F266170

General Info

Members Datasets Scaffolds Average Seq Length
175 109 175 192

Family's Representative Sequence

Representative Sequence 3300006852|Ga0075433_10018764|Ga0075433_100187646
Length 198
Sequence VGLGQAGGPVTLGTLPTREQALALLHEWIQNPNLRKHCYAVEAAMRAYAVRFDGDPERWGLTGLIHDFDWERHPDLERHPMQGVEILRAQGWPEDICRAVLGHAVHSGVPRDTTMAKALYACDEVAGFVVACALVTPTKSLDQIEVASVRKKMKRADFARNVNREDMVNGAAELGVELDQHIAFVLEAMLGIKGELGL

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
35 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
36 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
39 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
46 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
47 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
48 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
72 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
73 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
74 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
75 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
76 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
77 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
78 3300036534 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
79 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
80 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
81 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
82 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
83 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
84 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
85 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
86 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
87 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
88 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
89 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
90 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
91 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
92 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
93 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
94 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
95 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
96 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
99 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
100 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
101 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
102 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
103 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
104 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
105 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
106 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
107 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
108 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
109 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.57
Metatranscriptomes 3.43
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 97.14
Stem 0
Stem Tuber 0
Unclassified 2.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10716141 3300005327 Bacteria 869
2 Ga0070690_100008639 3300005330 Bacteria 5873
3 Ga0068869_100025416 3300005334 Bacteria 4112
4 Ga0068868_100155815 3300005338 Bacteria 1884
5 Ga0070689_100002176 3300005340 Bacteria 12693
6 Ga0070689_100143490 3300005340 Bacteria 1922
7 Ga0070689_100188789 3300005340 Bacteria 1677
8 Ga0070691_10032470 3300005341 Bacteria 2453
9 Ga0070692_10038261 3300005345 Bacteria 2444
10 Ga0070669_100081262 3300005353 Bacteria 2414
11 Ga0070675_100021625 3300005354 Bacteria 5140
12 Ga0070673_100249035 3300005364 Bacteria 1548
13 Ga0070673_100358854 3300005364 Bacteria 1295
14 Ga0070688_100088497 3300005365 Bacteria 2019
15 Ga0070713_100071269 3300005436 Bacteria 2936
16 Ga0070713_100876694 3300005436 Bacteria 863
17 Ga0070700_100010826 3300005441 Bacteria 5042
18 Ga0070700_100091397 3300005441 Bacteria 1987
19 Ga0070700_100103108 3300005441 Unclassified 1883
20 Ga0070694_100021138 3300005444 Bacteria 4155
21 Ga0070708_100007070 3300005445 Bacteria 8954
22 Ga0070708_100030708 3300005445 Bacteria 4646
23 Ga0070708_100222043 3300005445 Unclassified 1772
24 Ga0070708_100494154 3300005445 Bacteria 1154
25 Ga0070708_100673674 3300005445 Unclassified 974
26 Ga0070708_101262337 3300005445 Unclassified 690
27 Ga0070681_10259645 3300005458 Unclassified 1649
28 Ga0068867_100026119 3300005459 Bacteria 4192
29 Ga0070706_100001928 3300005467 Bacteria 21387
30 Ga0070706_100002586 3300005467 Bacteria 18176
31 Ga0070706_100079426 3300005467 Bacteria 3036
32 Ga0070707_100000849 3300005468 Bacteria 30319
33 Ga0070707_100115235 3300005468 Bacteria 2608
34 Ga0070698_100036998 3300005471 Bacteria 5034
35 Ga0070698_100672241 3300005471 Bacteria 977
36 Ga0070698_100731069 3300005471 Bacteria 932
37 Ga0070699_100032741 3300005518 Bacteria 4489
38 Ga0070699_100032988 3300005518 Bacteria 4473
39 Ga0070699_100219740 3300005518 Bacteria 1693
40 Ga0070679_100042248 3300005530 Bacteria 4540
41 Ga0070697_100005020 3300005536 Bacteria 10165
42 Ga0070672_100091221 3300005543 Bacteria 2458
43 Ga0070686_100058151 3300005544 Bacteria 2487
44 Ga0070686_100785920 3300005544 Bacteria 766
45 Ga0070704_100871036 3300005549 Bacteria 808
46 Ga0068857_100025026 3300005577 Bacteria 5258
47 Ga0068857_100126289 3300005577 Unclassified 2305
48 Ga0068859_100019969 3300005617 Bacteria 6727
49 Ga0068859_100406270 3300005617 Bacteria 1458
50 Ga0068864_100218835 3300005618 Bacteria 1756
51 Ga0068861_100030138 3300005719 Unclassified 3974
52 Ga0070717_10006073 3300006028 Bacteria 8859
53 Ga0070717_10090882 3300006028 Bacteria 2577
54 Ga0070717_10616411 3300006028 Bacteria 984
55 Ga0070715_10102889 3300006163 Bacteria 1335
56 Ga0075428_100012358 3300006844 Bacteria 9500
57 Ga0075428_100055169 3300006844 Bacteria 4354
58 Ga0075430_100030901 3300006846 Bacteria 4548
59 Ga0075430_100224394 3300006846 Bacteria 1559
60 Ga0075431_100685414 3300006847 Bacteria 1003
61 Ga0075433_10018764 3300006852 Bacteria 5755
62 Ga0075433_10049359 3300006852 Bacteria 3661
63 Ga0075434_100008746 3300006871 Bacteria 9420
64 Ga0075434_100030372 3300006871 Bacteria 5320
65 Ga0075429_100012369 3300006880 Bacteria 7403
66 Ga0075429_100014601 3300006880 Bacteria 6807
67 Ga0075429_100311287 3300006880 Bacteria 1378
68 Ga0075436_100020558 3300006914 Bacteria 4531
69 Ga0075436_100180205 3300006914 Bacteria 1493
70 Ga0097620_100002014 3300006931 Bacteria 20732
71 Ga0097620_100019969 3300006931 Bacteria 6727
72 Ga0097620_100406303 3300006931 Bacteria 1458
73 Ga0111539_10089422 3300009094 Bacteria 3618
74 Ga0114129_10034132 3300009147 Bacteria 7186
75 Ga0114129_10426939 3300009147 Bacteria 1742
76 Ga0105248_10069055 3300009177 Bacteria 3967
77 Ga0105249_10050294 3300009553 Unclassified 3800
78 Ga0157380_10181481 3300014326 Bacteria 1850
79 Ga0157377_10302502 3300014745 Bacteria 1056
80 Ga0157379_10031193 3300014968 Bacteria 4748
81 Ga0157379_10353320 3300014968 Bacteria 1346
82 Ga0197907_10609940 3300020069 Bacteria 790
83 Ga0206352_10437964 3300020078 Bacteria 1563
84 Ga0206350_10348783 3300020080 Bacteria 972
85 Ga0206350_10771021 3300020080 Bacteria 2491
86 Ga0206350_11045060 3300020080 Bacteria 694
87 Ga0207705_10466634 3300025909 Bacteria 979
88 Ga0207684_10000812 3300025910 Bacteria 36095
89 Ga0207684_10002320 3300025910 Bacteria 19318
90 Ga0207684_10005059 3300025910 Bacteria 12286
91 Ga0207707_10217203 3300025912 Unclassified 1665
92 Ga0207652_10030066 3300025921 Bacteria 4547
93 Ga0207646_10003238 3300025922 Bacteria 18561
94 Ga0207646_10033135 3300025922 Bacteria 4674
95 Ga0207646_10933268 3300025922 Unclassified 769
96 Ga0207681_10031977 3300025923 Unclassified 3441
97 Ga0207659_10029450 3300025926 Bacteria 3742
98 Ga0207670_10032238 3300025936 Bacteria 3368
99 Ga0207670_10334333 3300025936 Bacteria 1195
100 Ga0207704_10408902 3300025938 Bacteria 1073
101 Ga0207704_10753511 3300025938 Bacteria 810
102 Ga0207691_10642542 3300025940 Bacteria 897
103 Ga0207711_10165320 3300025941 Bacteria 2005
104 Ga0207689_10087063 3300025942 Bacteria 2567
105 Ga0207651_10092973 3300025960 Bacteria 2213
106 Ga0207651_10321689 3300025960 Bacteria 1293
107 Ga0207677_10626910 3300026023 Bacteria 946
108 Ga0207703_10414662 3300026035 Bacteria 1252
109 Ga0207708_10019541 3300026075 Bacteria 5108
110 Ga0207708_10100052 3300026075 Unclassified 2243
111 Ga0207641_10139974 3300026088 Bacteria 2182
112 Ga0207648_10042477 3300026089 Bacteria 3991
113 Ga0207674_10034132 3300026116 Bacteria 5321
114 Ga0207675_100136270 3300026118 Unclassified 2330
115 Ga0207428_10016750 3300027907 Bacteria 6303
116 Ga0265336_10025466 3300028666 Bacteria 1864
117 Ga0265338_10014281 3300028800 Bacteria 8851
118 Ga0265338_10032749 3300028800 Bacteria 5059
119 Ga0265338_10127859 3300028800 Bacteria 2013
120 Ga0307416_100171804 3300032002 Bacteria 2019
121 Ga0373956_0004795 3300035119 Bacteria 5408
122 Ga0373927_0000365 3300035695 Bacteria 35153
123 Ga0373933_0002654 3300035724 Bacteria 10021
124 Ga0373933_0140496 3300035724 Bacteria 1524
125 Ga0310109_028286 3300036534 Bacteria 747
126 Ga0436364_1254153 3300037853 Unclassified 3250
127 Ga0436364_1301910 3300037853 Unclassified 2064
128 Ga0436365_1843504 3300039437 Unclassified 1952
129 Ga0436363_0003471 3300039450 Bacteria 8628
130 Ga0451577_0437197 3300042876 Bacteria 1188
131 Ga0466969_0000162 3300044656 Bacteria 36417
132 Ga0466972_0188686 3300044658 Bacteria 966
133 Ga0466966_0000797 3300044684 Bacteria 20099
134 Ga0466966_0049601 3300044684 Bacteria 2673
135 Ga0466966_0113164 3300044684 Bacteria 1671
136 Ga0466961_0055354 3300044693 Bacteria 2529
137 Ga0466961_0128549 3300044693 Bacteria 1588
138 Ga0466964_0001457 3300044706 Bacteria 8094
139 Ga0466968_0000009 3300044735 Bacteria 71593
140 Ga0466970_0000073 3300044765 Bacteria 40482
141 Ga0466957_0257233 3300044842 Bacteria 1162
142 Ga0451576_0013816 3300045051 Bacteria 9020
143 Ga0451576_0076140 3300045051 Bacteria 3492
144 Ga0451576_0134861 3300045051 Bacteria 2574
145 Ga0451576_0160658 3300045051 Bacteria 2345
146 Ga0451576_0203899 3300045051 Bacteria 2065
147 Ga0451576_0272449 3300045051 Bacteria 1769
148 Ga0451576_0425732 3300045051 Bacteria 1393
149 Ga0451576_0480229 3300045051 Unclassified 1305
150 Ga0466958_0049452 3300045836 Bacteria 2544
151 Ga0466958_0163039 3300045836 Bacteria 1409
152 Ga0466958_0381286 3300045836 Bacteria 909
153 Ga0466967_0077476 3300045976 Bacteria 2993
154 Ga0495676_0520560 3300047321 Bacteria 779
155 Ga0501301_016751 3300049524 Bacteria 666
156 Ga0501034_0568661 3300049571 Bacteria 1041
157 Ga0501037_0275421 3300049573 Bacteria 1173
158 Ga0501047_0022984 3300049581 Bacteria 5985
159 Ga0501080_0257978 3300049742 Bacteria 1588
160 Ga0501044_0009770 3300049823 Bacteria 10433
161 nmdc:mga05p37_125597_c1 3300050507 Unclassified 3151
162 nmdc:mga05p37_615530_c1 3300050507 Bacteria 1223
163 nmdc:mga09592_1111509_c1 3300050508 Bacteria 657
164 nmdc:mga09592_21738_c1 3300050508 Bacteria 5289
165 nmdc:mga09592_51695_c1 3300050508 Bacteria 3467
166 nmdc:mga0qj67_141829_c1 3300050509 Bacteria 1948
167 nmdc:mga0qj67_30375_c1 3300050509 Bacteria 4205
168 nmdc:mga06r32_530959_c1 3300050510 Bacteria 1152
169 nmdc:mga08y16_31509_c1 3300050511 Bacteria 5577
170 nmdc:mga0n895_231003_c1 3300050512 Bacteria 1878
171 nmdc:mga0n895_39117_c1 3300050512 Bacteria 4599
172 nmdc:mga08x19_198842_c1 3300050514 Bacteria 1373
173 nmdc:mga0a205_17876_c1 3300050515 Bacteria 5765
174 nmdc:mga0a205_24900_c1 3300050515 Bacteria 5696
175 Ga0466962_0030819 3300061719 Bacteria 2568

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300014326 Ga0157380_10181481 Ga0157380_101814813 166
2 3300045051 Ga0451576_0013816 Ga0451576_0013816_5552_6115 172
3 3300039437 Ga0436365_1843504 Ga0436365_1843504_646_1197 174
4 3300049571 Ga0501034_0568661 Ga0501034_0568661_121_678 174
5 3300049573 Ga0501037_0275421 Ga0501037_0275421_128_685 174
6 3300049581 Ga0501047_0022984 Ga0501047_0022984_4532_5089 174
7 3300049742 Ga0501080_0257978 Ga0501080_0257978_494_1051 174
8 3300049823 Ga0501044_0009770 Ga0501044_0009770_447_1004 174
9 3300035695 Ga0373927_0000365 Ga0373927_0000365_15531_16121 176
10 3300045051 Ga0451576_0134861 Ga0451576_0134861_709_1278 178
11 3300045051 Ga0451576_0480229 Ga0451576_0480229_10_579 178
12 3300049524 Ga0501301_016751 Ga0501301_016751_41_604 179
13 3300005436 Ga0070713_100071269 Ga0070713_1000712693 182
14 3300044684 Ga0466966_0049601 Ga0466966_0049601_676_1293 182
15 3300044693 Ga0466961_0055354 Ga0466961_0055354_1807_2424 182
16 3300044842 Ga0466957_0257233 Ga0466957_0257233_379_996 182
17 3300061719 Ga0466962_0030819 Ga0466962_0030819_163_780 182
18 3300005330 Ga0070690_100008639 Ga0070690_1000086395 183
19 3300005334 Ga0068869_100025416 Ga0068869_1000254163 183
20 3300005338 Ga0068868_100155815 Ga0068868_1001558152 183
21 3300005340 Ga0070689_100002176 Ga0070689_10000217612 183
22 3300005340 Ga0070689_100143490 Ga0070689_1001434903 183
23 3300005340 Ga0070689_100188789 Ga0070689_1001887893 183
24 3300005341 Ga0070691_10032470 Ga0070691_100324704 183
25 3300005345 Ga0070692_10038261 Ga0070692_100382613 183
26 3300005353 Ga0070669_100081262 Ga0070669_1000812623 183
27 3300005354 Ga0070675_100021625 Ga0070675_1000216253 183
28 3300005364 Ga0070673_100249035 Ga0070673_1002490353 183
29 3300005364 Ga0070673_100358854 Ga0070673_1003588543 183
30 3300005365 Ga0070688_100088497 Ga0070688_1000884972 183
31 3300005436 Ga0070713_100876694 Ga0070713_1008766941 183
32 3300005441 Ga0070700_100010826 Ga0070700_1000108262 183
33 3300005441 Ga0070700_100091397 Ga0070700_1000913972 183
34 3300005441 Ga0070700_100103108 Ga0070700_1001031083 183
35 3300005444 Ga0070694_100021138 Ga0070694_1000211383 183
36 3300005445 Ga0070708_100007070 Ga0070708_1000070702 183
37 3300005445 Ga0070708_100030708 Ga0070708_1000307081 183
38 3300005445 Ga0070708_100222043 Ga0070708_1002220433 183
39 3300005445 Ga0070708_100494154 Ga0070708_1004941542 183
40 3300005445 Ga0070708_100673674 Ga0070708_1006736742 183
41 3300005445 Ga0070708_101262337 Ga0070708_1012623371 183
42 3300005458 Ga0070681_10259645 Ga0070681_102596452 183
43 3300005459 Ga0068867_100026119 Ga0068867_1000261194 183
44 3300005467 Ga0070706_100001928 Ga0070706_10000192821 183
45 3300005467 Ga0070706_100002586 Ga0070706_10000258618 183
46 3300005467 Ga0070706_100079426 Ga0070706_1000794264 183
47 3300005468 Ga0070707_100000849 Ga0070707_1000008493 183
48 3300005468 Ga0070707_100115235 Ga0070707_1001152354 183
49 3300005471 Ga0070698_100036998 Ga0070698_1000369986 183
50 3300005471 Ga0070698_100672241 Ga0070698_1006722411 183
51 3300005471 Ga0070698_100731069 Ga0070698_1007310692 183
52 3300005518 Ga0070699_100032741 Ga0070699_1000327412 183
53 3300005518 Ga0070699_100032988 Ga0070699_1000329886 183
54 3300005530 Ga0070679_100042248 Ga0070679_1000422482 183
55 3300005536 Ga0070697_100005020 Ga0070697_10000502010 183
56 3300005543 Ga0070672_100091221 Ga0070672_1000912213 183
57 3300005544 Ga0070686_100058151 Ga0070686_1000581513 183
58 3300005544 Ga0070686_100785920 Ga0070686_1007859202 183
59 3300005577 Ga0068857_100025026 Ga0068857_1000250264 183
60 3300005577 Ga0068857_100126289 Ga0068857_1001262892 183
61 3300005617 Ga0068859_100019969 Ga0068859_1000199695 183
62 3300005617 Ga0068859_100406270 Ga0068859_1004062702 183
63 3300005618 Ga0068864_100218835 Ga0068864_1002188352 183
64 3300005719 Ga0068861_100030138 Ga0068861_1000301383 183
65 3300006028 Ga0070717_10006073 Ga0070717_100060737 183
66 3300006028 Ga0070717_10090882 Ga0070717_100908822 183
67 3300006028 Ga0070717_10616411 Ga0070717_106164111 183
68 3300006163 Ga0070715_10102889 Ga0070715_101028892 183
69 3300006844 Ga0075428_100012358 Ga0075428_1000123588 183
70 3300006844 Ga0075428_100055169 Ga0075428_1000551696 183
71 3300006846 Ga0075430_100030901 Ga0075430_1000309011 183
72 3300006847 Ga0075431_100685414 Ga0075431_1006854142 183
73 3300006852 Ga0075433_10018764 Ga0075433_100187646 183
74 3300006852 Ga0075433_10049359 Ga0075433_100493592 183
75 3300006871 Ga0075434_100008746 Ga0075434_1000087465 183
76 3300006871 Ga0075434_100030372 Ga0075434_1000303725 183
77 3300006880 Ga0075429_100014601 Ga0075429_1000146016 183
78 3300006880 Ga0075429_100311287 Ga0075429_1003112871 183
79 3300006914 Ga0075436_100180205 Ga0075436_1001802052 183
80 3300006931 Ga0097620_100002014 Ga0097620_10000201410 183
81 3300006931 Ga0097620_100019969 Ga0097620_1000199695 183
82 3300006931 Ga0097620_100406303 Ga0097620_1004063032 183
83 3300009094 Ga0111539_10089422 Ga0111539_100894224 183
84 3300009147 Ga0114129_10426939 Ga0114129_104269392 183
85 3300009177 Ga0105248_10069055 Ga0105248_100690553 183
86 3300009553 Ga0105249_10050294 Ga0105249_100502943 183
87 3300014745 Ga0157377_10302502 Ga0157377_103025023 183
88 3300014968 Ga0157379_10031193 Ga0157379_100311932 183
89 3300014968 Ga0157379_10353320 Ga0157379_103533201 183
90 3300020069 Ga0197907_10609940 Ga0197907_106099402 183
91 3300020078 Ga0206352_10437964 Ga0206352_104379643 183
92 3300020080 Ga0206350_10348783 Ga0206350_103487831 183
93 3300020080 Ga0206350_10771021 Ga0206350_107710214 183
94 3300020080 Ga0206350_11045060 Ga0206350_110450601 183
95 3300025910 Ga0207684_10000812 Ga0207684_1000081211 183
96 3300025910 Ga0207684_10002320 Ga0207684_100023202 183
97 3300025910 Ga0207684_10005059 Ga0207684_1000505911 183
98 3300025912 Ga0207707_10217203 Ga0207707_102172032 183
99 3300025921 Ga0207652_10030066 Ga0207652_100300662 183
100 3300025922 Ga0207646_10003238 Ga0207646_100032387 183
101 3300025922 Ga0207646_10033135 Ga0207646_100331354 183
102 3300025922 Ga0207646_10933268 Ga0207646_109332681 183
103 3300025923 Ga0207681_10031977 Ga0207681_100319773 183
104 3300025926 Ga0207659_10029450 Ga0207659_100294504 183
105 3300025936 Ga0207670_10032238 Ga0207670_100322382 183
106 3300025936 Ga0207670_10334333 Ga0207670_103343332 183
107 3300025938 Ga0207704_10408902 Ga0207704_104089021 183
108 3300025938 Ga0207704_10753511 Ga0207704_107535111 183
109 3300025940 Ga0207691_10642542 Ga0207691_106425422 183
110 3300025941 Ga0207711_10165320 Ga0207711_101653203 183
111 3300025942 Ga0207689_10087063 Ga0207689_100870633 183
112 3300025960 Ga0207651_10092973 Ga0207651_100929733 183
113 3300025960 Ga0207651_10321689 Ga0207651_103216891 183
114 3300026023 Ga0207677_10626910 Ga0207677_106269102 183
115 3300026035 Ga0207703_10414662 Ga0207703_104146622 183
116 3300026075 Ga0207708_10019541 Ga0207708_100195416 183
117 3300026075 Ga0207708_10100052 Ga0207708_101000522 183
118 3300026088 Ga0207641_10139974 Ga0207641_101399743 183
119 3300026089 Ga0207648_10042477 Ga0207648_100424773 183
120 3300026116 Ga0207674_10034132 Ga0207674_100341324 183
121 3300026118 Ga0207675_100136270 Ga0207675_1001362703 183
122 3300027907 Ga0207428_10016750 Ga0207428_100167503 183
123 3300028666 Ga0265336_10025466 Ga0265336_100254662 183
124 3300028800 Ga0265338_10014281 Ga0265338_100142816 183
125 3300028800 Ga0265338_10032749 Ga0265338_100327495 183
126 3300028800 Ga0265338_10127859 Ga0265338_101278593 183
127 3300035119 Ga0373956_0004795 Ga0373956_0004795_4676_5263 183
128 3300035724 Ga0373933_0002654 Ga0373933_0002654_2841_3437 183
129 3300035724 Ga0373933_0140496 Ga0373933_0140496_181_768 183
130 3300036534 Ga0310109_028286 Ga0310109_028286_31_621 183
131 3300037853 Ga0436364_1254153 Ga0436364_1254153_1796_2386 183
132 3300037853 Ga0436364_1301910 Ga0436364_1301910_382_972 183
133 3300039450 Ga0436363_0003471 Ga0436363_0003471_6642_7223 183
134 3300042876 Ga0451577_0437197 Ga0451577_0437197_536_1105 183
135 3300044656 Ga0466969_0000162 Ga0466969_0000162_28909_29493 183
136 3300044658 Ga0466972_0188686 Ga0466972_0188686_141_743 183
137 3300044684 Ga0466966_0000797 Ga0466966_0000797_7310_7894 183
138 3300044684 Ga0466966_0113164 Ga0466966_0113164_55_657 183
139 3300044693 Ga0466961_0128549 Ga0466961_0128549_681_1283 183
140 3300044706 Ga0466964_0001457 Ga0466964_0001457_222_806 183
141 3300044735 Ga0466968_0000009 Ga0466968_0000009_693_1277 183
142 3300044765 Ga0466970_0000073 Ga0466970_0000073_30530_31114 183
143 3300045051 Ga0451576_0076140 Ga0451576_0076140_2802_3377 183
144 3300045051 Ga0451576_0203899 Ga0451576_0203899_867_1436 183
145 3300045051 Ga0451576_0272449 Ga0451576_0272449_452_1021 183
146 3300045051 Ga0451576_0425732 Ga0451576_0425732_600_1181 183
147 3300045836 Ga0466958_0049452 Ga0466958_0049452_1707_2324 183
148 3300045836 Ga0466958_0381286 Ga0466958_0381286_175_759 183
149 3300047321 Ga0495676_0520560 Ga0495676_0520560_199_768 183
150 3300050507 nmdc:mga05p37_615530_c1 nmdc:mga05p37_615530_c1_67_636 183
151 3300050508 nmdc:mga09592_1111509_c1 nmdc:mga09592_1111509_c1_49_618 183
152 3300050508 nmdc:mga09592_51695_c1 nmdc:mga09592_51695_c1_1155_1724 183
153 3300050509 nmdc:mga0qj67_141829_c1 nmdc:mga0qj67_141829_c1_798_1376 183
154 3300050511 nmdc:mga08y16_31509_c1 nmdc:mga08y16_31509_c1_4116_4688 183
155 3300050512 nmdc:mga0n895_231003_c1 nmdc:mga0n895_231003_c1_655_1224 183
156 3300050512 nmdc:mga0n895_39117_c1 nmdc:mga0n895_39117_c1_4003_4566 183
157 3300050514 nmdc:mga08x19_198842_c1 nmdc:mga08x19_198842_c1_374_943 183
158 3300050515 nmdc:mga0a205_17876_c1 nmdc:mga0a205_17876_c1_4226_4789 183
159 3300050515 nmdc:mga0a205_24900_c1 nmdc:mga0a205_24900_c1_4630_5199 183
160 3300005327 Ga0070658_10716141 Ga0070658_107161411 188
161 3300005518 Ga0070699_100219740 Ga0070699_1002197402 188
162 3300005549 Ga0070704_100871036 Ga0070704_1008710362 188
163 3300006846 Ga0075430_100224394 Ga0075430_1002243942 188
164 3300006880 Ga0075429_100012369 Ga0075429_1000123698 188
165 3300006914 Ga0075436_100020558 Ga0075436_1000205582 188
166 3300009147 Ga0114129_10034132 Ga0114129_100341325 188
167 3300025909 Ga0207705_10466634 Ga0207705_104666341 188
168 3300032002 Ga0307416_100171804 Ga0307416_1001718041 188
169 3300045051 Ga0451576_0160658 Ga0451576_0160658_720_1310 188
170 3300045836 Ga0466958_0163039 Ga0466958_0163039_360_953 188
171 3300045976 Ga0466967_0077476 Ga0466967_0077476_1577_2170 188
172 3300050507 nmdc:mga05p37_125597_c1 nmdc:mga05p37_125597_c1_2090_2680 188
173 3300050508 nmdc:mga09592_21738_c1 nmdc:mga09592_21738_c1_4430_5020 188
174 3300050509 nmdc:mga0qj67_30375_c1 nmdc:mga0qj67_30375_c1_1550_2140 188
175 3300050510 nmdc:mga06r32_530959_c1 nmdc:mga06r32_530959_c1_68_658 188

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01966

HD

HD domain

34

127

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
4s1c-assembly3.cif.gz_A crystal structure of l. monocytogenes phosphodiesterase pgph hd domain 0.5888 6 188
4s1c-assembly3.cif.gz_D-2 crystal structure of l. monocytogenes phosphodiesterase pgph hd domain 0.5884 6 188
4s1b-assembly3.cif.gz_D-2 crystal structure of l. monocytogenes phosphodiesterase pgph hd domain in complex with cyclic-di-amp 0.5864 6 186
4s1c-assembly3.cif.gz_A crystal structure of l. monocytogenes phosphodiesterase pgph hd domain 0.5733 6 188
4s1c-assembly3.cif.gz_D-2 crystal structure of l. monocytogenes phosphodiesterase pgph hd domain 0.5733 6 188
ID Description Score Start End Superfamily
af_Q2FZ08_320_474_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.6941 6 146 1.10.3210.10
5ihyB01 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;HD-domain/PDEase-like 0.6547 3 91 1.10.472.50
af_B6SZF0_2_101_1.10.472.50 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;HD-domain/PDEase-like 0.6498 3 91 1.10.472.50
af_Q8GUM8_2_102_1.10.472.50 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;HD-domain/PDEase-like 0.6257 3 91 1.10.472.50
3dtoA01 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;HD-domain/PDEase-like 0.6105 3 100 1.10.472.50
ID Description Score Start End GO Terms
AF-A0A7W0GWB1-F1-model_v4 HDIG domain-containing protein 0.9925 1 107
AF-A0A0P9H8U0-F1-model_v4 HAD family hydrolase 0.9853 3 59 GO:0016787
AF-A0A382PJY9-F1-model_v4 HD domain-containing protein 0.9851 3 95
AF-A0A2V5U716-F1-model_v4 HAD family hydrolase 0.9822 3 113 GO:0016787
AF-A0A2V5KVT9-F1-model_v4 HAD family hydrolase 0.9798 3 96 GO:0016787

Feature Viewer

pLDDT pTM Quality
94.68 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map