F266897

General Info

Members Datasets Scaffolds Average Seq Length
175 102 166 223

Family's Representative Sequence

Representative Sequence 3300046471|Ga0495650_0000701|Ga0495650_0000701_19094_19852
Length 252
Sequence MPIWKSRYYLIFIITTGIDMCVNFRPPDPELLDTVMGVIVNLHDTGFWRAETWKDYGAPIVRRSAAGQREGLLASYGMVPRKRIPPGVRPFDTMNARAETVGQLRSFSGAWKKSQLCLVPMTAFYEPNYESGKAVRWGIGMADQSMFAVGGLWREWDGEAGPEHSFTQLTINADDHPLMKRFHKPGDEKRALVIVPQAEWDDWLNCTDLEYARSFLRPYPAEQMSAWEFPIPPRAKKQEPVIPTPDTQMGLL

Samples

Sample ID Description Type Environment
1 2643221645 Massilia sp. Root351 Isolate Unclassified
2 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
3 2821131069 Duganella sp. 1224 Isolate Unclassified
4 2842711865 Duganella sp. R-73148 Isolate Unclassified
5 2857558681 Duganella sp. R-74565 Isolate Unclassified
6 2857564685 Duganella sp. R-74599 Isolate Unclassified
7 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
8 2998344455 Vogesella urethralis SLBN-145 Isolate Rhizosphere
9 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
10 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
11 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
12 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
13 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
14 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
15 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
16 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
17 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
18 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
19 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
20 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
21 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
22 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
23 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
24 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
25 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
26 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
27 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
28 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
29 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
30 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
31 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
32 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
33 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
34 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
35 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
36 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
38 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
39 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
40 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
41 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
42 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
43 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
44 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
45 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
46 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
47 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
48 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
49 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
50 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
51 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
52 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
53 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
54 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
55 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
56 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
57 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
58 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
59 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
60 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
61 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
62 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
63 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
64 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
65 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
66 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
67 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
68 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
69 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
70 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
71 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
72 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
73 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
74 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
75 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
76 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
77 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
78 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
79 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
80 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
81 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
82 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
83 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
84 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
85 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
86 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
87 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
88 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
89 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
90 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
91 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
92 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
93 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
94 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
95 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
96 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
97 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
98 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
99 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
100 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
101 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
102 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.86
Metatranscriptomes 0
Isolates 5.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.57
Nodule 1.14
Rhizoplane 2.86
Rhizosphere 67.43
Stem 0
Stem Tuber 0
Unclassified 8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25158J39367_1000007 3300002739 Bacteria 54539
2 JGI25158J39367_1000677 3300002739 Bacteria 6599
3 JGI25152J39213_1022319 3300002773 Bacteria 1097
4 JGI25159J45721_1000164 3300002987 Bacteria 30978
5 JGI25159J45721_1000395 3300002987 Bacteria 20292
6 rootH2_10336503 3300003320 Unclassified 1053
7 rootL2_10034274 3300003322 Bacteria 10155
8 rootL2_10048739 3300003322 Bacteria 19368
9 rootL2_10140043 3300003322 Bacteria 6844
10 rootH1_10294028 3300003323 Unclassified 1267
11 JGI25160J50197_1000132 3300003354 Bacteria 67285
12 JGI25161J50226_1000105 3300003374 Bacteria 67332
13 JGI25161J50226_1000423 3300003374 Bacteria 20220
14 Ga0055526_1000064 3300003771 Bacteria 102469
15 Ga0055526_1000133 3300003771 Bacteria 66252
16 Ga0055526_1003995 3300003771 Bacteria 9076
17 Ga0055526_1012070 3300003771 Bacteria 3814
18 Ga0055537_1000093 3300003773 Bacteria 66252
19 Ga0055524_1000192 3300003775 Bacteria 67279
20 Ga0055524_1012697 3300003775 Unclassified 3219
21 Ga0055534_1000098 3300003784 Bacteria 67094
22 Ga0055530_10000193 3300003791 Bacteria 54610
23 Ga0055531_10015739 3300003794 Bacteria 3310
24 Ga0055543_1000101 3300004625 Bacteria 74568
25 Ga0055543_1000303 3300004625 Bacteria 34642
26 Ga0065165_1000282 3300005262 Bacteria 86839
27 Ga0065165_1001491 3300005262 Bacteria 24824
28 Ga0099826_10000002 3300006948 Bacteria 1125830
29 Ga0105244_10004778 3300009036 Bacteria 9212
30 Ga0213872_10000257 3300021361 Bacteria 46166
31 Ga0213872_10063559 3300021361 Bacteria 1668
32 Ga0209436_100028 3300025208 Bacteria 86801
33 Ga0209436_100341 3300025208 Bacteria 21099
34 Ga0209565_1000157 3300025263 Bacteria 90679
35 Ga0209673_1054292 3300025273 Unclassified 1039
36 Ga0209130_1000171 3300025284 Bacteria 94371
37 Ga0209130_1000189 3300025284 Bacteria 86853
38 Ga0209675_1000158 3300025291 Bacteria 87345
39 Ga0209564_1000007 3300025295 Bacteria 1028582
40 Ga0209564_1000342 3300025295 Bacteria 89220
41 Ga0209256_1000214 3300025299 Bacteria 107799
42 Ga0207426_1000343 3300025302 Bacteria 86853
43 Ga0207655_1003881 3300025728 Bacteria 10871
44 Ga0209282_1000001 3300027666 Bacteria 2450367
45 Ga0307408_100002472 3300031548 Bacteria 12958
46 Ga0307408_100003910 3300031548 Bacteria 10152
47 Ga0307408_100065612 3300031548 Bacteria 2663
48 Ga0265314_10024503 3300031711 Bacteria 4574
49 Ga0395900_0201584 3300037418 Bacteria 2013
50 Ga0395898_0000745 3300037466 Bacteria 56806
51 Ga0395905_0007676 3300037471 Bacteria 10704
52 Ga0395905_0132759 3300037471 Bacteria 2342
53 Ga0395901_0170762 3300038443 Bacteria 2282
54 Ga0395901_1178297 3300038443 Bacteria 733
55 Ga0436361_0125110 3300039447 Bacteria 71341
56 Ga0436361_1199241 3300039447 Bacteria 2814
57 Ga0450904_000849 3300042139 Bacteria 5036
58 Ga0466969_0005260 3300044656 Bacteria 6893
59 Ga0466966_0078659 3300044684 Bacteria 2056
60 Ga0466961_0001005 3300044693 Bacteria 17409
61 Ga0466959_0065873 3300045049 Bacteria 2628
62 Ga0495617_000018 3300046452 Bacteria 248300
63 Ga0495617_018924 3300046452 Bacteria 2330
64 Ga0495638_0040942 3300046460 Bacteria 2934
65 Ga0495638_0043956 3300046460 Bacteria 2816
66 Ga0495638_0097203 3300046460 Bacteria 1766
67 Ga0495638_0103748 3300046460 Bacteria 1697
68 Ga0495638_0338138 3300046460 Bacteria 799
69 Ga0495650_0000195 3300046471 Bacteria 131338
70 Ga0495650_0000701 3300046471 Bacteria 42968
71 Ga0495580_0008709 3300046472 Bacteria 8044
72 Ga0495605_0180130 3300046474 Bacteria 929
73 Ga0495639_0220132 3300046475 Bacteria 933
74 Ga0495594_0275190 3300046499 Bacteria 959
75 Ga0495596_0025333 3300046500 Bacteria 2398
76 Ga0495607_0009903 3300046501 Bacteria 6424
77 Ga0495583_0000548 3300046506 Bacteria 52694
78 Ga0495583_0000587 3300046506 Bacteria 49879
79 Ga0495583_0001625 3300046506 Bacteria 22004
80 Ga0495606_0000291 3300046507 Bacteria 86832
81 Ga0495606_0000330 3300046507 Bacteria 81940
82 Ga0495606_0001239 3300046507 Bacteria 35637
83 Ga0495606_0019659 3300046507 Bacteria 5013
84 Ga0495606_0031760 3300046507 Bacteria 3667
85 Ga0495610_0000008 3300046512 Bacteria 622732
86 Ga0495610_0000401 3300046512 Bacteria 44551
87 Ga0495610_0000877 3300046512 Bacteria 28001
88 Ga0495610_0002787 3300046512 Bacteria 14313
89 Ga0495610_0004459 3300046512 Bacteria 10347
90 Ga0495610_0011789 3300046512 Bacteria 5311
91 Ga0495610_0130745 3300046512 Bacteria 1090
92 Ga0495616_0000095 3300046513 Bacteria 74912
93 Ga0495616_0022586 3300046513 Bacteria 3397
94 Ga0495616_0145258 3300046513 Bacteria 1077
95 Ga0495630_0658340 3300046517 Bacteria 802
96 Ga0495632_0078811 3300046519 Bacteria 1573
97 Ga0495637_0004268 3300046520 Bacteria 7424
98 Ga0495637_0146136 3300046520 Bacteria 894
99 Ga0495643_0000127 3300046522 Bacteria 123390
100 Ga0495643_0005950 3300046522 Bacteria 8139
101 Ga0495643_0036838 3300046522 Bacteria 2685
102 Ga0495644_0017601 3300046523 Bacteria 2732
103 Ga0495648_0000140 3300046524 Bacteria 85868
104 Ga0495648_0079800 3300046524 Bacteria 1866
105 Ga0495666_0002421 3300046526 Bacteria 9282
106 Ga0495642_0022782 3300046528 Bacteria 2469
107 Ga0495642_0040356 3300046528 Bacteria 1895
108 Ga0495642_0134761 3300046528 Bacteria 1064
109 Ga0495654_0162408 3300046530 Bacteria 980
110 Ga0495665_0060168 3300046531 Bacteria 2005
111 Ga0495665_0066840 3300046531 Bacteria 1896
112 Ga0495609_0000292 3300046538 Bacteria 46197
113 Ga0495609_0000320 3300046538 Bacteria 42940
114 Ga0495609_0018450 3300046538 Bacteria 3232
115 Ga0495609_0146359 3300046538 Bacteria 1006
116 Ga0495597_0000228 3300046542 Bacteria 50672
117 Ga0495597_0002785 3300046542 Bacteria 10751
118 Ga0495597_0021462 3300046542 Bacteria 3002
119 Ga0495597_0022463 3300046542 Bacteria 2926
120 Ga0495622_0000004 3300046557 Bacteria 258984
121 Ga0495622_0000831 3300046557 Bacteria 17025
122 Ga0495633_0002889 3300046558 Bacteria 11774
123 Ga0495633_0055728 3300046558 Bacteria 1858
124 Ga0495668_0000027 3300046616 Bacteria 297194
125 Ga0495625_0000298 3300046660 Bacteria 76831
126 Ga0495625_0009305 3300046660 Bacteria 8234
127 Ga0495625_0060343 3300046660 Bacteria 2687
128 Ga0495625_0192953 3300046660 Bacteria 1348
129 Ga0495661_0003042 3300046665 Bacteria 12633
130 Ga0495661_0024061 3300046665 Bacteria 3945
131 Ga0495670_0016543 3300046691 Bacteria 3626
132 Ga0495671_0000001 3300046692 Bacteria 1169494
133 Ga0495671_0001707 3300046692 Bacteria 14314
134 Ga0495671_0042940 3300046692 Bacteria 2270
135 Ga0495671_0051009 3300046692 Bacteria 2059
136 Ga0495671_0153700 3300046692 Bacteria 1120
137 Ga0495649_0001067 3300046694 Bacteria 21406
138 Ga0495649_0042372 3300046694 Bacteria 2487
139 Ga0495589_0079513 3300046794 Bacteria 1595
140 Ga0495660_0007830 3300046810 Bacteria 6274
141 Ga0495604_0037015 3300047317 Bacteria 3844
142 Ga0495687_003055 3300047443 Bacteria 12557
143 Ga0495687_030026 3300047443 Bacteria 2507
144 Ga0495679_000135 3300047446 Bacteria 65867
145 Ga0495679_022061 3300047446 Bacteria 2185
146 Ga0495673_0000003 3300047469 Bacteria 1491337
147 Ga0495673_0000026 3300047469 Bacteria 476378
148 Ga0495681_0178981 3300047470 Bacteria 872
149 Ga0495686_0001510 3300047472 Bacteria 25040
150 Ga0495615_0056306 3300048090 Bacteria 1026
151 Ga0495626_0001382 3300048091 Bacteria 19521
152 Ga0495626_0025791 3300048091 Bacteria 2871
153 Ga0495626_0109200 3300048091 Bacteria 1199
154 Ga0495626_0152242 3300048091 Bacteria 974
155 Ga0496102_0042593 3300048905 Bacteria 4114
156 Ga0496105_0120104 3300048908 Bacteria 2168
157 Ga0496108_0034345 3300048911 Bacteria 4214
158 Ga0496111_0236266 3300048914 Bacteria 1357
159 Ga0496114_0064996 3300048917 Bacteria 3056
160 Ga0496126_0001218 3300048929 Bacteria 41841
161 Ga0496126_0035813 3300048929 Bacteria 4646
162 Ga0495678_000543 3300049459 Bacteria 36375
163 Ga0495682_0034116 3300049460 Bacteria 1877
164 Ga0500618_014190 3300053125 Bacteria 2041
165 Ga0500586_004514 3300053145 Bacteria 3420
166 Ga0500586_034910 3300053145 Bacteria 1679

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046506 Ga0495583_0000587 Ga0495583_0000587_31654_32199 179
2 3300046524 Ga0495648_0079800 Ga0495648_0079800_960_1505 179
3 3300046538 Ga0495609_0000320 Ga0495609_0000320_39790_40335 179
4 3300046692 Ga0495671_0051009 Ga0495671_0051009_1225_1770 179
5 3300003374 JGI25161J50226_1000423 JGI25161J50226_100042318 194
6 3300004625 Ga0055543_1000303 Ga0055543_10003037 194
7 3300025208 Ga0209436_100341 Ga0209436_1003419 194
8 3300025284 Ga0209130_1000171 Ga0209130_100017144 194
9 3300048091 Ga0495626_0025791 Ga0495626_0025791_2052_2738 204
10 3300003323 rootH1_10294028 rootH1_102940283 205
11 3300003791 Ga0055530_10000193 Ga0055530_1000019336 205
12 3300046460 Ga0495638_0043956 Ga0495638_0043956_1324_2010 205
13 3300046474 Ga0495605_0180130 Ga0495605_0180130_156_842 205
14 3300046500 Ga0495596_0025333 Ga0495596_0025333_1328_2014 205
15 3300046501 Ga0495607_0009903 Ga0495607_0009903_2354_3040 205
16 3300046507 Ga0495606_0019659 Ga0495606_0019659_342_1028 205
17 3300046513 Ga0495616_0022586 Ga0495616_0022586_1166_1852 205
18 3300046519 Ga0495632_0078811 Ga0495632_0078811_344_1030 205
19 3300046522 Ga0495643_0036838 Ga0495643_0036838_1972_2658 205
20 3300046523 Ga0495644_0017601 Ga0495644_0017601_447_1133 205
21 3300046528 Ga0495642_0040356 Ga0495642_0040356_326_1012 205
22 3300046531 Ga0495665_0060168 Ga0495665_0060168_1167_1853 205
23 3300046538 Ga0495609_0018450 Ga0495609_0018450_70_756 205
24 3300046542 Ga0495597_0022463 Ga0495597_0022463_1140_1826 205
25 3300046660 Ga0495625_0060343 Ga0495625_0060343_1883_2569 205
26 3300046692 Ga0495671_0153700 Ga0495671_0153700_360_1046 205
27 3300046794 Ga0495589_0079513 Ga0495589_0079513_400_1086 205
28 3300047470 Ga0495681_0178981 Ga0495681_0178981_89_775 205
29 3300048091 Ga0495626_0152242 Ga0495626_0152242_216_902 205
30 3300049460 Ga0495682_0034116 Ga0495682_0034116_920_1606 205
31 iso_pu_bacteria 2643221645 2644254511 205
32 iso_pu_bacteria 2765235838 2765570436 206
33 3300031548 Ga0307408_100065612 Ga0307408_1000656122 207
34 3300037466 Ga0395898_0000745 Ga0395898_0000745_4087_4725 207
35 3300046660 Ga0495625_0000298 Ga0495625_0000298_71729_72361 207
36 3300031548 Ga0307408_100002472 Ga0307408_10000247214 208
37 3300042139 Ga0450904_000849 Ga0450904_000849_2303_2998 208
38 3300046512 Ga0495610_0004459 Ga0495610_0004459_6835_7497 208
39 iso_pu_bacteria 2904439833 2904443520 208
40 iso_pu_bacteria 2857558681 2857562015 209
41 3300002739 JGI25158J39367_1000677 JGI25158J39367_10006773 210
42 3300002987 JGI25159J45721_1000395 JGI25159J45721_100039517 210
43 3300005262 Ga0065165_1001491 Ga0065165_10014915 210
44 3300046460 Ga0495638_0040942 Ga0495638_0040942_340_1041 212
45 3300003775 Ga0055524_1012697 Ga0055524_10126972 213
46 3300021361 Ga0213872_10000257 Ga0213872_100002571 213
47 3300039447 Ga0436361_0125110 Ga0436361_0125110_54811_55470 213
48 3300046460 Ga0495638_0338138 Ga0495638_0338138_23_703 213
49 3300046499 Ga0495594_0275190 Ga0495594_0275190_187_858 213
50 3300046507 Ga0495606_0031760 Ga0495606_0031760_2729_3400 213
51 3300046517 Ga0495630_0658340 Ga0495630_0658340_47_718 213
52 3300046530 Ga0495654_0162408 Ga0495654_0162408_74_748 213
53 3300046531 Ga0495665_0066840 Ga0495665_0066840_972_1643 213
54 3300046538 Ga0495609_0000292 Ga0495609_0000292_1074_1748 213
55 3300046538 Ga0495609_0146359 Ga0495609_0146359_55_726 213
56 3300046660 Ga0495625_0192953 Ga0495625_0192953_252_920 213
57 3300046692 Ga0495671_0042940 Ga0495671_0042940_259_927 213
58 3300046810 Ga0495660_0007830 Ga0495660_0007830_5534_6202 213
59 3300047317 Ga0495604_0037015 Ga0495604_0037015_3104_3775 213
60 3300047469 Ga0495673_0000003 Ga0495673_0000003_370371_371039 213
61 3300047469 Ga0495673_0000026 Ga0495673_0000026_418075_418743 213
62 3300053145 Ga0500586_034910 Ga0500586_034910_591_1259 213
63 3300031711 Ga0265314_10024503 Ga0265314_100245033 215
64 3300045049 Ga0466959_0065873 Ga0466959_0065873_1069_1752 215
65 3300046471 Ga0495650_0000195 Ga0495650_0000195_113341_114003 215
66 3300046506 Ga0495583_0000548 Ga0495583_0000548_18044_18706 215
67 3300046507 Ga0495606_0000330 Ga0495606_0000330_26143_26805 215
68 3300046507 Ga0495606_0001239 Ga0495606_0001239_14140_14802 215
69 3300046520 Ga0495637_0004268 Ga0495637_0004268_5618_6319 215
70 3300046528 Ga0495642_0022782 Ga0495642_0022782_1393_2055 215
71 3300046542 Ga0495597_0000228 Ga0495597_0000228_42012_42674 215
72 3300046557 Ga0495622_0000004 Ga0495622_0000004_142161_142823 215
73 3300046692 Ga0495671_0000001 Ga0495671_0000001_770144_770806 215
74 iso_pu_bacteria 2857564685 2857567127 216
75 3300044656 Ga0466969_0005260 Ga0466969_0005260_3683_4372 217
76 3300044684 Ga0466966_0078659 Ga0466966_0078659_571_1260 217
77 3300044693 Ga0466961_0001005 Ga0466961_0001005_7486_8175 217
78 3300046524 Ga0495648_0000140 Ga0495648_0000140_25628_26290 217
79 iso_pu_bacteria 2998344455 2998346543 217
80 3300003322 rootL2_10048739 rootL2_1004873919 218
81 iso_pu_bacteria 2821131069 2821134467 218
82 3300037418 Ga0395900_0201584 Ga0395900_0201584_752_1432 219
83 3300037471 Ga0395905_0007676 Ga0395905_0007676_9502_10182 219
84 3300037471 Ga0395905_0132759 Ga0395905_0132759_691_1371 219
85 3300038443 Ga0395901_0170762 Ga0395901_0170762_1089_1769 219
86 3300038443 Ga0395901_1178297 Ga0395901_1178297_36_716 219
87 3300046460 Ga0495638_0097203 Ga0495638_0097203_464_1147 219
88 3300046472 Ga0495580_0008709 Ga0495580_0008709_467_1138 219
89 3300046506 Ga0495583_0001625 Ga0495583_0001625_1726_2409 219
90 3300046513 Ga0495616_0000095 Ga0495616_0000095_19414_20097 219
91 3300046513 Ga0495616_0145258 Ga0495616_0145258_178_861 219
92 3300046520 Ga0495637_0146136 Ga0495637_0146136_199_882 219
93 3300046522 Ga0495643_0000127 Ga0495643_0000127_98201_98884 219
94 3300046522 Ga0495643_0005950 Ga0495643_0005950_399_1079 219
95 3300046526 Ga0495666_0002421 Ga0495666_0002421_459_1130 219
96 3300046528 Ga0495642_0134761 Ga0495642_0134761_331_1011 219
97 3300046542 Ga0495597_0002785 Ga0495597_0002785_97_774 219
98 3300046542 Ga0495597_0021462 Ga0495597_0021462_299_982 219
99 3300046665 Ga0495661_0003042 Ga0495661_0003042_228_908 219
100 3300046665 Ga0495661_0024061 Ga0495661_0024061_581_1264 219
101 3300046691 Ga0495670_0016543 Ga0495670_0016543_1072_1755 219
102 3300047443 Ga0495687_030026 Ga0495687_030026_14_694 219
103 3300048091 Ga0495626_0001382 Ga0495626_0001382_7740_8423 219
104 3300048091 Ga0495626_0109200 Ga0495626_0109200_86_769 219
105 3300006948 Ga0099826_10000002 Ga0099826_10000002822 220
106 3300027666 Ga0209282_1000001 Ga0209282_1000001338 220
107 3300046475 Ga0495639_0220132 Ga0495639_0220132_142_834 220
108 3300048090 Ga0495615_0056306 Ga0495615_0056306_56_748 220
109 3300048905 Ga0496102_0042593 Ga0496102_0042593_746_1438 220
110 3300048908 Ga0496105_0120104 Ga0496105_0120104_1317_2009 220
111 3300048911 Ga0496108_0034345 Ga0496108_0034345_3448_4140 220
112 3300048914 Ga0496111_0236266 Ga0496111_0236266_160_852 220
113 3300048917 Ga0496114_0064996 Ga0496114_0064996_482_1174 220
114 iso_pu_bacteria 2842711865 2842716195 220
115 3300002773 JGI25152J39213_1022319 JGI25152J39213_10223191 221
116 3300003771 Ga0055526_1003995 Ga0055526_10039957 221
117 3300003771 Ga0055526_1012070 Ga0055526_10120704 221
118 3300003794 Ga0055531_10015739 Ga0055531_100157393 221
119 3300021361 Ga0213872_10063559 Ga0213872_100635593 221
120 3300031548 Ga0307408_100003910 Ga0307408_1000039104 221
121 3300039447 Ga0436361_1199241 Ga0436361_1199241_1571_2308 221
122 3300047472 Ga0495686_0001510 Ga0495686_0001510_17389_18081 221
123 3300003322 rootL2_10034274 rootL2_100342745 222
124 3300046452 Ga0495617_018924 Ga0495617_018924_707_1384 223
125 3300047443 Ga0495687_003055 Ga0495687_003055_11645_12322 223
126 3300049459 Ga0495678_000543 Ga0495678_000543_33906_34631 223
127 3300053125 Ga0500618_014190 Ga0500618_014190_560_1258 223
128 iso_pu_bacteria 2842711865 2842716111 223
129 3300002739 JGI25158J39367_1000007 JGI25158J39367_100000757 224
130 3300002987 JGI25159J45721_1000164 JGI25159J45721_10001646 224
131 3300003320 rootH2_10336503 rootH2_103365031 224
132 3300003322 rootL2_10140043 rootL2_101400432 224
133 3300003354 JGI25160J50197_1000132 JGI25160J50197_10001326 224
134 3300003374 JGI25161J50226_1000105 JGI25161J50226_10001056 224
135 3300003771 Ga0055526_1000064 Ga0055526_100006443 224
136 3300003771 Ga0055526_1000133 Ga0055526_10001335 224
137 3300003773 Ga0055537_1000093 Ga0055537_10000935 224
138 3300003775 Ga0055524_1000192 Ga0055524_10001926 224
139 3300003784 Ga0055534_1000098 Ga0055534_10000986 224
140 3300004625 Ga0055543_1000101 Ga0055543_10001016 224
141 3300005262 Ga0065165_1000282 Ga0065165_1000282101 224
142 3300009036 Ga0105244_10004778 Ga0105244_100047784 224
143 3300025208 Ga0209436_100028 Ga0209436_1000287 224
144 3300025263 Ga0209565_1000157 Ga0209565_100015711 224
145 3300025273 Ga0209673_1054292 Ga0209673_10542922 224
146 3300025284 Ga0209130_1000189 Ga0209130_10001897 224
147 3300025291 Ga0209675_1000158 Ga0209675_10001588 224
148 3300025295 Ga0209564_1000007 Ga0209564_1000007532 224
149 3300025295 Ga0209564_1000342 Ga0209564_10003429 224
150 3300025299 Ga0209256_1000214 Ga0209256_100021423 224
151 3300025302 Ga0207426_1000343 Ga0207426_10003437 224
152 3300025728 Ga0207655_1003881 Ga0207655_10038814 224
153 3300046452 Ga0495617_000018 Ga0495617_000018_172986_173687 224
154 3300046460 Ga0495638_0103748 Ga0495638_0103748_313_1014 224
155 3300046471 Ga0495650_0000701 Ga0495650_0000701_19094_19852 224
156 3300046507 Ga0495606_0000291 Ga0495606_0000291_11442_12176 224
157 3300046512 Ga0495610_0000008 Ga0495610_0000008_302302_303003 224
158 3300046512 Ga0495610_0000401 Ga0495610_0000401_39902_40603 224
159 3300046512 Ga0495610_0000877 Ga0495610_0000877_18979_19680 224
160 3300046512 Ga0495610_0002787 Ga0495610_0002787_3120_3821 224
161 3300046512 Ga0495610_0011789 Ga0495610_0011789_15_770 224
162 3300046512 Ga0495610_0130745 Ga0495610_0130745_349_1050 224
163 3300046557 Ga0495622_0000831 Ga0495622_0000831_7269_7964 224
164 3300046558 Ga0495633_0002889 Ga0495633_0002889_6513_7214 224
165 3300046558 Ga0495633_0055728 Ga0495633_0055728_642_1397 224
166 3300046616 Ga0495668_0000027 Ga0495668_0000027_179140_179841 224
167 3300046660 Ga0495625_0009305 Ga0495625_0009305_97_798 224
168 3300046692 Ga0495671_0001707 Ga0495671_0001707_1575_2333 224
169 3300046694 Ga0495649_0001067 Ga0495649_0001067_19000_19704 224
170 3300046694 Ga0495649_0042372 Ga0495649_0042372_1499_2212 224
171 3300047446 Ga0495679_000135 Ga0495679_000135_275_1033 224
172 3300047446 Ga0495679_022061 Ga0495679_022061_1188_1946 224
173 3300048929 Ga0496126_0001218 Ga0496126_0001218_30405_31106 224
174 3300048929 Ga0496126_0035813 Ga0496126_0035813_2557_3258 224
175 3300053145 Ga0500586_004514 Ga0500586_004514_524_1282 224

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02586

SRAP

SOS response associated peptidase (SRAP)

44

231

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
1zn6-assembly1.cif.gz_A x-ray crystal structure of protein q7wlm8 from bordetella bronchiseptica. northeast structural genomics consortium target bor19. 0.8818 2 210
1zn6-assembly1.cif.gz_A x-ray crystal structure of protein q7wlm8 from bordetella bronchiseptica. northeast structural genomics consortium target bor19. 0.8698 2 210
6kbz-assembly4.cif.gz_H crystal structure of yedk with ssdna containing a tetrahydrofuran abasic site 0.7987 1 207
8d2m-assembly2.cif.gz_B covalent schiff base complex of yedk c2a and abasic dna 0.792 1 205
6kbz-assembly2.cif.gz_D crystal structure of yedk with ssdna containing a tetrahydrofuran abasic site 0.7801 2 207
ID Description Score Start End Superfamily
1zn6A00 Alpha Beta;Alpha-Beta Complex;hypothetical protein yedk fold;SOS response associated peptidase-like 0.8753 2 210 3.90.1680.10
1zn6A00 Alpha Beta;Alpha-Beta Complex;hypothetical protein yedk fold;SOS response associated peptidase-like 0.8712 2 210 3.90.1680.10
af_O05872_1_242_3.90.1680.10 Alpha Beta;Alpha-Beta Complex;hypothetical protein yedk fold;SOS response associated peptidase-like 0.8272 1 210 3.90.1680.10
af_I1KYZ5_1_237_3.90.1680.10 Alpha Beta;Alpha-Beta Complex;hypothetical protein yedk fold;SOS response associated peptidase-like 0.7825 1 207 3.90.1680.10
af_O05872_1_242_3.90.1680.10 Alpha Beta;Alpha-Beta Complex;hypothetical protein yedk fold;SOS response associated peptidase-like 0.776 1 210 3.90.1680.10
ID Description Score Start End GO Terms
AF-A0A3S4JXN6-F1-model_v4 Abasic site processing protein (EC 3.4.-.-) 0.9836 73 207 GO:0003697
GO:0006508
GO:0008233
GO:0016829
GO:0106300
AF-A0A6M4A948-F1-model_v4 Abasic site processing protein (EC 3.4.-.-) 0.981 73 215 GO:0003697
GO:0006508
GO:0008233
GO:0016829
GO:0106300
AF-A0A6S7BBJ2-F1-model_v4 Abasic site processing protein (EC 3.4.-.-) 0.977 58 156 GO:0003697
GO:0006508
GO:0008233
GO:0016829
GO:0106300
AF-A0A808X1L3-F1-model_v4 deleted 0.9752 1 207
AF-A0A4Q3G0Q1-F1-model_v4 Abasic site processing protein (EC 3.4.-.-) 0.9751 1 204 GO:0003697
GO:0006508
GO:0008233
GO:0016829
GO:0106300

Feature Viewer

pLDDT pTM Quality
92.12 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map