F265306

General Info

Members Datasets Scaffolds Average Seq Length
174 127 348 387

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0090832|Ga0501034_0090832_1806_2978
Length 390
Sequence MSAPDFLPFALPDIGDDEINEVVDALRSGWVTTGPKTKRFEEDFAAFLGEPGLHAVAVNSATAGLHLALEALGLGPGDEVITTTHTFTATAEVARYLGADVRLVDIDPATLNIDAAAVEAAVGPRTRAIVPVHYAGLAADMDAIGAVAARHGLGVVEDAAHALPTTWRGRLVGTLGSSSTVFSFYANKTMTTGEGGMLVTRDEAVFKRSKVMRLHGINRDAFDRYTSQAPSWYYEIVAPGFKYNLTDVAAAMGLHQLRRVRGFQVRREQIARQFDEAFADLPLILPPRPRHAGDLHAWHLYVVRLRDDAPLGRDAFIEAMYKAGIGCSVHYIPLHLHPYWRERYGLSPAQFPHSQHAFERMVSLPLYTRMGEADVQRVIDTVRRLLTQGA

Samples

Sample ID Description Type Environment
1 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
7 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
22 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
23 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
24 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
25 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
26 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
28 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
29 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
30 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
33 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
34 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
35 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
36 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
37 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
38 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
39 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
40 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
41 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
42 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
43 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
68 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
69 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
70 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
71 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
72 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
73 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
74 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
75 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
76 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
77 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
78 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
79 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
80 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
81 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
82 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
83 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
84 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
85 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
86 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
87 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
88 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
89 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
90 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
91 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
92 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
93 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
94 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
95 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
96 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
97 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
98 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
99 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
100 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
101 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
102 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
103 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
104 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
105 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
106 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
107 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
108 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
109 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
110 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
111 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
112 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
113 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
114 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
115 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
116 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
117 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
118 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
119 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
120 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
121 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
122 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
123 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
124 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
125 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
126 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
127 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.55
Metatranscriptomes 0
Isolates 3.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.39
Nodule 0
Rhizoplane 2.87
Rhizosphere 64.94
Stem 0
Stem Tuber 0
Unclassified 0.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501034_0090832 3300049571 Bacteria 3051
2 JGI24740J21852_10015795 3300001979 Bacteria 2745
3 JGI25152J39213_1002287 3300002773 Bacteria 7391
4 JGI25150J39212_1006585 3300002774 Bacteria 2389
5 JGI25153J46596_10006572 3300003215 Bacteria 5862
6 Ga0055526_1011260 3300003771 Bacteria 4053
7 Ga0065165_1002976 3300005262 Bacteria 12860
8 Ga0070658_10015162 3300005327 Bacteria 6168
9 Ga0070670_100075814 3300005331 Bacteria 2889
10 Ga0070666_10009824 3300005335 Bacteria 5975
11 Ga0068868_100011718 3300005338 Bacteria 6388
12 Ga0070675_100022260 3300005354 Bacteria 5062
13 Ga0070675_100040376 3300005354 Bacteria 3809
14 Ga0070671_100016583 3300005355 Bacteria 5955
15 Ga0070671_100030192 3300005355 Bacteria 4473
16 Ga0070674_100006461 3300005356 Bacteria 6842
17 Ga0070673_100077922 3300005364 Bacteria 2679
18 Ga0070673_100278213 3300005364 Bacteria 1467
19 Ga0070667_100017292 3300005367 Bacteria 5975
20 Ga0070696_100020539 3300005546 Bacteria 4475
21 Ga0070665_100065315 3300005548 Bacteria 3650
22 Ga0068855_100009084 3300005563 Bacteria 12012
23 Ga0068857_100022784 3300005577 Bacteria 5510
24 Ga0068864_100183009 3300005618 Bacteria 1916
25 Ga0068863_100030094 3300005841 Bacteria 5186
26 Ga0068858_100008718 3300005842 Bacteria 9736
27 Ga0075367_10012250 3300006178 Bacteria 4564
28 Ga0075367_10025220 3300006178 Bacteria 3360
29 Ga0075366_10000139 3300006195 Bacteria 30628
30 Ga0075366_10001435 3300006195 Bacteria 11892
31 Ga0075366_10007660 3300006195 Bacteria 5974
32 Ga0075366_10152348 3300006195 Bacteria 1400
33 Ga0097621_100102408 3300006237 Bacteria 2410
34 Ga0075370_10000064 3300006353 Bacteria 31947
35 Ga0075370_10001457 3300006353 Bacteria 10272
36 Ga0075370_10072327 3300006353 Bacteria 1974
37 Ga0068871_100025620 3300006358 Bacteria 4592
38 Ga0068871_100150937 3300006358 Bacteria 1982
39 Ga0075430_100003833 3300006846 Bacteria 12661
40 Ga0075429_100000282 3300006880 Bacteria 35849
41 Ga0075429_100004462 3300006880 Bacteria 12041
42 Ga0105240_10028904 3300009093 Bacteria 7232
43 Ga0105240_10051159 3300009093 Bacteria 5202
44 Ga0105237_10006482 3300009545 Bacteria 12972
45 Ga0105239_10019070 3300010375 Bacteria 7580
46 Ga0157378_10461148 3300013297 Bacteria 1263
47 Ga0163163_10094111 3300014325 Bacteria 3013
48 Ga0157379_10019808 3300014968 Bacteria 5946
49 Ga0157376_10055388 3300014969 Bacteria 3308
50 Ga0207425_1000363 3300025245 Bacteria 31420
51 Ga0209129_1000062 3300025258 Bacteria 240655
52 Ga0209673_1006813 3300025273 Bacteria 5424
53 Ga0209564_1000176 3300025295 Bacteria 152363
54 Ga0209758_1000129 3300025297 Bacteria 185022
55 Ga0209758_1000327 3300025297 Bacteria 89663
56 Ga0207656_10072653 3300025321 Bacteria 1532
57 Ga0207682_10003203 3300025893 Bacteria 7163
58 Ga0207645_10029597 3300025907 Bacteria 3530
59 Ga0207645_10035431 3300025907 Bacteria 3204
60 Ga0207705_10040038 3300025909 Bacteria 3359
61 Ga0207684_10154641 3300025910 Unclassified 1974
62 Ga0207695_10091708 3300025913 Bacteria 3051
63 Ga0207681_10127133 3300025923 Bacteria 1879
64 Ga0207650_10145995 3300025925 Bacteria 1863
65 Ga0207659_10002872 3300025926 Bacteria 10254
66 Ga0207687_10338963 3300025927 Bacteria 1222
67 Ga0207644_10011823 3300025931 Bacteria 5781
68 Ga0207644_10016848 3300025931 Bacteria 4923
69 Ga0207644_10179172 3300025931 Bacteria 1660
70 Ga0207644_10220875 3300025931 Bacteria 1502
71 Ga0207706_10094802 3300025933 Bacteria 2626
72 Ga0207669_10039292 3300025937 Bacteria 2733
73 Ga0207691_10003158 3300025940 Bacteria 16114
74 Ga0207689_10085614 3300025942 Bacteria 2591
75 Ga0207667_10069442 3300025949 Bacteria 3667
76 Ga0207640_10210620 3300025981 Bacteria 1480
77 Ga0207677_10007705 3300026023 Bacteria 5977
78 Ga0207641_10035307 3300026088 Bacteria 4164
79 Ga0207648_10006456 3300026089 Bacteria 11652
80 Ga0207648_10034445 3300026089 Bacteria 4464
81 Ga0207648_10068034 3300026089 Bacteria 3104
82 Ga0207648_10069898 3300026089 Bacteria 3060
83 Ga0207676_10047540 3300026095 Bacteria 3326
84 Ga0207676_10197013 3300026095 Bacteria 1777
85 Ga0207674_10023266 3300026116 Bacteria 6638
86 Ga0207683_10025352 3300026121 Bacteria 5115
87 Ga0207698_10075982 3300026142 Bacteria 2687
88 Ga0307517_10039449 3300028786 Bacteria 5185
89 Ga0307515_10002251 3300028794 Bacteria 42303
90 Ga0307515_10003180 3300028794 Bacteria 34757
91 Ga0307515_10131674 3300028794 Bacteria 2749
92 Ga0307515_10220485 3300028794 Bacteria 1716
93 Ga0307512_10098665 3300030522 Bacteria 1992
94 Ga0265339_10006657 3300031249 Bacteria 7560
95 Ga0265327_10064200 3300031251 Bacteria 1862
96 Ga0307513_10006149 3300031456 Bacteria 15752
97 Ga0307513_10028696 3300031456 Bacteria 6356
98 Ga0307513_10318564 3300031456 Bacteria 1314
99 Ga0307509_10000904 3300031507 Bacteria 50711
100 Ga0307509_10001327 3300031507 Bacteria 41950
101 Ga0307509_10073588 3300031507 Bacteria 3557
102 Ga0307509_10113933 3300031507 Bacteria 2700
103 Ga0307509_10149189 3300031507 Bacteria 2258
104 Ga0307509_10209441 3300031507 Bacteria 1776
105 Ga0307508_10000123 3300031616 Bacteria 92439
106 Ga0307508_10019053 3300031616 Bacteria 6236
107 Ga0307508_10062028 3300031616 Bacteria 3300
108 Ga0265342_10011073 3300031712 Bacteria 6190
109 Ga0307516_10000127 3300031730 Bacteria 90180
110 Ga0307516_10000438 3300031730 Bacteria 54750
111 Ga0307405_10013335 3300031731 Bacteria 4381
112 Ga0307413_10006847 3300031824 Bacteria 5243
113 Ga0307410_10005155 3300031852 Bacteria 6876
114 Ga0307410_10068163 3300031852 Bacteria 2456
115 Ga0307406_10005634 3300031901 Bacteria 6846
116 Ga0307406_10098230 3300031901 Bacteria 1988
117 Ga0307407_10074429 3300031903 Bacteria 2032
118 Ga0307412_10028342 3300031911 Bacteria 3502
119 Ga0307412_10090655 3300031911 Bacteria 2137
120 Ga0307409_100028410 3300031995 Bacteria 3984
121 Ga0307409_100240446 3300031995 Bacteria 1648
122 Ga0307416_100045577 3300032002 Bacteria 3454
123 Ga0307411_10002555 3300032005 Bacteria 8117
124 Ga0307411_10009352 3300032005 Bacteria 5147
125 Ga0307415_100024725 3300032126 Bacteria 3757
126 Ga0307510_10000122 3300033180 Bacteria 62024
127 Ga0373937_0041184 3300036401 Bacteria 4214
128 Ga0395905_0002018 3300037471 Bacteria 23204
129 Ga0439455_0002824 3300042012 Bacteria 3227
130 Ga0451577_0000697 3300042876 Bacteria 52454
131 Ga0451577_0010832 3300042876 Bacteria 8668
132 Ga0466972_0005063 3300044658 Bacteria 6606
133 Ga0466966_0042192 3300044684 Bacteria 2930
134 Ga0453684_0001396 3300044712 Bacteria 69884
135 Ga0453684_0157285 3300044712 Bacteria 2693
136 Ga0466959_0220552 3300045049 Bacteria 1315
137 Ga0495629_0108283 3300046459 Bacteria 1938
138 Ga0495610_0016888 3300046512 Bacteria 4182
139 Ga0495620_0051975 3300046515 Bacteria 1742
140 Ga0495632_0010786 3300046519 Bacteria 5380
141 Ga0495632_0023201 3300046519 Bacteria 3316
142 Ga0495645_0052522 3300046543 Bacteria 2965
143 Ga0495625_0000929 3300046660 Bacteria 39380
144 Ga0495625_0010045 3300046660 Bacteria 7867
145 Ga0495659_0034441 3300046664 Bacteria 1781
146 Ga0495604_0000852 3300047317 Bacteria 25474
147 Ga0495686_0106046 3300047472 Bacteria 1690
148 Ga0496102_0003049 3300048905 Bacteria 14192
149 Ga0496104_0000036 3300048907 Bacteria 180472
150 Ga0496106_0040507 3300048909 Bacteria 3489
151 Ga0496110_0000496 3300048913 Bacteria 26770
152 Ga0496111_0005319 3300048914 Bacteria 8224
153 Ga0501044_0318632 3300049823 Bacteria 1480
154 nmdc:mga03683_3510_c1 3300050489 Bacteria 5075
155 nmdc:mga0k408_155476_c1 3300050493 Bacteria 1362
156 nmdc:mga0k408_42420_c1 3300050493 Bacteria 2621
157 nmdc:mga06z11_43792_c1 3300050494 Bacteria 2254
158 nmdc:mga07m45_13666_c1 3300050496 Bacteria 4312
159 nmdc:mga07m45_1742_c1 3300050496 Bacteria 10017
160 nmdc:mga09592_425_c1 3300050508 Bacteria 31113
161 nmdc:mga09592_7794_c1 3300050508 Bacteria 8702
162 nmdc:mga0qj67_6075_c1 3300050509 Bacteria 8847
163 Ga0500578_0000079 3300053086 Bacteria 107137
164 Ga0500578_0085721 3300053086 Bacteria 2001
165 Ga0500568_0015245 3300053139 Bacteria 3445
166 Ga0500604_0022137 3300053151 Bacteria 1802
167 Ga0500619_000048 3300053154 Bacteria 37454
168 Ga0500645_005510 3300053730 Bacteria 4643
169 2587728076 2585428057 Bacteria 6737412
170 2587731137 2585428058 Bacteria 6853932
171 2588289890 2588253510 Bacteria 6901809
172 2643972311 2643221592 Bacteria 6608788
173 2644141578 2643221625 Bacteria 6512927
174 2644275651 2643221648 Bacteria 6521465
175 Ga0501034_0090832
176 JGI24740J21852_10015795
177 JGI25152J39213_1002287
178 JGI25150J39212_1006585
179 JGI25153J46596_10006572
180 Ga0055526_1011260
181 Ga0065165_1002976
182 Ga0070658_10015162
183 Ga0070670_100075814
184 Ga0070666_10009824
185 Ga0068868_100011718
186 Ga0070675_100022260
187 Ga0070675_100040376
188 Ga0070671_100016583
189 Ga0070671_100030192
190 Ga0070674_100006461
191 Ga0070673_100077922
192 Ga0070673_100278213
193 Ga0070667_100017292
194 Ga0070696_100020539
195 Ga0070665_100065315
196 Ga0068855_100009084
197 Ga0068857_100022784
198 Ga0068864_100183009
199 Ga0068863_100030094
200 Ga0068858_100008718
201 Ga0075367_10012250
202 Ga0075367_10025220
203 Ga0075366_10000139
204 Ga0075366_10001435
205 Ga0075366_10007660
206 Ga0075366_10152348
207 Ga0097621_100102408
208 Ga0075370_10000064
209 Ga0075370_10001457
210 Ga0075370_10072327
211 Ga0068871_100025620
212 Ga0068871_100150937
213 Ga0075430_100003833
214 Ga0075429_100000282
215 Ga0075429_100004462
216 Ga0105240_10028904
217 Ga0105240_10051159
218 Ga0105237_10006482
219 Ga0105239_10019070
220 Ga0157378_10461148
221 Ga0163163_10094111
222 Ga0157379_10019808
223 Ga0157376_10055388
224 Ga0207425_1000363
225 Ga0209129_1000062
226 Ga0209673_1006813
227 Ga0209564_1000176
228 Ga0209758_1000129
229 Ga0209758_1000327
230 Ga0207656_10072653
231 Ga0207682_10003203
232 Ga0207645_10029597
233 Ga0207645_10035431
234 Ga0207705_10040038
235 Ga0207684_10154641
236 Ga0207695_10091708
237 Ga0207681_10127133
238 Ga0207650_10145995
239 Ga0207659_10002872
240 Ga0207687_10338963
241 Ga0207644_10011823
242 Ga0207644_10016848
243 Ga0207644_10179172
244 Ga0207644_10220875
245 Ga0207706_10094802
246 Ga0207669_10039292
247 Ga0207691_10003158
248 Ga0207689_10085614
249 Ga0207667_10069442
250 Ga0207640_10210620
251 Ga0207677_10007705
252 Ga0207641_10035307
253 Ga0207648_10006456
254 Ga0207648_10034445
255 Ga0207648_10068034
256 Ga0207648_10069898
257 Ga0207676_10047540
258 Ga0207676_10197013
259 Ga0207674_10023266
260 Ga0207683_10025352
261 Ga0207698_10075982
262 Ga0307517_10039449
263 Ga0307515_10002251
264 Ga0307515_10003180
265 Ga0307515_10131674
266 Ga0307515_10220485
267 Ga0307512_10098665
268 Ga0265339_10006657
269 Ga0265327_10064200
270 Ga0307513_10006149
271 Ga0307513_10028696
272 Ga0307513_10318564
273 Ga0307509_10000904
274 Ga0307509_10001327
275 Ga0307509_10073588
276 Ga0307509_10113933
277 Ga0307509_10149189
278 Ga0307509_10209441
279 Ga0307508_10000123
280 Ga0307508_10019053
281 Ga0307508_10062028
282 Ga0265342_10011073
283 Ga0307516_10000127
284 Ga0307516_10000438
285 Ga0307405_10013335
286 Ga0307413_10006847
287 Ga0307410_10005155
288 Ga0307410_10068163
289 Ga0307406_10005634
290 Ga0307406_10098230
291 Ga0307407_10074429
292 Ga0307412_10028342
293 Ga0307412_10090655
294 Ga0307409_100028410
295 Ga0307409_100240446
296 Ga0307416_100045577
297 Ga0307411_10002555
298 Ga0307411_10009352
299 Ga0307415_100024725
300 Ga0307510_10000122
301 Ga0373937_0041184
302 Ga0395905_0002018
303 Ga0439455_0002824
304 Ga0451577_0000697
305 Ga0451577_0010832
306 Ga0466972_0005063
307 Ga0466966_0042192
308 Ga0453684_0001396
309 Ga0453684_0157285
310 Ga0466959_0220552
311 Ga0495629_0108283
312 Ga0495610_0016888
313 Ga0495620_0051975
314 Ga0495632_0010786
315 Ga0495632_0023201
316 Ga0495645_0052522
317 Ga0495625_0000929
318 Ga0495625_0010045
319 Ga0495659_0034441
320 Ga0495604_0000852
321 Ga0495686_0106046
322 Ga0496102_0003049
323 Ga0496104_0000036
324 Ga0496106_0040507
325 Ga0496110_0000496
326 Ga0496111_0005319
327 Ga0501044_0318632
328 nmdc:mga03683_3510_c1
329 nmdc:mga0k408_155476_c1
330 nmdc:mga0k408_42420_c1
331 nmdc:mga06z11_43792_c1
332 nmdc:mga07m45_13666_c1
333 nmdc:mga07m45_1742_c1
334 nmdc:mga09592_425_c1
335 nmdc:mga09592_7794_c1
336 nmdc:mga0qj67_6075_c1
337 Ga0500578_0000079
338 Ga0500578_0085721
339 Ga0500568_0015245
340 Ga0500604_0022137
341 Ga0500619_000048
342 Ga0500645_005510
343 2587728076
344 2587731137
345 2588289890
346 2643972311
347 2644141578
348 2644275651

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01041

DegT_DnrJ_EryC1

DegT/DnrJ/EryC1/StrS aminotransferase family

12

383

0.96

PF00155

Aminotran_1_2

Aminotransferase class I and II

18

163

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
1mdx-assembly1.cif.gz_A crystal structure of arnb transferase with pyridoxal 5' phosphate 0.968 10 390
1mdo-assembly1.cif.gz_A crystal structure of arnb aminotransferase with pyridomine 5' phosphate 0.9656 10 390
8su6-assembly1.cif.gz_B crystal structure of arnb transferase from klebsiella aerogenes (lattice translocation disorder, p1 form2) 0.9634 10 390
1mdx-assembly1.cif.gz_A crystal structure of arnb transferase with pyridoxal 5' phosphate 0.9628 10 390
4oca-assembly1.cif.gz_A-2 cryatal structure of arnb k188a complexted with plp and udp-ara4n 0.9614 9 390
ID Description Score Start End Superfamily
af_Q58466_2_255_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9881 10 262 3.40.640.10
1mdxA01 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9749 10 262 3.40.640.10
4lc3B01 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9674 9 262 3.40.640.10
af_Q58466_2_255_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.965 10 262 3.40.640.10
1mdxA01 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.963 10 262 3.40.640.10
ID Description Score Start End GO Terms
AF-X1S2V2-F1-model_v4 DegT/DnrJ/EryC1/StrS aminotransferase family protein 0.9837 82 220 GO:0000271
GO:0008483
GO:0030170
AF-A0A2M8Q735-F1-model_v4 Aminotransferase DegT 0.9792 20 157 GO:0000271
GO:0008483
GO:0030170
AF-A0A7C3BBA8-F1-model_v4 DegT/DnrJ/EryC1/StrS family aminotransferase 0.9781 10 389 GO:0000271
GO:0008483
GO:0030170
AF-A0A1Q7RLX2-F1-model_v4 UDP-4-amino-4, 6-dideoxy-N-acetyl-beta-L-altrosamine transaminase 0.9779 11 389 GO:0000271
GO:0008483
GO:0030170
AF-A0A3D5DEC6-F1-model_v4 Aminotransferase DegT 0.9776 73 195 GO:0000271
GO:0008483
GO:0030170

Map