010277 3300037471 Bacteria 9112
139 Ga0395905_0021242 3300037471 Bacteria 6143
140 Ga0395905_0266960 3300037471 Viruses 1597
141 Ga0395905_1507959 3300037471 Bacteria 577
142 Ga0436364_0267368 3300037853 Bacteria 35795
143 Ga0395901_0006958 3300038443 Bacteria 11427
144 Ga0395901_0872523 3300038443 Bacteria 883
145 Ga0395901_0937080 3300038443 Bacteria 846
146 Ga0395901_1413432 3300038443 Unclassified 654
147 Ga0436365_0689373 3300039437 Bacteria 73333
148 Ga0451807_1924339 3300041486 Bacteria 1297
149 Ga0451853_2414012 3300041512 Bacteria 1105
150 Ga0466966_0615823 3300044684 Bacteria 654
151 Ga0466961_0638144 3300044693 Unclassified 639
152 Ga0466963_0067907 3300044694 Bacteria 2393
153 Ga0466963_0083375 3300044694 Bacteria 2168
154 Ga0466971_0042683 3300044719 Bacteria 2038
155 Ga0466957_0013658 3300044842 Bacteria 4714
156 Ga0466957_0510718 3300044842 Bacteria 834
157 Ga0466957_0536834 3300044842 Bacteria 814
158 Ga0466958_0037364 3300045836 Viruses 2910
159 Ga0466958_0072307 3300045836 Bacteria 2112
160 Ga0466967_0066934 3300045976 Bacteria 3202
161 Ga0466967_0124498 3300045976 Bacteria 2386
162 Ga0466967_0214124 3300045976 Bacteria 1828
163 Ga0466967_0273359 3300045976 Bacteria 1619
164 Ga0466967_0799320 3300045976 Bacteria 936
165 Ga0495663_0069117 3300046525 Unclassified 1122
166 Ga0495663_0085573 3300046525 Bacteria 1021
167 Ga0495669_0265243 3300046684 Bacteria 825
168 Ga0495685_228265 3300047447 Unclassified 593
169 Ga0496111_0903270 3300048914 Bacteria 636
170 nmdc:mga05p37_1415707_c1 3300050507 Bacteria 699
171 nmdc:mga05p37_2026547_c1 3300050507 Unclassified 543
172 Ga0500568_0001916 3300053139 Bacteria 12763
173 Ga0500616_0000101 3300053153 Bacteria 172722
174 Ga0466962_0202451 3300061719 Bacteria 970

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005327 Ga0070658_10000002 Ga0070658_10000002223 113
2 3300025909 Ga0207705_10000008 Ga0207705_10000008568 113
3 3300009148 Ga0105243_11928897 Ga0105243_119288972 122
4 3300021384 Ga0213876_10000980 Ga0213876_1000098028 122
5 3300031995 Ga0307409_100235874 Ga0307409_1002358742 122
6 3300031995 Ga0307409_101439300 Ga0307409_1014393002 122
7 3300032002 Ga0307416_100750142 Ga0307416_1007501422 122
8 3300039437 Ga0436365_0689373 Ga0436365_0689373_69075_69536 122
9 3300041512 Ga0451853_2414012 Ga0451853_2414012_700_1083 122
10 3300053139 Ga0500568_0001916 Ga0500568_0001916_4844_5227 122
11 3300053153 Ga0500616_0000101 Ga0500616_0000101_63966_64349 122
12 3300005344 Ga0070661_100208552 Ga0070661_1002085522 124
13 3300009098 Ga0105245_10020432 Ga0105245_100204325 124
14 3300025920 Ga0207649_10201903 Ga0207649_102019032 124
15 3300025927 Ga0207687_10040332 Ga0207687_100403324 124
16 3300031548 Ga0307408_102031264 Ga0307408_1020312642 124
17 3300041486 Ga0451807_1924339 Ga0451807_1924339_443_829 125
18 3300005327 Ga0070658_10070814 Ga0070658_100708143 127
19 3300005544 Ga0070686_100394367 Ga0070686_1003943672 127
20 3300005617 Ga0068859_100054100 Ga0068859_1000541002 127
21 3300005842 Ga0068858_100003810 Ga0068858_1000038106 127
22 3300006931 Ga0097620_100054099 Ga0097620_1000540994 127
23 3300009553 Ga0105249_10059336 Ga0105249_100593362 127
24 3300026035 Ga0207703_10039048 Ga0207703_100390483 127
25 3300031911 Ga0307412_10281976 Ga0307412_102819762 127
26 3300032002 Ga0307416_100662291 Ga0307416_1006622912 127
27 3300045976 Ga0466967_0124498 Ga0466967_0124498_1243_1632 127
28 3300045976 Ga0466967_0799320 Ga0466967_0799320_481_870 127
29 3300046525 Ga0495663_0085573 Ga0495663_0085573_177_563 127
30 3300046684 Ga0495669_0265243 Ga0495669_0265243_389_775 127
31 3300048914 Ga0496111_0903270 Ga0496111_0903270_164_550 127
32 3300032004 Ga0307414_10757753 Ga0307414_107577532 128
33 3300002070 JGI24750J21931_1037975 JGI24750J21931_10379752 129
34 3300005327 Ga0070658_10018673 Ga0070658_100186732 129
35 3300005327 Ga0070658_10025402 Ga0070658_100254022 129
36 3300005327 Ga0070658_10224967 Ga0070658_102249672 129
37 3300005327 Ga0070658_10371147 Ga0070658_103711472 129
38 3300005327 Ga0070658_10569176 Ga0070658_105691762 129
39 3300005331 Ga0070670_100761310 Ga0070670_1007613102 129
40 3300005335 Ga0070666_10120835 Ga0070666_101208352 129
41 3300005336 Ga0070680_100000503 Ga0070680_1000005037 129
42 3300005339 Ga0070660_100002243 Ga0070660_1000022435 129
43 3300005339 Ga0070660_100013835 Ga0070660_1000138355 129
44 3300005339 Ga0070660_100098685 Ga0070660_1000986853 129
45 3300005344 Ga0070661_100000042 Ga0070661_10000004273 129
46 3300005344 Ga0070661_100438650 Ga0070661_1004386501 129
47 3300005344 Ga0070661_100938790 Ga0070661_1009387901 129
48 3300005344 Ga0070661_101236329 Ga0070661_1012363292 129
49 3300005345 Ga0070692_10000859 Ga0070692_100008597 129
50 3300005345 Ga0070692_10639665 Ga0070692_106396651 129
51 3300005345 Ga0070692_10956415 Ga0070692_109564151 129
52 3300005347 Ga0070668_101145310 Ga0070668_1011453101 129
53 3300005354 Ga0070675_100006289 Ga0070675_10000628911 129
54 3300005366 Ga0070659_100021116 Ga0070659_1000211164 129
55 3300005366 Ga0070659_100039019 Ga0070659_1000390193 129
56 3300005367 Ga0070667_100021842 Ga0070667_1000218424 129
57 3300005455 Ga0070663_100270079 Ga0070663_1002700792 129
58 3300005455 Ga0070663_100381554 Ga0070663_1003815542 129
59 3300005457 Ga0070662_100253456 Ga0070662_1002534562 129
60 3300005458 Ga0070681_10151874 Ga0070681_101518742 129
61 3300005458 Ga0070681_10392180 Ga0070681_103921802 129
62 3300005530 Ga0070679_100000002 Ga0070679_10000000267 129
63 3300005530 Ga0070679_100601344 Ga0070679_1006013442 129
64 3300005548 Ga0070665_100336505 Ga0070665_1003365052 129
65 3300005563 Ga0068855_100185337 Ga0068855_1001853373 129
66 3300005563 Ga0068855_100412557 Ga0068855_1004125573 129
67 3300005564 Ga0070664_100511263 Ga0070664_1005112632 129
68 3300005578 Ga0068854_100836683 Ga0068854_1008366832 129
69 3300005614 Ga0068856_102558487 Ga0068856_1025584871 129
70 3300005616 Ga0068852_100096499 Ga0068852_1000964993 129
71 3300005616 Ga0068852_100216249 Ga0068852_1002162492 129
72 3300005616 Ga0068852_102474988 Ga0068852_1024749881 129
73 3300005617 Ga0068859_100095578 Ga0068859_1000955782 129
74 3300005844 Ga0068862_100061815 Ga0068862_1000618152 129
75 3300005985 Ga0081539_10077068 Ga0081539_100770682 129
76 3300006931 Ga0097620_100095579 Ga0097620_1000955792 129
77 3300009094 Ga0111539_10890323 Ga0111539_108903232 129
78 3300009094 Ga0111539_11369870 Ga0111539_113698702 129
79 3300009147 Ga0114129_10574288 Ga0114129_105742882 129
80 3300009147 Ga0114129_11643500 Ga0114129_116435002 129
81 3300009177 Ga0105248_10046168 Ga0105248_100461685 129
82 3300013100 Ga0157373_10142755 Ga0157373_101427553 129
83 3300013102 Ga0157371_10217504 Ga0157371_102175042 129
84 3300013102 Ga0157371_10572054 Ga0157371_105720542 129
85 3300013105 Ga0157369_10050322 Ga0157369_100503226 129
86 3300013105 Ga0157369_10301443 Ga0157369_103014432 129
87 3300020081 Ga0206354_10926119 Ga0206354_109261193 129
88 3300020082 Ga0206353_11051854 Ga0206353_110518542 129
89 3300021377 Ga0213874_10071144 Ga0213874_100711442 129
90 3300021388 Ga0213875_10000897 Ga0213875_1000089721 129
91 3300025909 Ga0207705_10042705 Ga0207705_100427054 129
92 3300025909 Ga0207705_10170095 Ga0207705_101700952 129
93 3300025909 Ga0207705_10206437 Ga0207705_102064372 129
94 3300025909 Ga0207705_10635177 Ga0207705_106351771 129
95 3300025909 Ga0207705_10808901 Ga0207705_108089012 129
96 3300025912 Ga0207707_10023714 Ga0207707_100237142 129
97 3300025917 Ga0207660_10000036 Ga0207660_100000369 129
98 3300025917 Ga0207660_10000199 Ga0207660_100001997 129
99 3300025919 Ga0207657_10007497 Ga0207657_1000749714 129
100 3300025919 Ga0207657_10008812 Ga0207657_100088123 129
101 3300025919 Ga0207657_10024233 Ga0207657_100242332 129
102 3300025920 Ga0207649_10000047 Ga0207649_1000004777 129
103 3300025920 Ga0207649_10454683 Ga0207649_104546832 129
104 3300025921 Ga0207652_10000001 Ga0207652_10000001427 129
105 3300025921 Ga0207652_10000002 Ga0207652_10000002301 129
106 3300025932 Ga0207690_10011098 Ga0207690_100110983 129
107 3300025932 Ga0207690_10012858 Ga0207690_100128583 129
108 3300025932 Ga0207690_10502140 Ga0207690_105021402 129
109 3300025933 Ga0207706_10038993 Ga0207706_100389933 129
110 3300025941 Ga0207711_10118799 Ga0207711_101187992 129
111 3300025944 Ga0207661_10029364 Ga0207661_100293642 129
112 3300025945 Ga0207679_10194373 Ga0207679_101943731 129
113 3300025961 Ga0207712_10086406 Ga0207712_100864062 129
114 3300025972 Ga0207668_10845163 Ga0207668_108451632 129
115 3300025986 Ga0207658_10590190 Ga0207658_105901902 129
116 3300026041 Ga0207639_10145619 Ga0207639_101456193 129
117 3300026041 Ga0207639_10741281 Ga0207639_107412812 129
118 3300026067 Ga0207678_10197127 Ga0207678_101971272 129
119 3300026078 Ga0207702_10084501 Ga0207702_100845013 129
120 3300026116 Ga0207674_11238000 Ga0207674_112380002 129
121 3300026142 Ga0207698_10438539 Ga0207698_104385392 129
122 3300026142 Ga0207698_11580033 Ga0207698_115800332 129
123 3300026142 Ga0207698_12185907 Ga0207698_121859072 129
124 3300028380 Ga0268265_10143210 Ga0268265_101432102 129
125 3300028381 Ga0268264_11603411 Ga0268264_116034111 129
126 3300031548 Ga0307408_100491344 Ga0307408_1004913442 129
127 3300031731 Ga0307405_10391870 Ga0307405_103918702 129
128 3300031852 Ga0307410_10980081 Ga0307410_109800811 129
129 3300031995 Ga0307409_100074332 Ga0307409_1000743322 129
130 3300031995 Ga0307409_100083134 Ga0307409_1000831342 129
131 3300031995 Ga0307409_100099135 Ga0307409_1000991352 129
132 3300032002 Ga0307416_100810198 Ga0307416_1008101982 129
133 3300032002 Ga0307416_101396588 Ga0307416_1013965882 129
134 3300032004 Ga0307414_10118374 Ga0307414_101183742 129
135 3300032004 Ga0307414_10720124 Ga0307414_107201242 129
136 3300032005 Ga0307411_10491778 Ga0307411_104917782 129
137 3300032126 Ga0307415_100239618 Ga0307415_1002396182 129
138 3300032126 Ga0307415_101629622 Ga0307415_1016296222 129
139 3300037312 Ga0395899_0384195 Ga0395899_0384195_205_594 129
140 3300037418 Ga0395900_0136668 Ga0395900_0136668_625_1014 129
141 3300037418 Ga0395900_0319086 Ga0395900_0319086_45_434 129
142 3300037418 Ga0395900_1055357 Ga0395900_1055357_229_630 129
143 3300037418 Ga0395900_1130705 Ga0395900_1130705_269_658 129
144 3300037466 Ga0395898_0303229 Ga0395898_0303229_604_993 129
145 3300037466 Ga0395898_0361362 Ga0395898_0361362_448_837 129
146 3300037466 Ga0395898_0604288 Ga0395898_0604288_331_720 129
147 3300037471 Ga0395905_0007794 Ga0395905_0007794_8065_8454 129
148 3300037471 Ga0395905_0010277 Ga0395905_0010277_5151_5552 129
149 3300037471 Ga0395905_0021242 Ga0395905_0021242_4538_4927 129
150 3300037471 Ga0395905_0266960 Ga0395905_0266960_1060_1467 129
151 3300037471 Ga0395905_1507959 Ga0395905_1507959_55_444 129
152 3300037853 Ga0436364_0267368 Ga0436364_0267368_11761_12162 129
153 3300038443 Ga0395901_0006958 Ga0395901_0006958_1375_1764 129
154 3300038443 Ga0395901_0872523 Ga0395901_0872523_229_618 129
155 3300038443 Ga0395901_0937080 Ga0395901_0937080_186_575 129
156 3300038443 Ga0395901_1413432 Ga0395901_1413432_105_494 129
157 3300044684 Ga0466966_0615823 Ga0466966_0615823_79_480 129
158 3300044693 Ga0466961_0638144 Ga0466961_0638144_204_596 129
159 3300044694 Ga0466963_0067907 Ga0466963_0067907_1096_1488 129
160 3300044694 Ga0466963_0083375 Ga0466963_0083375_228_620 129
161 3300044719 Ga0466971_0042683 Ga0466971_0042683_1529_1921 129
162 3300044842 Ga0466957_0013658 Ga0466957_0013658_252_644 129
163 3300044842 Ga0466957_0510718 Ga0466957_0510718_67_468 129
164 3300044842 Ga0466957_0536834 Ga0466957_0536834_99_491 129
165 3300045836 Ga0466958_0037364 Ga0466958_0037364_1834_2226 129
166 3300045836 Ga0466958_0072307 Ga0466958_0072307_616_1008 129
167 3300045976 Ga0466967_0066934 Ga0466967_0066934_2435_2827 129
168 3300045976 Ga0466967_0214124 Ga0466967_0214124_738_1127 129
169 3300045976 Ga0466967_0273359 Ga0466967_0273359_585_974 129
170 3300046525 Ga0495663_0069117 Ga0495663_0069117_435_824 129
171 3300047447 Ga0495685_228265 Ga0495685_228265_96_485 129
172 3300050507 nmdc:mga05p37_1415707_c1 nmdc:mga05p37_1415707_c1_232_633 129
173 3300050507 nmdc:mga05p37_2026547_c1 nmdc:mga05p37_2026547_c1_55_456 129
174 3300061719 Ga0466962_0202451 Ga0466962_0202451_144_536 129

Structural Annotation

Top 5 Hits

ID Description Score Start End
6biq-assembly5.cif.gz_D structure of nlpc2 from trichomonas vaginalis 0.7603 3 126
6biq-assembly4.cif.gz_C structure of nlpc2 from trichomonas vaginalis 0.758 3 129
7cfl-assembly4.cif.gz_D x-ray structure of autolysin acd24020 catalytic domain from clostridium difficile 0.7397 1 127
6b8c-assembly1.cif.gz_A crystal structure of nlpc/p60 domain of peptidoglycan hydrolase saga 0.7383 4 113
7cfl-assembly4.cif.gz_D x-ray structure of autolysin acd24020 catalytic domain from clostridium difficile 0.7343 1 127
ID Description Score Start End Superfamily
af_D3YXJ5_108_216_3.90.1720.10 Alpha Beta;Alpha-Beta Complex;endopeptidase fold (from Nostoc punctiforme);endopeptidase domain like (from Nostoc punctiforme) 0.7536 72 103 3.90.1720.10
af_K7UBM1_7_168_3.90.1720.10 Alpha Beta;Alpha-Beta Complex;endopeptidase fold (from Nostoc punctiforme);endopeptidase domain like (from Nostoc punctiforme) 0.7402 68 101 3.90.1720.10
af_P9WHU3_241_385_3.90.1720.10 Alpha Beta;Alpha-Beta Complex;endopeptidase fold (from Nostoc punctiforme);endopeptidase domain like (from Nostoc punctiforme) 0.7244 4 127 3.90.1720.10
af_O95237_37_179_3.90.1720.10 Alpha Beta;Alpha-Beta Complex;endopeptidase fold (from Nostoc punctiforme);endopeptidase domain like (from Nostoc punctiforme) 0.7137 72 101 3.90.1720.10
af_P23898_36_154_3.90.1720.10 Alpha Beta;Alpha-Beta Complex;endopeptidase fold (from Nostoc punctiforme);endopeptidase domain like (from Nostoc punctiforme) 0.6912 4 125 3.90.1720.10
ID Description Score Start End GO Terms
AF-A0A0E9MQE0-F1-model_v4 Uncharacterized protein 0.9551 56 128
AF-A0A0Q4D267-F1-model_v4 NlpC/P60 domain-containing protein 0.9436 4 126 GO:0008234
AF-A0A0Q4IIY7-F1-model_v4 NlpC/P60 domain-containing protein 0.9424 4 125 GO:0008234
AF-A0A525HP93-F1-model_v4 Peptidoglycan endopeptidase 0.9393 13 128
AF-A0A7W7EZJ9-F1-model_v4 Cell wall-associated NlpC family hydrolase 0.935 1 126 GO:0008234

Feature Viewer

pLDDT pTM Quality
92.59 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map