F266550
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 175 | 112 | 175 | 267 |
Family's Representative Sequence
| Representative Sequence | 3300028786|Ga0307517_10007381|Ga0307517_100073812 |
| Length | 302 |
| Sequence | MRGFLIMRRPFAGILIILFISSNFTNDPRIRIMKQFILFTFFWLLLSGCRVNPYKATNKEYKKQARQFARVISQTPLTPGVDSVPIAPYWAGTINFNLRKPNFVIIHHTAQNSCPQTLHTFTIAPTQVSAHYVICRDGTVQHMLNDYLRAWQAGLSKWGNITDVNSISIGIELDNNGFEPFPDAQISSLLHLLAKLKTSYNIPPANFIGHGDIAPTRKNDPSYLFPWKALADKGFGLWYGDTTGVSVPGDFRSLAALRLIGYDTRDSSAAAMAFKRHFEQDTLRSWGAPEEKILYTLYRGYE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2883068021 | Chitinophaga rhizosphaerae T16R-86 | Isolate | Rhizosphere |
| 2 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 3 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 4 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 5 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 6 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 25 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 26 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 27 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 28 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 29 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 30 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 31 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 32 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 33 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 34 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 35 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 36 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 37 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 38 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 82 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 83 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 84 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 85 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 86 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 87 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 88 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 89 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 90 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 91 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 92 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 93 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 94 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 95 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 96 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 97 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 98 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 99 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 106 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 107 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 108 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 109 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 110 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 111 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 112 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.43 |
| Metatranscriptomes | 0 |
| Isolates | 0.57 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.71 |
| Nodule | 0 |
| Rhizoplane | 0.57 |
| Rhizosphere | 90.86 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.86 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH1_10000847 | 3300003316 | Bacteria | 5739 |
| 2 | rootH1_10000847 | 3300003323 | Bacteria | 5674 |
| 3 | rootH1_10118958 | 3300003316 | Bacteria | 2803 |
| 4 | rootH2_10010421 | 3300003320 | Bacteria | 28080 |
| 5 | rootH2_10018543 | 3300003320 | Bacteria | 23020 |
| 6 | rootL2_10017946 | 3300003322 | Bacteria | 5238 |
| 7 | rootH1_10397825 | 3300003323 | Bacteria | 1241 |
| 8 | Ga0065712_10010803 | 3300005290 | Unclassified | 2926 |
| 9 | Ga0065712_10083359 | 3300005290 | Bacteria | 2840 |
| 10 | Ga0065712_10084317 | 3300005290 | Bacteria | 2773 |
| 11 | Ga0065712_10089341 | 3300005290 | Bacteria | 2475 |
| 12 | Ga0070683_100014906 | 3300005329 | Bacteria | 6813 |
| 13 | Ga0070670_100027400 | 3300005331 | Bacteria | 4902 |
| 14 | Ga0070682_100017121 | 3300005337 | Bacteria | 4223 |
| 15 | Ga0070689_100260396 | 3300005340 | Bacteria | 1433 |
| 16 | Ga0070687_100288184 | 3300005343 | Bacteria | 1037 |
| 17 | Ga0070669_100200367 | 3300005353 | Bacteria | 1570 |
| 18 | Ga0070669_100631454 | 3300005353 | Unclassified | 900 |
| 19 | Ga0070675_100077527 | 3300005354 | Bacteria | 2766 |
| 20 | Ga0070675_100125664 | 3300005354 | Unclassified | 2181 |
| 21 | Ga0070673_100254636 | 3300005364 | Bacteria | 1531 |
| 22 | Ga0070659_100254784 | 3300005366 | Bacteria | 1455 |
| 23 | Ga0070667_100329925 | 3300005367 | Unclassified | 1378 |
| 24 | Ga0070685_10005151 | 3300005466 | Bacteria | 6626 |
| 25 | Ga0070698_100003616 | 3300005471 | Bacteria | 16995 |
| 26 | Ga0070699_100317214 | 3300005518 | Bacteria | 1400 |
| 27 | Ga0070684_100090701 | 3300005535 | Unclassified | 2718 |
| 28 | Ga0070672_100193490 | 3300005543 | Unclassified | 1699 |
| 29 | Ga0070686_100050581 | 3300005544 | Bacteria | 2642 |
| 30 | Ga0070665_100000031 | 3300005548 | Bacteria | 333365 |
| 31 | Ga0068855_100024164 | 3300005563 | Bacteria | 7274 |
| 32 | Ga0068855_100058726 | 3300005563 | Bacteria | 4503 |
| 33 | Ga0068852_100064335 | 3300005616 | Unclassified | 3197 |
| 34 | Ga0068852_100091012 | 3300005616 | Unclassified | 2729 |
| 35 | Ga0068859_100323685 | 3300005617 | Bacteria | 1636 |
| 36 | Ga0068859_100431747 | 3300005617 | Unclassified | 1414 |
| 37 | Ga0068864_100084970 | 3300005618 | Bacteria | 2781 |
| 38 | Ga0068861_100028653 | 3300005719 | Bacteria | 4065 |
| 39 | Ga0068861_100185684 | 3300005719 | Bacteria | 1734 |
| 40 | Ga0068863_100003524 | 3300005841 | Bacteria | 15444 |
| 41 | Ga0068863_100165142 | 3300005841 | Bacteria | 2123 |
| 42 | Ga0068860_100000082 | 3300005843 | Bacteria | 169805 |
| 43 | Ga0068860_100815794 | 3300005843 | Bacteria | 947 |
| 44 | Ga0097621_100022393 | 3300006237 | Bacteria | 4904 |
| 45 | Ga0097621_100520429 | 3300006237 | Bacteria | 1080 |
| 46 | Ga0068871_100004061 | 3300006358 | Bacteria | 10123 |
| 47 | Ga0075428_100032434 | 3300006844 | Bacteria | 5769 |
| 48 | Ga0075428_100034368 | 3300006844 | Bacteria | 5593 |
| 49 | Ga0075428_100228424 | 3300006844 | Bacteria | 2008 |
| 50 | Ga0075430_100003699 | 3300006846 | Bacteria | 12849 |
| 51 | Ga0075431_100015945 | 3300006847 | Bacteria | 7624 |
| 52 | Ga0075429_100015670 | 3300006880 | Bacteria | 6568 |
| 53 | Ga0097620_100323688 | 3300006931 | Bacteria | 1636 |
| 54 | Ga0097620_100431769 | 3300006931 | Unclassified | 1414 |
| 55 | Ga0105240_10000117 | 3300009093 | Bacteria | 165286 |
| 56 | Ga0105240_10000119 | 3300009093 | Bacteria | 163675 |
| 57 | Ga0105240_10002157 | 3300009093 | Bacteria | 32150 |
| 58 | Ga0105240_10043338 | 3300009093 | Bacteria | 5726 |
| 59 | Ga0105240_10088307 | 3300009093 | Bacteria | 3794 |
| 60 | Ga0114129_10103401 | 3300009147 | Bacteria | 3938 |
| 61 | Ga0105241_10257251 | 3300009174 | Bacteria | 1483 |
| 62 | Ga0105242_10001987 | 3300009176 | Bacteria | 16076 |
| 63 | Ga0105242_10426022 | 3300009176 | Bacteria | 1245 |
| 64 | Ga0105237_10007261 | 3300009545 | Bacteria | 12155 |
| 65 | Ga0105237_10011360 | 3300009545 | Bacteria | 9422 |
| 66 | Ga0105237_10081913 | 3300009545 | Bacteria | 3218 |
| 67 | Ga0105237_10104130 | 3300009545 | Bacteria | 2829 |
| 68 | Ga0105237_10435657 | 3300009545 | Bacteria | 1316 |
| 69 | Ga0105238_10027498 | 3300009551 | Bacteria | 5797 |
| 70 | Ga0105238_10096678 | 3300009551 | Bacteria | 2939 |
| 71 | Ga0105249_10146589 | 3300009553 | Bacteria | 2268 |
| 72 | Ga0105239_10000097 | 3300010375 | Bacteria | 122808 |
| 73 | Ga0105239_10000313 | 3300010375 | Bacteria | 71404 |
| 74 | Ga0105239_10008674 | 3300010375 | Bacteria | 11515 |
| 75 | Ga0105239_10011362 | 3300010375 | Bacteria | 9935 |
| 76 | Ga0105239_10037142 | 3300010375 | Bacteria | 5342 |
| 77 | Ga0157373_10027805 | 3300013100 | Unclassified | 4080 |
| 78 | Ga0157370_10049954 | 3300013104 | Bacteria | 3999 |
| 79 | Ga0157374_10000002 | 3300013296 | Bacteria | 1054226 |
| 80 | Ga0163162_10000473 | 3300013306 | Bacteria | 37302 |
| 81 | Ga0163162_10020741 | 3300013306 | Bacteria | 6460 |
| 82 | Ga0163162_10027069 | 3300013306 | Bacteria | 5670 |
| 83 | Ga0157372_10000617 | 3300013307 | Bacteria | 38817 |
| 84 | Ga0157372_10003187 | 3300013307 | Bacteria | 17701 |
| 85 | Ga0157372_10103332 | 3300013307 | Unclassified | 3256 |
| 86 | Ga0157372_10362479 | 3300013307 | Bacteria | 1689 |
| 87 | Ga0157372_10447325 | 3300013307 | Bacteria | 1506 |
| 88 | Ga0157375_10064962 | 3300013308 | Bacteria | 3635 |
| 89 | Ga0157375_10114846 | 3300013308 | Bacteria | 2795 |
| 90 | Ga0157380_10090198 | 3300014326 | Bacteria | 2528 |
| 91 | Ga0157376_10003410 | 3300014969 | Bacteria | 10934 |
| 92 | Ga0157376_10029380 | 3300014969 | Bacteria | 4378 |
| 93 | Ga0157376_10064376 | 3300014969 | Bacteria | 3092 |
| 94 | Ga0157376_10493840 | 3300014969 | Unclassified | 1202 |
| 95 | Ga0157376_10653344 | 3300014969 | Unclassified | 1052 |
| 96 | Ga0163161_10065437 | 3300017792 | Bacteria | 2653 |
| 97 | Ga0163161_10136796 | 3300017792 | Bacteria | 1853 |
| 98 | Ga0207695_10000060 | 3300025913 | Bacteria | 360217 |
| 99 | Ga0207695_10000077 | 3300025913 | Bacteria | 307107 |
| 100 | Ga0207695_10000139 | 3300025913 | Bacteria | 216873 |
| 101 | Ga0207695_10001270 | 3300025913 | Bacteria | 42915 |
| 102 | Ga0207695_10026872 | 3300025913 | Bacteria | 6417 |
| 103 | Ga0207671_10000325 | 3300025914 | Bacteria | 70129 |
| 104 | Ga0207671_10018110 | 3300025914 | Bacteria | 5411 |
| 105 | Ga0207671_10074728 | 3300025914 | Bacteria | 2533 |
| 106 | Ga0207662_10056109 | 3300025918 | Bacteria | 2352 |
| 107 | Ga0207662_10096810 | 3300025918 | Bacteria | 1824 |
| 108 | Ga0207681_10322240 | 3300025923 | Bacteria | 1229 |
| 109 | Ga0207650_10049525 | 3300025925 | Bacteria | 3102 |
| 110 | Ga0207659_10154324 | 3300025926 | Bacteria | 1796 |
| 111 | Ga0207690_10438321 | 3300025932 | Bacteria | 1048 |
| 112 | Ga0207686_10000442 | 3300025934 | Bacteria | 27861 |
| 113 | Ga0207686_10229145 | 3300025934 | Bacteria | 1346 |
| 114 | Ga0207670_10173541 | 3300025936 | Unclassified | 1618 |
| 115 | Ga0207670_10323975 | 3300025936 | Bacteria | 1213 |
| 116 | Ga0207669_10206325 | 3300025937 | Bacteria | 1431 |
| 117 | Ga0207689_10029212 | 3300025942 | Bacteria | 4606 |
| 118 | Ga0207689_10135990 | 3300025942 | Unclassified | 2024 |
| 119 | Ga0207661_10017013 | 3300025944 | Bacteria | 5371 |
| 120 | Ga0207667_10006621 | 3300025949 | Bacteria | 14003 |
| 121 | Ga0207667_10048110 | 3300025949 | Bacteria | 4511 |
| 122 | Ga0207651_10049512 | 3300025960 | Bacteria | 2847 |
| 123 | Ga0207712_10026619 | 3300025961 | Bacteria | 3855 |
| 124 | Ga0207712_10028218 | 3300025961 | Bacteria | 3752 |
| 125 | Ga0207712_10574265 | 3300025961 | Bacteria | 972 |
| 126 | Ga0207639_10413900 | 3300026041 | Bacteria | 1217 |
| 127 | Ga0207708_10061469 | 3300026075 | Bacteria | 2868 |
| 128 | Ga0207641_10000111 | 3300026088 | Bacteria | 120527 |
| 129 | Ga0207648_10262047 | 3300026089 | Bacteria | 1542 |
| 130 | Ga0207674_10055055 | 3300026116 | Bacteria | 4047 |
| 131 | Ga0207675_100051640 | 3300026118 | Bacteria | 3836 |
| 132 | Ga0207683_10245462 | 3300026121 | Bacteria | 1633 |
| 133 | Ga0207698_10071532 | 3300026142 | Bacteria | 2753 |
| 134 | Ga0207698_10415715 | 3300026142 | Bacteria | 1289 |
| 135 | Ga0207698_10512946 | 3300026142 | Bacteria | 1169 |
| 136 | Ga0268266_10000146 | 3300028379 | Bacteria | 135225 |
| 137 | Ga0268265_10218296 | 3300028380 | Bacteria | 1667 |
| 138 | Ga0268264_10000013 | 3300028381 | Bacteria | 513859 |
| 139 | Ga0268264_10620193 | 3300028381 | Bacteria | 1068 |
| 140 | Ga0307517_10007381 | 3300028786 | Bacteria | 16035 |
| 141 | Ga0307511_10000024 | 3300030521 | Bacteria | 112616 |
| 142 | Ga0307509_10125636 | 3300031507 | Unclassified | 2532 |
| 143 | Ga0307408_100000164 | 3300031548 | Bacteria | 73855 |
| 144 | Ga0307516_10009496 | 3300031730 | Bacteria | 10837 |
| 145 | Ga0307516_10138753 | 3300031730 | Unclassified | 2203 |
| 146 | Ga0307412_10001422 | 3300031911 | Bacteria | 13337 |
| 147 | Ga0307414_10101903 | 3300032004 | Bacteria | 2162 |
| 148 | Ga0307414_10107793 | 3300032004 | Bacteria | 2112 |
| 149 | Ga0307510_10028173 | 3300033180 | Bacteria | 6417 |
| 150 | Ga0451807_0352324 | 3300041486 | Bacteria | 1516 |
| 151 | Ga0439431_0005084 | 3300041997 | Bacteria | 2900 |
| 152 | Ga0450923_002165 | 3300042125 | Bacteria | 2767 |
| 153 | Ga0450898_006421 | 3300042134 | Bacteria | 1804 |
| 154 | Ga0466972_0000016 | 3300044658 | Bacteria | 208802 |
| 155 | Ga0466972_0033325 | 3300044658 | Bacteria | 2526 |
| 156 | Ga0466965_0089668 | 3300044683 | Bacteria | 1563 |
| 157 | Ga0466964_0103394 | 3300044706 | Bacteria | 1259 |
| 158 | Ga0466970_0003015 | 3300044765 | Bacteria | 8162 |
| 159 | Ga0466959_0016615 | 3300045049 | Bacteria | 5381 |
| 160 | Ga0495638_0038884 | 3300046460 | Bacteria | 3022 |
| 161 | Ga0495606_0033396 | 3300046507 | Unclassified | 3549 |
| 162 | Ga0495648_0001894 | 3300046524 | Bacteria | 19973 |
| 163 | Ga0495611_0000042 | 3300046648 | Bacteria | 94996 |
| 164 | Ga0495672_0062623 | 3300047320 | Bacteria | 2139 |
| 165 | Ga0495687_000010 | 3300047443 | Bacteria | 413735 |
| 166 | Ga0495686_0000102 | 3300047472 | Bacteria | 177525 |
| 167 | Ga0495686_0118728 | 3300047472 | Bacteria | 1579 |
| 168 | Ga0501047_0333324 | 3300049581 | Unclassified | 1356 |
| 169 | nmdc:mga09592_129035_c1 | 3300050508 | Bacteria | 2175 |
| 170 | nmdc:mga0qj67_25282_c1 | 3300050509 | Bacteria | 4587 |
| 171 | nmdc:mga06r32_470207_c1 | 3300050510 | Bacteria | 1236 |
| 172 | Ga0500583_0000474 | 3300053092 | Bacteria | 12540 |
| 173 | Ga0500622_0006708 | 3300053156 | Bacteria | 6635 |
| 174 | Ga0500637_0033044 | 3300053178 | Unclassified | 2888 |
| 175 | Ga0466962_0021438 | 3300061719 | Unclassified | 3102 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006880 | Ga0075429_100015670 | Ga0075429_1000156704 | 234 |
| 2 | 3300005290 | Ga0065712_10010803 | Ga0065712_100108033 | 236 |
| 3 | 3300005543 | Ga0070672_100193490 | Ga0070672_1001934902 | 236 |
| 4 | 3300042134 | Ga0450898_006421 | Ga0450898_006421_795_1613 | 241 |
| 5 | 3300005617 | Ga0068859_100323685 | Ga0068859_1003236852 | 243 |
| 6 | 3300006931 | Ga0097620_100323688 | Ga0097620_1003236882 | 243 |
| 7 | 3300025961 | Ga0207712_10574265 | Ga0207712_105742651 | 243 |
| 8 | 3300042125 | Ga0450923_002165 | Ga0450923_002165_1359_2174 | 243 |
| 9 | 3300005290 | Ga0065712_10083359 | Ga0065712_100833592 | 246 |
| 10 | 3300005343 | Ga0070687_100288184 | Ga0070687_1002881841 | 246 |
| 11 | 3300028381 | Ga0268264_10620193 | Ga0268264_106201932 | 246 |
| 12 | 3300041486 | Ga0451807_0352324 | Ga0451807_0352324_329_1138 | 246 |
| 13 | 3300005290 | Ga0065712_10084317 | Ga0065712_100843171 | 247 |
| 14 | 3300005331 | Ga0070670_100027400 | Ga0070670_1000274002 | 247 |
| 15 | 3300005340 | Ga0070689_100260396 | Ga0070689_1002603962 | 247 |
| 16 | 3300005354 | Ga0070675_100077527 | Ga0070675_1000775272 | 247 |
| 17 | 3300005364 | Ga0070673_100254636 | Ga0070673_1002546362 | 247 |
| 18 | 3300013308 | Ga0157375_10114846 | Ga0157375_101148462 | 247 |
| 19 | 3300025925 | Ga0207650_10049525 | Ga0207650_100495253 | 247 |
| 20 | 3300025926 | Ga0207659_10154324 | Ga0207659_101543242 | 247 |
| 21 | 3300025934 | Ga0207686_10229145 | Ga0207686_102291451 | 247 |
| 22 | 3300025936 | Ga0207670_10323975 | Ga0207670_103239752 | 247 |
| 23 | 3300025942 | Ga0207689_10135990 | Ga0207689_101359902 | 247 |
| 24 | 3300025960 | Ga0207651_10049512 | Ga0207651_100495122 | 247 |
| 25 | 3300026089 | Ga0207648_10262047 | Ga0207648_102620472 | 247 |
| 26 | 3300047472 | Ga0495686_0000102 | Ga0495686_0000102_148960_149772 | 247 |
| 27 | 3300005841 | Ga0068863_100003524 | Ga0068863_1000035244 | 248 |
| 28 | 3300026088 | Ga0207641_10000111 | Ga0207641_1000011192 | 248 |
| 29 | 3300005290 | Ga0065712_10089341 | Ga0065712_100893412 | 249 |
| 30 | 3300005337 | Ga0070682_100017121 | Ga0070682_1000171212 | 249 |
| 31 | 3300014969 | Ga0157376_10653344 | Ga0157376_106533442 | 249 |
| 32 | 3300025942 | Ga0207689_10029212 | Ga0207689_100292122 | 249 |
| 33 | 3300041997 | Ga0439431_0005084 | Ga0439431_0005084_852_1670 | 249 |
| 34 | 3300005719 | Ga0068861_100028653 | Ga0068861_1000286534 | 250 |
| 35 | 3300005466 | Ga0070685_10005151 | Ga0070685_100051512 | 251 |
| 36 | 3300005544 | Ga0070686_100050581 | Ga0070686_1000505812 | 251 |
| 37 | 3300005719 | Ga0068861_100185684 | Ga0068861_1001856842 | 251 |
| 38 | 3300005841 | Ga0068863_100165142 | Ga0068863_1001651423 | 251 |
| 39 | 3300005843 | Ga0068860_100815794 | Ga0068860_1008157941 | 251 |
| 40 | 3300009176 | Ga0105242_10426022 | Ga0105242_104260222 | 251 |
| 41 | 3300009553 | Ga0105249_10146589 | Ga0105249_101465892 | 251 |
| 42 | 3300013306 | Ga0163162_10027069 | Ga0163162_100270692 | 251 |
| 43 | 3300013308 | Ga0157375_10064962 | Ga0157375_100649622 | 251 |
| 44 | 3300014969 | Ga0157376_10064376 | Ga0157376_100643762 | 251 |
| 45 | 3300017792 | Ga0163161_10065437 | Ga0163161_100654372 | 251 |
| 46 | 3300025918 | Ga0207662_10096810 | Ga0207662_100968102 | 251 |
| 47 | 3300025936 | Ga0207670_10173541 | Ga0207670_101735412 | 251 |
| 48 | 3300025961 | Ga0207712_10028218 | Ga0207712_100282182 | 251 |
| 49 | 3300026142 | Ga0207698_10512946 | Ga0207698_105129462 | 251 |
| 50 | 3300005366 | Ga0070659_100254784 | Ga0070659_1002547841 | 253 |
| 51 | 3300025932 | Ga0207690_10438321 | Ga0207690_104383211 | 253 |
| 52 | 3300026116 | Ga0207674_10055055 | Ga0207674_100550552 | 257 |
| 53 | 3300003320 | rootH2_10018543 | rootH2_1001854314 | 258 |
| 54 | 3300006844 | Ga0075428_100034368 | Ga0075428_1000343682 | 258 |
| 55 | 3300013307 | Ga0157372_10003187 | Ga0157372_1000318713 | 262 |
| 56 | 3300014969 | Ga0157376_10493840 | Ga0157376_104938402 | 262 |
| 57 | 3300031548 | Ga0307408_100000164 | Ga0307408_10000016434 | 262 |
| 58 | iso_pu_bacteria | 2883068021 | 2883072036 | 262 |
| 59 | 3300005353 | Ga0070669_100631454 | Ga0070669_1006314541 | 263 |
| 60 | 3300005354 | Ga0070675_100125664 | Ga0070675_1001256643 | 263 |
| 61 | 3300005471 | Ga0070698_100003616 | Ga0070698_1000036164 | 263 |
| 62 | 3300005518 | Ga0070699_100317214 | Ga0070699_1003172141 | 263 |
| 63 | 3300005618 | Ga0068864_100084970 | Ga0068864_1000849702 | 263 |
| 64 | 3300006237 | Ga0097621_100022393 | Ga0097621_1000223933 | 263 |
| 65 | 3300006237 | Ga0097621_100520429 | Ga0097621_1005204292 | 263 |
| 66 | 3300006358 | Ga0068871_100004061 | Ga0068871_1000040615 | 263 |
| 67 | 3300006844 | Ga0075428_100032434 | Ga0075428_1000324344 | 263 |
| 68 | 3300006844 | Ga0075428_100228424 | Ga0075428_1002284242 | 263 |
| 69 | 3300006846 | Ga0075430_100003699 | Ga0075430_1000036997 | 263 |
| 70 | 3300006847 | Ga0075431_100015945 | Ga0075431_1000159458 | 263 |
| 71 | 3300009147 | Ga0114129_10103401 | Ga0114129_101034014 | 263 |
| 72 | 3300009174 | Ga0105241_10257251 | Ga0105241_102572512 | 263 |
| 73 | 3300009176 | Ga0105242_10001987 | Ga0105242_100019874 | 263 |
| 74 | 3300013306 | Ga0163162_10020741 | Ga0163162_100207412 | 263 |
| 75 | 3300014326 | Ga0157380_10090198 | Ga0157380_100901983 | 263 |
| 76 | 3300014969 | Ga0157376_10029380 | Ga0157376_100293803 | 263 |
| 77 | 3300017792 | Ga0163161_10136796 | Ga0163161_101367961 | 263 |
| 78 | 3300025918 | Ga0207662_10056109 | Ga0207662_100561092 | 263 |
| 79 | 3300025923 | Ga0207681_10322240 | Ga0207681_103222401 | 263 |
| 80 | 3300025934 | Ga0207686_10000442 | Ga0207686_1000044218 | 263 |
| 81 | 3300025937 | Ga0207669_10206325 | Ga0207669_102063252 | 263 |
| 82 | 3300025961 | Ga0207712_10026619 | Ga0207712_100266192 | 263 |
| 83 | 3300026075 | Ga0207708_10061469 | Ga0207708_100614692 | 263 |
| 84 | 3300026121 | Ga0207683_10245462 | Ga0207683_102454622 | 263 |
| 85 | 3300028380 | Ga0268265_10218296 | Ga0268265_102182963 | 263 |
| 86 | 3300031911 | Ga0307412_10001422 | Ga0307412_1000142210 | 263 |
| 87 | 3300032004 | Ga0307414_10107793 | Ga0307414_101077932 | 263 |
| 88 | 3300044658 | Ga0466972_0000016 | Ga0466972_0000016_46422_47225 | 263 |
| 89 | 3300044765 | Ga0466970_0003015 | Ga0466970_0003015_7301_8104 | 263 |
| 90 | 3300047320 | Ga0495672_0062623 | Ga0495672_0062623_439_1245 | 263 |
| 91 | 3300050508 | nmdc:mga09592_129035_c1 | nmdc:mga09592_129035_c1_1066_1881 | 263 |
| 92 | 3300050509 | nmdc:mga0qj67_25282_c1 | nmdc:mga0qj67_25282_c1_1049_1864 | 263 |
| 93 | 3300050510 | nmdc:mga06r32_470207_c1 | nmdc:mga06r32_470207_c1_232_1047 | 263 |
| 94 | 3300005353 | Ga0070669_100200367 | Ga0070669_1002003672 | 265 |
| 95 | 3300005617 | Ga0068859_100431747 | Ga0068859_1004317472 | 265 |
| 96 | 3300006931 | Ga0097620_100431769 | Ga0097620_1004317692 | 265 |
| 97 | 3300026118 | Ga0207675_100051640 | Ga0207675_1000516402 | 265 |
| 98 | 3300032004 | Ga0307414_10101903 | Ga0307414_101019032 | 265 |
| 99 | 3300003323 | rootH1_10397825 | rootH1_103978252 | 266 |
| 100 | 3300005367 | Ga0070667_100329925 | Ga0070667_1003299251 | 266 |
| 101 | 3300005616 | Ga0068852_100091012 | Ga0068852_1000910122 | 266 |
| 102 | 3300009093 | Ga0105240_10000117 | Ga0105240_10000117156 | 266 |
| 103 | 3300009093 | Ga0105240_10000119 | Ga0105240_10000119140 | 266 |
| 104 | 3300009545 | Ga0105237_10104130 | Ga0105237_101041303 | 266 |
| 105 | 3300009551 | Ga0105238_10027498 | Ga0105238_100274982 | 266 |
| 106 | 3300010375 | Ga0105239_10000097 | Ga0105239_10000097117 | 266 |
| 107 | 3300010375 | Ga0105239_10011362 | Ga0105239_100113623 | 266 |
| 108 | 3300013104 | Ga0157370_10049954 | Ga0157370_100499542 | 266 |
| 109 | 3300025913 | Ga0207695_10000077 | Ga0207695_10000077122 | 266 |
| 110 | 3300025913 | Ga0207695_10000139 | Ga0207695_1000013964 | 266 |
| 111 | 3300025913 | Ga0207695_10026872 | Ga0207695_100268724 | 266 |
| 112 | 3300025914 | Ga0207671_10074728 | Ga0207671_100747283 | 266 |
| 113 | 3300026041 | Ga0207639_10413900 | Ga0207639_104139002 | 266 |
| 114 | 3300044683 | Ga0466965_0089668 | Ga0466965_0089668_100_909 | 266 |
| 115 | 3300044706 | Ga0466964_0103394 | Ga0466964_0103394_250_1059 | 266 |
| 116 | 3300047472 | Ga0495686_0118728 | Ga0495686_0118728_346_1155 | 266 |
| 117 | 3300005329 | Ga0070683_100014906 | Ga0070683_1000149064 | 267 |
| 118 | 3300005535 | Ga0070684_100090701 | Ga0070684_1000907011 | 267 |
| 119 | 3300005548 | Ga0070665_100000031 | Ga0070665_10000003124 | 267 |
| 120 | 3300005563 | Ga0068855_100024164 | Ga0068855_1000241643 | 267 |
| 121 | 3300005616 | Ga0068852_100064335 | Ga0068852_1000643355 | 267 |
| 122 | 3300009093 | Ga0105240_10088307 | Ga0105240_100883071 | 267 |
| 123 | 3300009545 | Ga0105237_10081913 | Ga0105237_100819132 | 267 |
| 124 | 3300010375 | Ga0105239_10008674 | Ga0105239_100086743 | 267 |
| 125 | 3300010375 | Ga0105239_10037142 | Ga0105239_100371423 | 267 |
| 126 | 3300013100 | Ga0157373_10027805 | Ga0157373_100278052 | 267 |
| 127 | 3300013307 | Ga0157372_10103332 | Ga0157372_101033326 | 267 |
| 128 | 3300013307 | Ga0157372_10362479 | Ga0157372_103624792 | 267 |
| 129 | 3300025913 | Ga0207695_10000060 | Ga0207695_1000006085 | 267 |
| 130 | 3300025944 | Ga0207661_10017013 | Ga0207661_100170134 | 267 |
| 131 | 3300025949 | Ga0207667_10006621 | Ga0207667_1000662114 | 267 |
| 132 | 3300026142 | Ga0207698_10415715 | Ga0207698_104157153 | 267 |
| 133 | 3300028379 | Ga0268266_10000146 | Ga0268266_1000014624 | 267 |
| 134 | 3300030521 | Ga0307511_10000024 | Ga0307511_1000002427 | 267 |
| 135 | 3300031730 | Ga0307516_10009496 | Ga0307516_100094969 | 267 |
| 136 | 3300031730 | Ga0307516_10138753 | Ga0307516_101387533 | 267 |
| 137 | 3300044658 | Ga0466972_0033325 | Ga0466972_0033325_677_1480 | 267 |
| 138 | 3300053178 | Ga0500637_0033044 | Ga0500637_0033044_391_1203 | 267 |
| 139 | 3300003322 | rootL2_10017946 | rootL2_100179461 | 268 |
| 140 | 3300005843 | Ga0068860_100000082 | Ga0068860_100000082100 | 268 |
| 141 | 3300009545 | Ga0105237_10007261 | Ga0105237_100072618 | 268 |
| 142 | 3300013306 | Ga0163162_10000473 | Ga0163162_1000047325 | 268 |
| 143 | 3300025914 | Ga0207671_10000325 | Ga0207671_1000032511 | 268 |
| 144 | 3300028381 | Ga0268264_10000013 | Ga0268264_10000013359 | 268 |
| 145 | 3300046460 | Ga0495638_0038884 | Ga0495638_0038884_724_1539 | 268 |
| 146 | 3300046524 | Ga0495648_0001894 | Ga0495648_0001894_668_1483 | 268 |
| 147 | 3300047443 | Ga0495687_000010 | Ga0495687_000010_161808_162623 | 268 |
| 148 | 3300049581 | Ga0501047_0333324 | Ga0501047_0333324_205_1011 | 268 |
| 149 | 3300053092 | Ga0500583_0000474 | Ga0500583_0000474_11325_12140 | 268 |
| 150 | 3300053156 | Ga0500622_0006708 | Ga0500622_0006708_1176_1991 | 268 |
| 151 | 3300003316 | rootH1_10000847 | rootH1_100008473 | 269 |
| 152 | 3300003316 | rootH1_10118958 | rootH1_101189582 | 269 |
| 153 | 3300003320 | rootH2_10010421 | rootH2_1001042123 | 269 |
| 154 | 3300005563 | Ga0068855_100058726 | Ga0068855_1000587264 | 269 |
| 155 | 3300009093 | Ga0105240_10002157 | Ga0105240_1000215728 | 269 |
| 156 | 3300009093 | Ga0105240_10043338 | Ga0105240_100433381 | 269 |
| 157 | 3300009545 | Ga0105237_10011360 | Ga0105237_100113609 | 269 |
| 158 | 3300009545 | Ga0105237_10435657 | Ga0105237_104356572 | 269 |
| 159 | 3300009551 | Ga0105238_10096678 | Ga0105238_100966782 | 269 |
| 160 | 3300010375 | Ga0105239_10000313 | Ga0105239_1000031351 | 269 |
| 161 | 3300013296 | Ga0157374_10000002 | Ga0157374_10000002583 | 269 |
| 162 | 3300013307 | Ga0157372_10000617 | Ga0157372_1000061714 | 269 |
| 163 | 3300013307 | Ga0157372_10447325 | Ga0157372_104473252 | 269 |
| 164 | 3300014969 | Ga0157376_10003410 | Ga0157376_1000341010 | 269 |
| 165 | 3300025913 | Ga0207695_10001270 | Ga0207695_1000127029 | 269 |
| 166 | 3300025914 | Ga0207671_10018110 | Ga0207671_100181107 | 269 |
| 167 | 3300025949 | Ga0207667_10048110 | Ga0207667_100481104 | 269 |
| 168 | 3300026142 | Ga0207698_10071532 | Ga0207698_100715321 | 269 |
| 169 | 3300028786 | Ga0307517_10007381 | Ga0307517_100073812 | 269 |
| 170 | 3300031507 | Ga0307509_10125636 | Ga0307509_101256364 | 269 |
| 171 | 3300033180 | Ga0307510_10028173 | Ga0307510_100281732 | 269 |
| 172 | 3300045049 | Ga0466959_0016615 | Ga0466959_0016615_642_1472 | 269 |
| 173 | 3300046507 | Ga0495606_0033396 | Ga0495606_0033396_2227_3099 | 269 |
| 174 | 3300046648 | Ga0495611_0000042 | Ga0495611_0000042_28788_29621 | 269 |
| 175 | 3300061719 | Ga0466962_0021438 | Ga0466962_0021438_557_1387 | 269 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7f5i-assembly1.cif.gz_A | x-ray structure of clostridium perfringens-specific amidase endolysin | 0.6267 | 60 | 176 |
| 3d2y-assembly1.cif.gz_A | complex of the n-acetylmuramyl-l-alanine amidase amid from e.coli with the substrate anhydro-n-acetylmuramic acid-l-ala-d-gamma-glu-l-lys | 0.6236 | 69 | 268 |
| 4bol-assembly1.cif.gz_A | crystal structure of ampdh2 from pseudomonas aeruginosa in complex with pentapeptide | 0.6234 | 68 | 261 |
| 6ssc-assembly1.cif.gz_A | n-acetylmuramoyl-l-alanine amidase lysc from clostridium intestinale urnw | 0.6013 | 44 | 202 |
| 6srt-assembly1.cif.gz_A | endolysine n-acetylmuramoyl-l-alanine amidase lyscs from clostridium intestinale urnw | 0.5989 | 44 | 202 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P75820_43_192_3.40.80.10 | Alpha Beta;3-Layer(aba) Sandwich;Lysozyme-like;Peptidoglycan recognition protein-like | 0.7298 | 67 | 203 | 3.40.80.10 |
| 4bpaB01 | Alpha Beta;3-Layer(aba) Sandwich;Lysozyme-like;Peptidoglycan recognition protein-like | 0.7152 | 68 | 201 | 3.40.80.10 |
| af_C0H5A2_319_480_2.40.50.1070 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); | 0.6924 | 145 | 176 | 2.40.50.1070 |
| af_P75820_43_192_3.40.80.10 | Alpha Beta;3-Layer(aba) Sandwich;Lysozyme-like;Peptidoglycan recognition protein-like | 0.6686 | 67 | 203 | 3.40.80.10 |
| af_A0A1D6PEB4_49_302_3.60.21.10 | Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases | 0.6598 | 136 | 177 | 3.60.21.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D2RBY0-F1-model_v4 | deleted | 0.7641 | 81 | 205 |
|
| AF-A0A037ZLR7-F1-model_v4 | N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28) | 0.7415 | 70 | 217 |
GO:0005576
GO:0008745 GO:0009253 GO:0009254 GO:0071555 |
| AF-A0A849WVF8-F1-model_v4 | N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28) | 0.7305 | 66 | 176 |
GO:0005576
GO:0008745 GO:0009253 GO:0009254 GO:0071555 |
| AF-A0A2E8PR97-F1-model_v4 | N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28) | 0.7279 | 68 | 176 |
GO:0005576
GO:0008745 GO:0009253 GO:0009254 GO:0016020 GO:0071555 |
| AF-A0A7C5LR31-F1-model_v4 | N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28) | 0.7234 | 53 | 205 |
GO:0005576
GO:0008745 GO:0009253 GO:0009254 GO:0019867 GO:0071555 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar