F266550

General Info

Members Datasets Scaffolds Average Seq Length
175 112 175 267

Family's Representative Sequence

Representative Sequence 3300028786|Ga0307517_10007381|Ga0307517_100073812
Length 302
Sequence MRGFLIMRRPFAGILIILFISSNFTNDPRIRIMKQFILFTFFWLLLSGCRVNPYKATNKEYKKQARQFARVISQTPLTPGVDSVPIAPYWAGTINFNLRKPNFVIIHHTAQNSCPQTLHTFTIAPTQVSAHYVICRDGTVQHMLNDYLRAWQAGLSKWGNITDVNSISIGIELDNNGFEPFPDAQISSLLHLLAKLKTSYNIPPANFIGHGDIAPTRKNDPSYLFPWKALADKGFGLWYGDTTGVSVPGDFRSLAALRLIGYDTRDSSAAAMAFKRHFEQDTLRSWGAPEEKILYTLYRGYE

Samples

Sample ID Description Type Environment
1 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
22 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
35 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
36 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
41 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
53 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
54 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
55 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
82 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
83 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
84 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
85 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
86 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
87 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
88 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
89 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
90 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
91 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
92 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
93 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
94 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
95 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
96 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
97 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
98 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
99 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
100 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
101 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
102 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
103 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
104 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
105 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
106 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
107 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
108 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
109 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
110 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
111 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
112 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.43
Metatranscriptomes 0
Isolates 0.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.71
Nodule 0
Rhizoplane 0.57
Rhizosphere 90.86
Stem 0
Stem Tuber 0
Unclassified 6.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10000847 3300003316 Bacteria 5739
2 rootH1_10000847 3300003323 Bacteria 5674
3 rootH1_10118958 3300003316 Bacteria 2803
4 rootH2_10010421 3300003320 Bacteria 28080
5 rootH2_10018543 3300003320 Bacteria 23020
6 rootL2_10017946 3300003322 Bacteria 5238
7 rootH1_10397825 3300003323 Bacteria 1241
8 Ga0065712_10010803 3300005290 Unclassified 2926
9 Ga0065712_10083359 3300005290 Bacteria 2840
10 Ga0065712_10084317 3300005290 Bacteria 2773
11 Ga0065712_10089341 3300005290 Bacteria 2475
12 Ga0070683_100014906 3300005329 Bacteria 6813
13 Ga0070670_100027400 3300005331 Bacteria 4902
14 Ga0070682_100017121 3300005337 Bacteria 4223
15 Ga0070689_100260396 3300005340 Bacteria 1433
16 Ga0070687_100288184 3300005343 Bacteria 1037
17 Ga0070669_100200367 3300005353 Bacteria 1570
18 Ga0070669_100631454 3300005353 Unclassified 900
19 Ga0070675_100077527 3300005354 Bacteria 2766
20 Ga0070675_100125664 3300005354 Unclassified 2181
21 Ga0070673_100254636 3300005364 Bacteria 1531
22 Ga0070659_100254784 3300005366 Bacteria 1455
23 Ga0070667_100329925 3300005367 Unclassified 1378
24 Ga0070685_10005151 3300005466 Bacteria 6626
25 Ga0070698_100003616 3300005471 Bacteria 16995
26 Ga0070699_100317214 3300005518 Bacteria 1400
27 Ga0070684_100090701 3300005535 Unclassified 2718
28 Ga0070672_100193490 3300005543 Unclassified 1699
29 Ga0070686_100050581 3300005544 Bacteria 2642
30 Ga0070665_100000031 3300005548 Bacteria 333365
31 Ga0068855_100024164 3300005563 Bacteria 7274
32 Ga0068855_100058726 3300005563 Bacteria 4503
33 Ga0068852_100064335 3300005616 Unclassified 3197
34 Ga0068852_100091012 3300005616 Unclassified 2729
35 Ga0068859_100323685 3300005617 Bacteria 1636
36 Ga0068859_100431747 3300005617 Unclassified 1414
37 Ga0068864_100084970 3300005618 Bacteria 2781
38 Ga0068861_100028653 3300005719 Bacteria 4065
39 Ga0068861_100185684 3300005719 Bacteria 1734
40 Ga0068863_100003524 3300005841 Bacteria 15444
41 Ga0068863_100165142 3300005841 Bacteria 2123
42 Ga0068860_100000082 3300005843 Bacteria 169805
43 Ga0068860_100815794 3300005843 Bacteria 947
44 Ga0097621_100022393 3300006237 Bacteria 4904
45 Ga0097621_100520429 3300006237 Bacteria 1080
46 Ga0068871_100004061 3300006358 Bacteria 10123
47 Ga0075428_100032434 3300006844 Bacteria 5769
48 Ga0075428_100034368 3300006844 Bacteria 5593
49 Ga0075428_100228424 3300006844 Bacteria 2008
50 Ga0075430_100003699 3300006846 Bacteria 12849
51 Ga0075431_100015945 3300006847 Bacteria 7624
52 Ga0075429_100015670 3300006880 Bacteria 6568
53 Ga0097620_100323688 3300006931 Bacteria 1636
54 Ga0097620_100431769 3300006931 Unclassified 1414
55 Ga0105240_10000117 3300009093 Bacteria 165286
56 Ga0105240_10000119 3300009093 Bacteria 163675
57 Ga0105240_10002157 3300009093 Bacteria 32150
58 Ga0105240_10043338 3300009093 Bacteria 5726
59 Ga0105240_10088307 3300009093 Bacteria 3794
60 Ga0114129_10103401 3300009147 Bacteria 3938
61 Ga0105241_10257251 3300009174 Bacteria 1483
62 Ga0105242_10001987 3300009176 Bacteria 16076
63 Ga0105242_10426022 3300009176 Bacteria 1245
64 Ga0105237_10007261 3300009545 Bacteria 12155
65 Ga0105237_10011360 3300009545 Bacteria 9422
66 Ga0105237_10081913 3300009545 Bacteria 3218
67 Ga0105237_10104130 3300009545 Bacteria 2829
68 Ga0105237_10435657 3300009545 Bacteria 1316
69 Ga0105238_10027498 3300009551 Bacteria 5797
70 Ga0105238_10096678 3300009551 Bacteria 2939
71 Ga0105249_10146589 3300009553 Bacteria 2268
72 Ga0105239_10000097 3300010375 Bacteria 122808
73 Ga0105239_10000313 3300010375 Bacteria 71404
74 Ga0105239_10008674 3300010375 Bacteria 11515
75 Ga0105239_10011362 3300010375 Bacteria 9935
76 Ga0105239_10037142 3300010375 Bacteria 5342
77 Ga0157373_10027805 3300013100 Unclassified 4080
78 Ga0157370_10049954 3300013104 Bacteria 3999
79 Ga0157374_10000002 3300013296 Bacteria 1054226
80 Ga0163162_10000473 3300013306 Bacteria 37302
81 Ga0163162_10020741 3300013306 Bacteria 6460
82 Ga0163162_10027069 3300013306 Bacteria 5670
83 Ga0157372_10000617 3300013307 Bacteria 38817
84 Ga0157372_10003187 3300013307 Bacteria 17701
85 Ga0157372_10103332 3300013307 Unclassified 3256
86 Ga0157372_10362479 3300013307 Bacteria 1689
87 Ga0157372_10447325 3300013307 Bacteria 1506
88 Ga0157375_10064962 3300013308 Bacteria 3635
89 Ga0157375_10114846 3300013308 Bacteria 2795
90 Ga0157380_10090198 3300014326 Bacteria 2528
91 Ga0157376_10003410 3300014969 Bacteria 10934
92 Ga0157376_10029380 3300014969 Bacteria 4378
93 Ga0157376_10064376 3300014969 Bacteria 3092
94 Ga0157376_10493840 3300014969 Unclassified 1202
95 Ga0157376_10653344 3300014969 Unclassified 1052
96 Ga0163161_10065437 3300017792 Bacteria 2653
97 Ga0163161_10136796 3300017792 Bacteria 1853
98 Ga0207695_10000060 3300025913 Bacteria 360217
99 Ga0207695_10000077 3300025913 Bacteria 307107
100 Ga0207695_10000139 3300025913 Bacteria 216873
101 Ga0207695_10001270 3300025913 Bacteria 42915
102 Ga0207695_10026872 3300025913 Bacteria 6417
103 Ga0207671_10000325 3300025914 Bacteria 70129
104 Ga0207671_10018110 3300025914 Bacteria 5411
105 Ga0207671_10074728 3300025914 Bacteria 2533
106 Ga0207662_10056109 3300025918 Bacteria 2352
107 Ga0207662_10096810 3300025918 Bacteria 1824
108 Ga0207681_10322240 3300025923 Bacteria 1229
109 Ga0207650_10049525 3300025925 Bacteria 3102
110 Ga0207659_10154324 3300025926 Bacteria 1796
111 Ga0207690_10438321 3300025932 Bacteria 1048
112 Ga0207686_10000442 3300025934 Bacteria 27861
113 Ga0207686_10229145 3300025934 Bacteria 1346
114 Ga0207670_10173541 3300025936 Unclassified 1618
115 Ga0207670_10323975 3300025936 Bacteria 1213
116 Ga0207669_10206325 3300025937 Bacteria 1431
117 Ga0207689_10029212 3300025942 Bacteria 4606
118 Ga0207689_10135990 3300025942 Unclassified 2024
119 Ga0207661_10017013 3300025944 Bacteria 5371
120 Ga0207667_10006621 3300025949 Bacteria 14003
121 Ga0207667_10048110 3300025949 Bacteria 4511
122 Ga0207651_10049512 3300025960 Bacteria 2847
123 Ga0207712_10026619 3300025961 Bacteria 3855
124 Ga0207712_10028218 3300025961 Bacteria 3752
125 Ga0207712_10574265 3300025961 Bacteria 972
126 Ga0207639_10413900 3300026041 Bacteria 1217
127 Ga0207708_10061469 3300026075 Bacteria 2868
128 Ga0207641_10000111 3300026088 Bacteria 120527
129 Ga0207648_10262047 3300026089 Bacteria 1542
130 Ga0207674_10055055 3300026116 Bacteria 4047
131 Ga0207675_100051640 3300026118 Bacteria 3836
132 Ga0207683_10245462 3300026121 Bacteria 1633
133 Ga0207698_10071532 3300026142 Bacteria 2753
134 Ga0207698_10415715 3300026142 Bacteria 1289
135 Ga0207698_10512946 3300026142 Bacteria 1169
136 Ga0268266_10000146 3300028379 Bacteria 135225
137 Ga0268265_10218296 3300028380 Bacteria 1667
138 Ga0268264_10000013 3300028381 Bacteria 513859
139 Ga0268264_10620193 3300028381 Bacteria 1068
140 Ga0307517_10007381 3300028786 Bacteria 16035
141 Ga0307511_10000024 3300030521 Bacteria 112616
142 Ga0307509_10125636 3300031507 Unclassified 2532
143 Ga0307408_100000164 3300031548 Bacteria 73855
144 Ga0307516_10009496 3300031730 Bacteria 10837
145 Ga0307516_10138753 3300031730 Unclassified 2203
146 Ga0307412_10001422 3300031911 Bacteria 13337
147 Ga0307414_10101903 3300032004 Bacteria 2162
148 Ga0307414_10107793 3300032004 Bacteria 2112
149 Ga0307510_10028173 3300033180 Bacteria 6417
150 Ga0451807_0352324 3300041486 Bacteria 1516
151 Ga0439431_0005084 3300041997 Bacteria 2900
152 Ga0450923_002165 3300042125 Bacteria 2767
153 Ga0450898_006421 3300042134 Bacteria 1804
154 Ga0466972_0000016 3300044658 Bacteria 208802
155 Ga0466972_0033325 3300044658 Bacteria 2526
156 Ga0466965_0089668 3300044683 Bacteria 1563
157 Ga0466964_0103394 3300044706 Bacteria 1259
158 Ga0466970_0003015 3300044765 Bacteria 8162
159 Ga0466959_0016615 3300045049 Bacteria 5381
160 Ga0495638_0038884 3300046460 Bacteria 3022
161 Ga0495606_0033396 3300046507 Unclassified 3549
162 Ga0495648_0001894 3300046524 Bacteria 19973
163 Ga0495611_0000042 3300046648 Bacteria 94996
164 Ga0495672_0062623 3300047320 Bacteria 2139
165 Ga0495687_000010 3300047443 Bacteria 413735
166 Ga0495686_0000102 3300047472 Bacteria 177525
167 Ga0495686_0118728 3300047472 Bacteria 1579
168 Ga0501047_0333324 3300049581 Unclassified 1356
169 nmdc:mga09592_129035_c1 3300050508 Bacteria 2175
170 nmdc:mga0qj67_25282_c1 3300050509 Bacteria 4587
171 nmdc:mga06r32_470207_c1 3300050510 Bacteria 1236
172 Ga0500583_0000474 3300053092 Bacteria 12540
173 Ga0500622_0006708 3300053156 Bacteria 6635
174 Ga0500637_0033044 3300053178 Unclassified 2888
175 Ga0466962_0021438 3300061719 Unclassified 3102

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006880 Ga0075429_100015670 Ga0075429_1000156704 234
2 3300005290 Ga0065712_10010803 Ga0065712_100108033 236
3 3300005543 Ga0070672_100193490 Ga0070672_1001934902 236
4 3300042134 Ga0450898_006421 Ga0450898_006421_795_1613 241
5 3300005617 Ga0068859_100323685 Ga0068859_1003236852 243
6 3300006931 Ga0097620_100323688 Ga0097620_1003236882 243
7 3300025961 Ga0207712_10574265 Ga0207712_105742651 243
8 3300042125 Ga0450923_002165 Ga0450923_002165_1359_2174 243
9 3300005290 Ga0065712_10083359 Ga0065712_100833592 246
10 3300005343 Ga0070687_100288184 Ga0070687_1002881841 246
11 3300028381 Ga0268264_10620193 Ga0268264_106201932 246
12 3300041486 Ga0451807_0352324 Ga0451807_0352324_329_1138 246
13 3300005290 Ga0065712_10084317 Ga0065712_100843171 247
14 3300005331 Ga0070670_100027400 Ga0070670_1000274002 247
15 3300005340 Ga0070689_100260396 Ga0070689_1002603962 247
16 3300005354 Ga0070675_100077527 Ga0070675_1000775272 247
17 3300005364 Ga0070673_100254636 Ga0070673_1002546362 247
18 3300013308 Ga0157375_10114846 Ga0157375_101148462 247
19 3300025925 Ga0207650_10049525 Ga0207650_100495253 247
20 3300025926 Ga0207659_10154324 Ga0207659_101543242 247
21 3300025934 Ga0207686_10229145 Ga0207686_102291451 247
22 3300025936 Ga0207670_10323975 Ga0207670_103239752 247
23 3300025942 Ga0207689_10135990 Ga0207689_101359902 247
24 3300025960 Ga0207651_10049512 Ga0207651_100495122 247
25 3300026089 Ga0207648_10262047 Ga0207648_102620472 247
26 3300047472 Ga0495686_0000102 Ga0495686_0000102_148960_149772 247
27 3300005841 Ga0068863_100003524 Ga0068863_1000035244 248
28 3300026088 Ga0207641_10000111 Ga0207641_1000011192 248
29 3300005290 Ga0065712_10089341 Ga0065712_100893412 249
30 3300005337 Ga0070682_100017121 Ga0070682_1000171212 249
31 3300014969 Ga0157376_10653344 Ga0157376_106533442 249
32 3300025942 Ga0207689_10029212 Ga0207689_100292122 249
33 3300041997 Ga0439431_0005084 Ga0439431_0005084_852_1670 249
34 3300005719 Ga0068861_100028653 Ga0068861_1000286534 250
35 3300005466 Ga0070685_10005151 Ga0070685_100051512 251
36 3300005544 Ga0070686_100050581 Ga0070686_1000505812 251
37 3300005719 Ga0068861_100185684 Ga0068861_1001856842 251
38 3300005841 Ga0068863_100165142 Ga0068863_1001651423 251
39 3300005843 Ga0068860_100815794 Ga0068860_1008157941 251
40 3300009176 Ga0105242_10426022 Ga0105242_104260222 251
41 3300009553 Ga0105249_10146589 Ga0105249_101465892 251
42 3300013306 Ga0163162_10027069 Ga0163162_100270692 251
43 3300013308 Ga0157375_10064962 Ga0157375_100649622 251
44 3300014969 Ga0157376_10064376 Ga0157376_100643762 251
45 3300017792 Ga0163161_10065437 Ga0163161_100654372 251
46 3300025918 Ga0207662_10096810 Ga0207662_100968102 251
47 3300025936 Ga0207670_10173541 Ga0207670_101735412 251
48 3300025961 Ga0207712_10028218 Ga0207712_100282182 251
49 3300026142 Ga0207698_10512946 Ga0207698_105129462 251
50 3300005366 Ga0070659_100254784 Ga0070659_1002547841 253
51 3300025932 Ga0207690_10438321 Ga0207690_104383211 253
52 3300026116 Ga0207674_10055055 Ga0207674_100550552 257
53 3300003320 rootH2_10018543 rootH2_1001854314 258
54 3300006844 Ga0075428_100034368 Ga0075428_1000343682 258
55 3300013307 Ga0157372_10003187 Ga0157372_1000318713 262
56 3300014969 Ga0157376_10493840 Ga0157376_104938402 262
57 3300031548 Ga0307408_100000164 Ga0307408_10000016434 262
58 iso_pu_bacteria 2883068021 2883072036 262
59 3300005353 Ga0070669_100631454 Ga0070669_1006314541 263
60 3300005354 Ga0070675_100125664 Ga0070675_1001256643 263
61 3300005471 Ga0070698_100003616 Ga0070698_1000036164 263
62 3300005518 Ga0070699_100317214 Ga0070699_1003172141 263
63 3300005618 Ga0068864_100084970 Ga0068864_1000849702 263
64 3300006237 Ga0097621_100022393 Ga0097621_1000223933 263
65 3300006237 Ga0097621_100520429 Ga0097621_1005204292 263
66 3300006358 Ga0068871_100004061 Ga0068871_1000040615 263
67 3300006844 Ga0075428_100032434 Ga0075428_1000324344 263
68 3300006844 Ga0075428_100228424 Ga0075428_1002284242 263
69 3300006846 Ga0075430_100003699 Ga0075430_1000036997 263
70 3300006847 Ga0075431_100015945 Ga0075431_1000159458 263
71 3300009147 Ga0114129_10103401 Ga0114129_101034014 263
72 3300009174 Ga0105241_10257251 Ga0105241_102572512 263
73 3300009176 Ga0105242_10001987 Ga0105242_100019874 263
74 3300013306 Ga0163162_10020741 Ga0163162_100207412 263
75 3300014326 Ga0157380_10090198 Ga0157380_100901983 263
76 3300014969 Ga0157376_10029380 Ga0157376_100293803 263
77 3300017792 Ga0163161_10136796 Ga0163161_101367961 263
78 3300025918 Ga0207662_10056109 Ga0207662_100561092 263
79 3300025923 Ga0207681_10322240 Ga0207681_103222401 263
80 3300025934 Ga0207686_10000442 Ga0207686_1000044218 263
81 3300025937 Ga0207669_10206325 Ga0207669_102063252 263
82 3300025961 Ga0207712_10026619 Ga0207712_100266192 263
83 3300026075 Ga0207708_10061469 Ga0207708_100614692 263
84 3300026121 Ga0207683_10245462 Ga0207683_102454622 263
85 3300028380 Ga0268265_10218296 Ga0268265_102182963 263
86 3300031911 Ga0307412_10001422 Ga0307412_1000142210 263
87 3300032004 Ga0307414_10107793 Ga0307414_101077932 263
88 3300044658 Ga0466972_0000016 Ga0466972_0000016_46422_47225 263
89 3300044765 Ga0466970_0003015 Ga0466970_0003015_7301_8104 263
90 3300047320 Ga0495672_0062623 Ga0495672_0062623_439_1245 263
91 3300050508 nmdc:mga09592_129035_c1 nmdc:mga09592_129035_c1_1066_1881 263
92 3300050509 nmdc:mga0qj67_25282_c1 nmdc:mga0qj67_25282_c1_1049_1864 263
93 3300050510 nmdc:mga06r32_470207_c1 nmdc:mga06r32_470207_c1_232_1047 263
94 3300005353 Ga0070669_100200367 Ga0070669_1002003672 265
95 3300005617 Ga0068859_100431747 Ga0068859_1004317472 265
96 3300006931 Ga0097620_100431769 Ga0097620_1004317692 265
97 3300026118 Ga0207675_100051640 Ga0207675_1000516402 265
98 3300032004 Ga0307414_10101903 Ga0307414_101019032 265
99 3300003323 rootH1_10397825 rootH1_103978252 266
100 3300005367 Ga0070667_100329925 Ga0070667_1003299251 266
101 3300005616 Ga0068852_100091012 Ga0068852_1000910122 266
102 3300009093 Ga0105240_10000117 Ga0105240_10000117156 266
103 3300009093 Ga0105240_10000119 Ga0105240_10000119140 266
104 3300009545 Ga0105237_10104130 Ga0105237_101041303 266
105 3300009551 Ga0105238_10027498 Ga0105238_100274982 266
106 3300010375 Ga0105239_10000097 Ga0105239_10000097117 266
107 3300010375 Ga0105239_10011362 Ga0105239_100113623 266
108 3300013104 Ga0157370_10049954 Ga0157370_100499542 266
109 3300025913 Ga0207695_10000077 Ga0207695_10000077122 266
110 3300025913 Ga0207695_10000139 Ga0207695_1000013964 266
111 3300025913 Ga0207695_10026872 Ga0207695_100268724 266
112 3300025914 Ga0207671_10074728 Ga0207671_100747283 266
113 3300026041 Ga0207639_10413900 Ga0207639_104139002 266
114 3300044683 Ga0466965_0089668 Ga0466965_0089668_100_909 266
115 3300044706 Ga0466964_0103394 Ga0466964_0103394_250_1059 266
116 3300047472 Ga0495686_0118728 Ga0495686_0118728_346_1155 266
117 3300005329 Ga0070683_100014906 Ga0070683_1000149064 267
118 3300005535 Ga0070684_100090701 Ga0070684_1000907011 267
119 3300005548 Ga0070665_100000031 Ga0070665_10000003124 267
120 3300005563 Ga0068855_100024164 Ga0068855_1000241643 267
121 3300005616 Ga0068852_100064335 Ga0068852_1000643355 267
122 3300009093 Ga0105240_10088307 Ga0105240_100883071 267
123 3300009545 Ga0105237_10081913 Ga0105237_100819132 267
124 3300010375 Ga0105239_10008674 Ga0105239_100086743 267
125 3300010375 Ga0105239_10037142 Ga0105239_100371423 267
126 3300013100 Ga0157373_10027805 Ga0157373_100278052 267
127 3300013307 Ga0157372_10103332 Ga0157372_101033326 267
128 3300013307 Ga0157372_10362479 Ga0157372_103624792 267
129 3300025913 Ga0207695_10000060 Ga0207695_1000006085 267
130 3300025944 Ga0207661_10017013 Ga0207661_100170134 267
131 3300025949 Ga0207667_10006621 Ga0207667_1000662114 267
132 3300026142 Ga0207698_10415715 Ga0207698_104157153 267
133 3300028379 Ga0268266_10000146 Ga0268266_1000014624 267
134 3300030521 Ga0307511_10000024 Ga0307511_1000002427 267
135 3300031730 Ga0307516_10009496 Ga0307516_100094969 267
136 3300031730 Ga0307516_10138753 Ga0307516_101387533 267
137 3300044658 Ga0466972_0033325 Ga0466972_0033325_677_1480 267
138 3300053178 Ga0500637_0033044 Ga0500637_0033044_391_1203 267
139 3300003322 rootL2_10017946 rootL2_100179461 268
140 3300005843 Ga0068860_100000082 Ga0068860_100000082100 268
141 3300009545 Ga0105237_10007261 Ga0105237_100072618 268
142 3300013306 Ga0163162_10000473 Ga0163162_1000047325 268
143 3300025914 Ga0207671_10000325 Ga0207671_1000032511 268
144 3300028381 Ga0268264_10000013 Ga0268264_10000013359 268
145 3300046460 Ga0495638_0038884 Ga0495638_0038884_724_1539 268
146 3300046524 Ga0495648_0001894 Ga0495648_0001894_668_1483 268
147 3300047443 Ga0495687_000010 Ga0495687_000010_161808_162623 268
148 3300049581 Ga0501047_0333324 Ga0501047_0333324_205_1011 268
149 3300053092 Ga0500583_0000474 Ga0500583_0000474_11325_12140 268
150 3300053156 Ga0500622_0006708 Ga0500622_0006708_1176_1991 268
151 3300003316 rootH1_10000847 rootH1_100008473 269
152 3300003316 rootH1_10118958 rootH1_101189582 269
153 3300003320 rootH2_10010421 rootH2_1001042123 269
154 3300005563 Ga0068855_100058726 Ga0068855_1000587264 269
155 3300009093 Ga0105240_10002157 Ga0105240_1000215728 269
156 3300009093 Ga0105240_10043338 Ga0105240_100433381 269
157 3300009545 Ga0105237_10011360 Ga0105237_100113609 269
158 3300009545 Ga0105237_10435657 Ga0105237_104356572 269
159 3300009551 Ga0105238_10096678 Ga0105238_100966782 269
160 3300010375 Ga0105239_10000313 Ga0105239_1000031351 269
161 3300013296 Ga0157374_10000002 Ga0157374_10000002583 269
162 3300013307 Ga0157372_10000617 Ga0157372_1000061714 269
163 3300013307 Ga0157372_10447325 Ga0157372_104473252 269
164 3300014969 Ga0157376_10003410 Ga0157376_1000341010 269
165 3300025913 Ga0207695_10001270 Ga0207695_1000127029 269
166 3300025914 Ga0207671_10018110 Ga0207671_100181107 269
167 3300025949 Ga0207667_10048110 Ga0207667_100481104 269
168 3300026142 Ga0207698_10071532 Ga0207698_100715321 269
169 3300028786 Ga0307517_10007381 Ga0307517_100073812 269
170 3300031507 Ga0307509_10125636 Ga0307509_101256364 269
171 3300033180 Ga0307510_10028173 Ga0307510_100281732 269
172 3300045049 Ga0466959_0016615 Ga0466959_0016615_642_1472 269
173 3300046507 Ga0495606_0033396 Ga0495606_0033396_2227_3099 269
174 3300046648 Ga0495611_0000042 Ga0495611_0000042_28788_29621 269
175 3300061719 Ga0466962_0021438 Ga0466962_0021438_557_1387 269

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01510

Amidase_2

N-acetylmuramoyl-L-alanine amidase

97

223

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
7f5i-assembly1.cif.gz_A x-ray structure of clostridium perfringens-specific amidase endolysin 0.6267 60 176
3d2y-assembly1.cif.gz_A complex of the n-acetylmuramyl-l-alanine amidase amid from e.coli with the substrate anhydro-n-acetylmuramic acid-l-ala-d-gamma-glu-l-lys 0.6236 69 268
4bol-assembly1.cif.gz_A crystal structure of ampdh2 from pseudomonas aeruginosa in complex with pentapeptide 0.6234 68 261
6ssc-assembly1.cif.gz_A n-acetylmuramoyl-l-alanine amidase lysc from clostridium intestinale urnw 0.6013 44 202
6srt-assembly1.cif.gz_A endolysine n-acetylmuramoyl-l-alanine amidase lyscs from clostridium intestinale urnw 0.5989 44 202
ID Description Score Start End Superfamily
af_P75820_43_192_3.40.80.10 Alpha Beta;3-Layer(aba) Sandwich;Lysozyme-like;Peptidoglycan recognition protein-like 0.7298 67 203 3.40.80.10
4bpaB01 Alpha Beta;3-Layer(aba) Sandwich;Lysozyme-like;Peptidoglycan recognition protein-like 0.7152 68 201 3.40.80.10
af_C0H5A2_319_480_2.40.50.1070 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); 0.6924 145 176 2.40.50.1070
af_P75820_43_192_3.40.80.10 Alpha Beta;3-Layer(aba) Sandwich;Lysozyme-like;Peptidoglycan recognition protein-like 0.6686 67 203 3.40.80.10
af_A0A1D6PEB4_49_302_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.6598 136 177 3.60.21.10
ID Description Score Start End GO Terms
AF-A0A3D2RBY0-F1-model_v4 deleted 0.7641 81 205
AF-A0A037ZLR7-F1-model_v4 N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28) 0.7415 70 217 GO:0005576
GO:0008745
GO:0009253
GO:0009254
GO:0071555
AF-A0A849WVF8-F1-model_v4 N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28) 0.7305 66 176 GO:0005576
GO:0008745
GO:0009253
GO:0009254
GO:0071555
AF-A0A2E8PR97-F1-model_v4 N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28) 0.7279 68 176 GO:0005576
GO:0008745
GO:0009253
GO:0009254
GO:0016020
GO:0071555
AF-A0A7C5LR31-F1-model_v4 N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28) 0.7234 53 205 GO:0005576
GO:0008745
GO:0009253
GO:0009254
GO:0019867
GO:0071555

Feature Viewer

pLDDT pTM Quality
61.39 0.67 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map