F266941
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 175 | 130 | 152 | 395 |
Family's Representative Sequence
| Representative Sequence | 3300046522|Ga0495643_0001059|Ga0495643_0001059_9551_10852 |
| Length | 433 |
| Sequence | MSFDAFGRILFRYRFQNAETENLRLRRLAYSLLMTSLLHLPNLPLSKLAPVAPDPLLSLTSLFAKDTRDRKIDLGVGVYRNSHGVTPVFAAIKEAEQRLAACQPTKAYLGPDGNAAFVEVLSDVALGLDRPVRGLQTLGGTGALFLACVLLASEGTGPTIWLQTPTWSNHLPIFLSAGLAFRTVDSGASEGAGTAQFLAALEQANAGDAVLLQACCHNPTGVDFSSEDWAAVAALCGRKGLTPLVDIAYQGFGDGWDEDMIGLRTLAAAVPELLIAYSCDKNFGLYRERVGALFVAAETTAAMEAAHGHLMAHARGTYSMPADHGAAAVLAVLQDHRLTADWRAELENMRQRVTSVRSALARAGCIGACDLGRLEREHGMFSLLPLGPDTILQLRSRFGIYMAPSGRINLAGLRENDIAYFVDALQDVQEAFA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2510917021 | Novosphingobium sp. AP12 | Isolate | Rhizosphere |
| 3 | 2523231067 | Pleomorphomonas oryzae DSM 16300 | Isolate | Unclassified |
| 4 | 2524023250 | Niveispirillum irakense DSM 11586 | Isolate | Unclassified |
| 5 | 2643221541 | Sphingomonas sp. Root50 | Isolate | Unclassified |
| 6 | 2643221588 | Altererythrobacter sp. Root672 | Isolate | Unclassified |
| 7 | 2643221605 | Sphingomonas sp. Root710 | Isolate | Unclassified |
| 8 | 2643221606 | Sphingomonas sp. Root720 | Isolate | Unclassified |
| 9 | 2643221671 | Sphingomonas sp. Root1294 | Isolate | Unclassified |
| 10 | 2738543031 | Pleomorphomonas sp. CF100 | Isolate | Unclassified |
| 11 | 2739367664 | Novosphingobium sp. GV002 | Isolate | Unclassified |
| 12 | 2739367865 | Novosphingobium sp. GV013 | Isolate | Unclassified |
| 13 | 2841760612 | Bosea sp. Tri-49 | Isolate | Nodule |
| 14 | 2844104063 | Bosea sp. Tri-39 | Isolate | Nodule |
| 15 | 2851182111 | Bosea sp. Tri-44 | Isolate | Nodule |
| 16 | 2851246043 | Bosea sp. Tri-54 | Isolate | Nodule |
| 17 | 2896253425 | Aurantiacibacter rhizosphaerae GH3-10 | Isolate | Rhizosphere |
| 18 | 2928027323 | Sphingomonas sp. 1185 | Isolate | Unclassified |
| 19 | 2941485952 | Brevundimonas faecalis 2814 | Isolate | Rhizosphere |
| 20 | 2984555340 | Sphingomonas sp. SORGH_AS789 | Isolate | Aerial Root |
| 21 | 2984564862 | Sphingomonas sp. SORGH_AS870 | Isolate | Aerial Root |
| 22 | 2993356040 | Sphingomonas sp. SORGH_AS742 | Isolate | Aerial Root |
| 23 | 3000865235 | Altericroceibacterium indicum DSM 18604 | Isolate | Rhizosphere |
| 24 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 25 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 26 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 27 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 28 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 29 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 30 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 31 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 38 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 39 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 41 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 42 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 43 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 44 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 45 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 46 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 47 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 48 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 61 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 62 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 63 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 64 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 81 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 82 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 83 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 84 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 85 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 86 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 87 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 88 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 89 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 90 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 91 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 92 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 93 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 94 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 95 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 96 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 97 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 98 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 99 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 100 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 101 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 102 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 103 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 104 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 105 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 106 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 107 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 108 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 109 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 110 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 111 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 112 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 113 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 114 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 115 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 116 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 117 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 118 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 119 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 120 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 121 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 122 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 123 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 124 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 125 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 126 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 127 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 128 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 129 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 130 | 8057529695 | Bosea vestrisii A18/4-2 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 86.86 |
| Metatranscriptomes | 0 |
| Isolates | 13.14 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 1.71 |
| Bulb | 0 |
| Endosphere | 15.43 |
| Nodule | 2.86 |
| Rhizoplane | 0 |
| Rhizosphere | 66.86 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 13.14 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_307682 | 2162886007 | Bacteria | 29333 |
| 2 | JGI24740J21852_10010958 | 3300001979 | Bacteria | 3467 |
| 3 | JGI24740J21852_10012291 | 3300001979 | Bacteria | 3231 |
| 4 | JGI24740J21852_10026037 | 3300001979 | Bacteria | 1964 |
| 5 | JGI24739J22299_10021476 | 3300001989 | Bacteria | 2297 |
| 6 | JGI24739J22299_10024392 | 3300001989 | Bacteria | 2132 |
| 7 | JGI24738J21930_10002928 | 3300002075 | Bacteria | 4366 |
| 8 | Ga0055536_1003474 | 3300003781 | Bacteria | 8444 |
| 9 | Ga0065165_1000048 | 3300005262 | Bacteria | 196539 |
| 10 | Ga0065704_10000192 | 3300005289 | Bacteria | 216848 |
| 11 | Ga0065707_10102494 | 3300005295 | Bacteria | 2802 |
| 12 | Ga0070682_100147394 | 3300005337 | Bacteria | 1611 |
| 13 | Ga0070660_100006385 | 3300005339 | Bacteria | 8170 |
| 14 | Ga0070668_100159581 | 3300005347 | Bacteria | 1829 |
| 15 | Ga0070659_100000984 | 3300005366 | Bacteria | 20941 |
| 16 | Ga0070659_100042925 | 3300005366 | Bacteria | 3536 |
| 17 | Ga0070663_100027332 | 3300005455 | Bacteria | 3874 |
| 18 | Ga0070663_100033166 | 3300005455 | Bacteria | 3565 |
| 19 | Ga0070684_100029220 | 3300005535 | Bacteria | 4670 |
| 20 | Ga0068853_100081794 | 3300005539 | Bacteria | 2828 |
| 21 | Ga0068853_100081796 | 3300005539 | Bacteria | 2828 |
| 22 | Ga0068855_100044333 | 3300005563 | Bacteria | 5264 |
| 23 | Ga0068855_100327200 | 3300005563 | Bacteria | 1692 |
| 24 | Ga0068855_100388020 | 3300005563 | Bacteria | 1532 |
| 25 | Ga0070664_100065760 | 3300005564 | Bacteria | 3095 |
| 26 | Ga0068857_100033127 | 3300005577 | Bacteria | 4569 |
| 27 | Ga0068857_100084500 | 3300005577 | Bacteria | 2836 |
| 28 | Ga0068854_100001796 | 3300005578 | Bacteria | 13078 |
| 29 | Ga0068854_100023306 | 3300005578 | Bacteria | 4227 |
| 30 | Ga0068854_100047933 | 3300005578 | Bacteria | 3046 |
| 31 | Ga0068856_100016897 | 3300005614 | Bacteria | 7072 |
| 32 | Ga0068856_100024629 | 3300005614 | Bacteria | 5859 |
| 33 | Ga0068856_100219500 | 3300005614 | Bacteria | 1917 |
| 34 | Ga0068852_100013467 | 3300005616 | Bacteria | 6262 |
| 35 | Ga0068852_100014776 | 3300005616 | Bacteria | 6028 |
| 36 | Ga0068852_100332597 | 3300005616 | Bacteria | 1478 |
| 37 | Ga0068851_10023398 | 3300005834 | Bacteria | 3020 |
| 38 | Ga0075432_10003304 | 3300006058 | Bacteria | 5450 |
| 39 | Ga0075366_10086175 | 3300006195 | Bacteria | 1879 |
| 40 | Ga0075370_10062516 | 3300006353 | Bacteria | 2122 |
| 41 | Ga0105240_10108062 | 3300009093 | Bacteria | 3371 |
| 42 | Ga0105240_10132634 | 3300009093 | Bacteria | 2986 |
| 43 | Ga0105240_10262886 | 3300009093 | Bacteria | 1990 |
| 44 | Ga0105243_10000150 | 3300009148 | Bacteria | 79825 |
| 45 | Ga0105241_10009912 | 3300009174 | Bacteria | 7001 |
| 46 | Ga0105241_10038101 | 3300009174 | Bacteria | 3625 |
| 47 | Ga0105237_10019521 | 3300009545 | Bacteria | 7001 |
| 48 | Ga0105237_10094080 | 3300009545 | Bacteria | 2986 |
| 49 | Ga0105238_10101822 | 3300009551 | Bacteria | 2854 |
| 50 | Ga0105238_10108615 | 3300009551 | Bacteria | 2755 |
| 51 | Ga0105239_10024092 | 3300010375 | Bacteria | 6703 |
| 52 | Ga0105239_10165400 | 3300010375 | Bacteria | 2473 |
| 53 | Ga0157373_10029122 | 3300013100 | Bacteria | 3980 |
| 54 | Ga0157370_10087385 | 3300013104 | Bacteria | 2928 |
| 55 | Ga0157369_10002565 | 3300013105 | Bacteria | 21747 |
| 56 | Ga0163162_10116845 | 3300013306 | Bacteria | 2768 |
| 57 | Ga0157372_10024345 | 3300013307 | Bacteria | 6575 |
| 58 | Ga0163161_10138803 | 3300017792 | Bacteria | 1839 |
| 59 | Ga0209026_1001756 | 3300025250 | Bacteria | 8978 |
| 60 | Ga0209130_1000071 | 3300025284 | Bacteria | 178273 |
| 61 | Ga0209025_1002646 | 3300025294 | Bacteria | 18319 |
| 62 | Ga0207426_1022695 | 3300025302 | Bacteria | 2150 |
| 63 | Ga0207697_10038312 | 3300025315 | Bacteria | 1965 |
| 64 | Ga0207654_10000442 | 3300025911 | Bacteria | 23622 |
| 65 | Ga0207654_10004226 | 3300025911 | Bacteria | 7246 |
| 66 | Ga0207695_10003338 | 3300025913 | Bacteria | 22726 |
| 67 | Ga0207695_10008582 | 3300025913 | Bacteria | 12767 |
| 68 | Ga0207695_10105281 | 3300025913 | Bacteria | 2809 |
| 69 | Ga0207671_10012484 | 3300025914 | Bacteria | 6825 |
| 70 | Ga0207671_10083117 | 3300025914 | Bacteria | 2404 |
| 71 | Ga0207657_10002610 | 3300025919 | Bacteria | 19473 |
| 72 | Ga0207657_10051490 | 3300025919 | Bacteria | 3579 |
| 73 | Ga0207694_10010416 | 3300025924 | Bacteria | 7009 |
| 74 | Ga0207694_10041867 | 3300025924 | Bacteria | 3531 |
| 75 | Ga0207690_10000052 | 3300025932 | Bacteria | 106112 |
| 76 | Ga0207690_10034237 | 3300025932 | Bacteria | 3272 |
| 77 | Ga0207706_10011533 | 3300025933 | Bacteria | 8049 |
| 78 | Ga0207706_10086547 | 3300025933 | Bacteria | 2755 |
| 79 | Ga0207709_10000005 | 3300025935 | Bacteria | 806813 |
| 80 | Ga0207667_10007044 | 3300025949 | Bacteria | 13585 |
| 81 | Ga0207640_10001866 | 3300025981 | Bacteria | 11302 |
| 82 | Ga0207640_10066222 | 3300025981 | Bacteria | 2413 |
| 83 | Ga0207639_10241673 | 3300026041 | Bacteria | 1570 |
| 84 | Ga0207678_10003212 | 3300026067 | Bacteria | 14773 |
| 85 | Ga0207678_10036933 | 3300026067 | Bacteria | 4253 |
| 86 | Ga0207702_10002001 | 3300026078 | Bacteria | 19755 |
| 87 | Ga0207702_10002550 | 3300026078 | Bacteria | 17144 |
| 88 | Ga0207702_10020399 | 3300026078 | Bacteria | 5490 |
| 89 | Ga0207674_10033943 | 3300026116 | Bacteria | 5337 |
| 90 | Ga0207674_10056824 | 3300026116 | Bacteria | 3971 |
| 91 | Ga0207698_10002024 | 3300026142 | Bacteria | 11965 |
| 92 | Ga0207698_10059475 | 3300026142 | Bacteria | 2968 |
| 93 | Ga0207698_10080245 | 3300026142 | Bacteria | 2627 |
| 94 | Ga0307410_10174351 | 3300031852 | Bacteria | 1623 |
| 95 | Ga0307414_10093161 | 3300032004 | Bacteria | 2245 |
| 96 | Ga0316583_10026492 | 3300032133 | Bacteria | 2069 |
| 97 | Ga0307510_10008895 | 3300033180 | Bacteria | 11965 |
| 98 | Ga0436360_0666790 | 3300039438 | Bacteria | 7062 |
| 99 | Ga0436361_0868236 | 3300039447 | Bacteria | 3273 |
| 100 | Ga0436362_0208270 | 3300039453 | Bacteria | 1683 |
| 101 | Ga0495638_0019466 | 3300046460 | Bacteria | 4491 |
| 102 | Ga0495650_0000093 | 3300046471 | Bacteria | 221558 |
| 103 | Ga0495583_0000474 | 3300046506 | Bacteria | 58751 |
| 104 | Ga0495583_0022510 | 3300046506 | Bacteria | 3213 |
| 105 | Ga0495610_0000018 | 3300046512 | Bacteria | 355044 |
| 106 | Ga0495631_0028242 | 3300046518 | Bacteria | 2560 |
| 107 | Ga0495643_0001059 | 3300046522 | Bacteria | 27569 |
| 108 | Ga0495643_0064340 | 3300046522 | Bacteria | 1938 |
| 109 | Ga0495654_0065712 | 3300046530 | Bacteria | 1730 |
| 110 | Ga0495609_0014894 | 3300046538 | Bacteria | 3648 |
| 111 | Ga0495661_0009545 | 3300046665 | Bacteria | 6655 |
| 112 | Ga0495677_0003401 | 3300047445 | Bacteria | 6184 |
| 113 | Ga0495686_0000260 | 3300047472 | Bacteria | 94551 |
| 114 | Ga0495686_0093502 | 3300047472 | Bacteria | 1823 |
| 115 | Ga0495615_0000007 | 3300048090 | Bacteria | 90892 |
| 116 | Ga0496116_0000011 | 3300048919 | Bacteria | 646953 |
| 117 | Ga0496117_0163512 | 3300048920 | Bacteria | 1301 |
| 118 | Ga0496118_0049459 | 3300048921 | Bacteria | 3237 |
| 119 | Ga0496121_0000620 | 3300048924 | Bacteria | 66051 |
| 120 | Ga0496121_0015865 | 3300048924 | Bacteria | 7832 |
| 121 | Ga0496122_0001060 | 3300048925 | Bacteria | 47797 |
| 122 | Ga0496123_0003719 | 3300048926 | Bacteria | 16783 |
| 123 | Ga0496124_0005101 | 3300048927 | Bacteria | 14955 |
| 124 | Ga0496124_0006074 | 3300048927 | Bacteria | 13283 |
| 125 | Ga0496126_0077324 | 3300048929 | Bacteria | 2950 |
| 126 | Ga0501032_0022626 | 3300049569 | Bacteria | 4356 |
| 127 | Ga0501043_0017383 | 3300049579 | Bacteria | 5639 |
| 128 | Ga0501046_0043067 | 3300049580 | Bacteria | 3596 |
| 129 | Ga0501047_0000070 | 3300049581 | Bacteria | 127146 |
| 130 | Ga0501047_0130580 | 3300049581 | Bacteria | 2393 |
| 131 | Ga0501035_0179465 | 3300049822 | Bacteria | 1825 |
| 132 | Ga0501044_0001276 | 3300049823 | Bacteria | 29754 |
| 133 | nmdc:mga0k408_66577_c1 | 3300050493 | Bacteria | 2098 |
| 134 | nmdc:mga07m45_76729_c1 | 3300050496 | Bacteria | 1905 |
| 135 | nmdc:mga0sz30_15812_c1 | 3300050516 | Bacteria | 2986 |
| 136 | Ga0500643_000386 | 3300053087 | Bacteria | 34137 |
| 137 | Ga0500643_002276 | 3300053087 | Bacteria | 10073 |
| 138 | Ga0500555_000477 | 3300053103 | Bacteria | 16617 |
| 139 | Ga0500592_000010 | 3300053116 | Bacteria | 76714 |
| 140 | Ga0500607_000305 | 3300053121 | Bacteria | 46428 |
| 141 | Ga0500608_000458 | 3300053122 | Bacteria | 15296 |
| 142 | Ga0500618_019117 | 3300053125 | Bacteria | 1688 |
| 143 | Ga0500559_0000007 | 3300053136 | Bacteria | 226236 |
| 144 | Ga0500559_0001810 | 3300053136 | Bacteria | 11688 |
| 145 | Ga0500573_0000082 | 3300053140 | Bacteria | 45547 |
| 146 | Ga0500622_0002604 | 3300053156 | Bacteria | 12850 |
| 147 | Ga0500624_000018 | 3300053157 | Bacteria | 131677 |
| 148 | Ga0500624_000205 | 3300053157 | Bacteria | 22830 |
| 149 | Ga0500627_0000036 | 3300053158 | Bacteria | 79400 |
| 150 | Ga0500636_0009686 | 3300053177 | Bacteria | 5608 |
| 151 | Ga0500637_0003517 | 3300053178 | Bacteria | 7255 |
| 152 | Ga0500645_005578 | 3300053730 | Bacteria | 4608 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300050496 | nmdc:mga07m45_76729_c1 | nmdc:mga07m45_76729_c1_854_1894 | 341 |
| 2 | 3300046522 | Ga0495643_0064340 | Ga0495643_0064340_306_1535 | 349 |
| 3 | 3300017792 | Ga0163161_10138803 | Ga0163161_101388031 | 366 |
| 4 | 3300053136 | Ga0500559_0000007 | Ga0500559_0000007_53641_54822 | 367 |
| 5 | 3300032004 | Ga0307414_10093161 | Ga0307414_100931612 | 368 |
| 6 | 3300001979 | JGI24740J21852_10010958 | JGI24740J21852_100109583 | 372 |
| 7 | 3300005337 | Ga0070682_100147394 | Ga0070682_1001473941 | 372 |
| 8 | 3300005455 | Ga0070663_100033166 | Ga0070663_1000331663 | 372 |
| 9 | 3300005535 | Ga0070684_100029220 | Ga0070684_1000292206 | 372 |
| 10 | 3300005539 | Ga0068853_100081796 | Ga0068853_1000817962 | 372 |
| 11 | 3300005563 | Ga0068855_100327200 | Ga0068855_1003272002 | 372 |
| 12 | 3300005564 | Ga0070664_100065760 | Ga0070664_1000657602 | 372 |
| 13 | 3300005577 | Ga0068857_100084500 | Ga0068857_1000845002 | 372 |
| 14 | 3300005578 | Ga0068854_100023306 | Ga0068854_1000233064 | 372 |
| 15 | 3300005614 | Ga0068856_100219500 | Ga0068856_1002195002 | 372 |
| 16 | 3300005616 | Ga0068852_100332597 | Ga0068852_1003325971 | 372 |
| 17 | 3300005834 | Ga0068851_10023398 | Ga0068851_100233982 | 372 |
| 18 | 3300009093 | Ga0105240_10132634 | Ga0105240_101326342 | 372 |
| 19 | 3300009174 | Ga0105241_10038101 | Ga0105241_100381012 | 372 |
| 20 | 3300009545 | Ga0105237_10094080 | Ga0105237_100940802 | 372 |
| 21 | 3300009551 | Ga0105238_10101822 | Ga0105238_101018222 | 372 |
| 22 | 3300010375 | Ga0105239_10165400 | Ga0105239_101654002 | 372 |
| 23 | 3300013100 | Ga0157373_10029122 | Ga0157373_100291225 | 372 |
| 24 | 3300013104 | Ga0157370_10087385 | Ga0157370_100873852 | 372 |
| 25 | 3300013105 | Ga0157369_10002565 | Ga0157369_1000256510 | 372 |
| 26 | 3300013307 | Ga0157372_10024345 | Ga0157372_100243452 | 372 |
| 27 | 3300025911 | Ga0207654_10000442 | Ga0207654_1000044211 | 372 |
| 28 | 3300025913 | Ga0207695_10003338 | Ga0207695_1000333813 | 372 |
| 29 | 3300025914 | Ga0207671_10083117 | Ga0207671_100831172 | 372 |
| 30 | 3300025924 | Ga0207694_10010416 | Ga0207694_100104166 | 372 |
| 31 | 3300025933 | Ga0207706_10086547 | Ga0207706_100865472 | 372 |
| 32 | 3300025981 | Ga0207640_10066222 | Ga0207640_100662222 | 372 |
| 33 | 3300026067 | Ga0207678_10003212 | Ga0207678_1000321213 | 372 |
| 34 | 3300026078 | Ga0207702_10002550 | Ga0207702_100025506 | 372 |
| 35 | 3300026116 | Ga0207674_10056824 | Ga0207674_100568243 | 372 |
| 36 | 3300026142 | Ga0207698_10059475 | Ga0207698_100594752 | 372 |
| 37 | 3300046518 | Ga0495631_0028242 | Ga0495631_0028242_1360_2499 | 374 |
| 38 | 3300050493 | nmdc:mga0k408_66577_c1 | nmdc:mga0k408_66577_c1_928_2067 | 374 |
| 39 | 3300050516 | nmdc:mga0sz30_15812_c1 | nmdc:mga0sz30_15812_c1_962_2146 | 374 |
| 40 | 3300049569 | Ga0501032_0022626 | Ga0501032_0022626_1186_2391 | 377 |
| 41 | 3300049579 | Ga0501043_0017383 | Ga0501043_0017383_3422_4627 | 377 |
| 42 | 3300049580 | Ga0501046_0043067 | Ga0501046_0043067_2095_3300 | 377 |
| 43 | 3300049581 | Ga0501047_0000070 | Ga0501047_0000070_69145_70350 | 377 |
| 44 | iso_pu_bacteria | 2841760612 | 2841766400 | 379 |
| 45 | iso_pu_bacteria | 2844104063 | 2844106167 | 379 |
| 46 | iso_pu_bacteria | 2851182111 | 2851186668 | 379 |
| 47 | iso_pu_bacteria | 2851246043 | 2851246523 | 379 |
| 48 | iso_pu_bacteria | 8057529695 | 8057531283 | 379 |
| 49 | 3300026142 | Ga0207698_10080245 | Ga0207698_100802453 | 381 |
| 50 | iso_pu_bacteria | 2523231067 | 2523467282 | 381 |
| 51 | iso_pu_bacteria | 2738543031 | 2739347786 | 381 |
| 52 | iso_pu_bacteria | 2941485952 | 2941488168 | 382 |
| 53 | 3300001989 | JGI24739J22299_10024392 | JGI24739J22299_100243923 | 383 |
| 54 | 3300005262 | Ga0065165_1000048 | Ga0065165_100004879 | 383 |
| 55 | 3300025284 | Ga0209130_1000071 | Ga0209130_100007161 | 383 |
| 56 | 3300025294 | Ga0209025_1002646 | Ga0209025_10026464 | 383 |
| 57 | 3300025302 | Ga0207426_1022695 | Ga0207426_10226952 | 383 |
| 58 | 3300039438 | Ga0436360_0666790 | Ga0436360_0666790_4968_6149 | 383 |
| 59 | iso_pu_bacteria | 2524023250 | 2524612361 | 383 |
| 60 | iso_pu_bacteria | 2739367664 | 2739650103 | 384 |
| 61 | iso_pu_bacteria | 2739367865 | 2740028576 | 384 |
| 62 | 3300001979 | JGI24740J21852_10012291 | JGI24740J21852_100122913 | 385 |
| 63 | 3300001979 | JGI24740J21852_10026037 | JGI24740J21852_100260372 | 385 |
| 64 | 3300001989 | JGI24739J22299_10021476 | JGI24739J22299_100214763 | 385 |
| 65 | 3300002075 | JGI24738J21930_10002928 | JGI24738J21930_100029282 | 385 |
| 66 | 3300005339 | Ga0070660_100006385 | Ga0070660_1000063856 | 385 |
| 67 | 3300005366 | Ga0070659_100000984 | Ga0070659_10000098416 | 385 |
| 68 | 3300005366 | Ga0070659_100042925 | Ga0070659_1000429252 | 385 |
| 69 | 3300005455 | Ga0070663_100027332 | Ga0070663_1000273322 | 385 |
| 70 | 3300005539 | Ga0068853_100081794 | Ga0068853_1000817942 | 385 |
| 71 | 3300005563 | Ga0068855_100044333 | Ga0068855_1000443335 | 385 |
| 72 | 3300005563 | Ga0068855_100388020 | Ga0068855_1003880202 | 385 |
| 73 | 3300005577 | Ga0068857_100033127 | Ga0068857_1000331272 | 385 |
| 74 | 3300005578 | Ga0068854_100001796 | Ga0068854_10000179613 | 385 |
| 75 | 3300005578 | Ga0068854_100047933 | Ga0068854_1000479332 | 385 |
| 76 | 3300005614 | Ga0068856_100016897 | Ga0068856_1000168972 | 385 |
| 77 | 3300005614 | Ga0068856_100024629 | Ga0068856_1000246292 | 385 |
| 78 | 3300005616 | Ga0068852_100013467 | Ga0068852_1000134674 | 385 |
| 79 | 3300005616 | Ga0068852_100014776 | Ga0068852_1000147762 | 385 |
| 80 | 3300009093 | Ga0105240_10108062 | Ga0105240_101080622 | 385 |
| 81 | 3300009093 | Ga0105240_10262886 | Ga0105240_102628862 | 385 |
| 82 | 3300009148 | Ga0105243_10000150 | Ga0105243_1000015038 | 385 |
| 83 | 3300009174 | Ga0105241_10009912 | Ga0105241_100099126 | 385 |
| 84 | 3300009545 | Ga0105237_10019521 | Ga0105237_100195216 | 385 |
| 85 | 3300009551 | Ga0105238_10108615 | Ga0105238_101086152 | 385 |
| 86 | 3300010375 | Ga0105239_10024092 | Ga0105239_100240922 | 385 |
| 87 | 3300013306 | Ga0163162_10116845 | Ga0163162_101168452 | 385 |
| 88 | 3300025250 | Ga0209026_1001756 | Ga0209026_10017569 | 385 |
| 89 | 3300025911 | Ga0207654_10004226 | Ga0207654_100042262 | 385 |
| 90 | 3300025913 | Ga0207695_10008582 | Ga0207695_100085822 | 385 |
| 91 | 3300025913 | Ga0207695_10105281 | Ga0207695_101052812 | 385 |
| 92 | 3300025914 | Ga0207671_10012484 | Ga0207671_100124842 | 385 |
| 93 | 3300025919 | Ga0207657_10002610 | Ga0207657_1000261010 | 385 |
| 94 | 3300025919 | Ga0207657_10051490 | Ga0207657_100514902 | 385 |
| 95 | 3300025924 | Ga0207694_10041867 | Ga0207694_100418672 | 385 |
| 96 | 3300025932 | Ga0207690_10000052 | Ga0207690_1000005218 | 385 |
| 97 | 3300025932 | Ga0207690_10034237 | Ga0207690_100342372 | 385 |
| 98 | 3300025933 | Ga0207706_10011533 | Ga0207706_100115332 | 385 |
| 99 | 3300025935 | Ga0207709_10000005 | Ga0207709_1000000578 | 385 |
| 100 | 3300025949 | Ga0207667_10007044 | Ga0207667_100070442 | 385 |
| 101 | 3300025981 | Ga0207640_10001866 | Ga0207640_100018665 | 385 |
| 102 | 3300026041 | Ga0207639_10241673 | Ga0207639_102416731 | 385 |
| 103 | 3300026067 | Ga0207678_10036933 | Ga0207678_100369332 | 385 |
| 104 | 3300026078 | Ga0207702_10002001 | Ga0207702_100020016 | 385 |
| 105 | 3300026078 | Ga0207702_10020399 | Ga0207702_100203992 | 385 |
| 106 | 3300026116 | Ga0207674_10033943 | Ga0207674_100339435 | 385 |
| 107 | 3300026142 | Ga0207698_10002024 | Ga0207698_100020248 | 385 |
| 108 | 3300031852 | Ga0307410_10174351 | Ga0307410_101743512 | 385 |
| 109 | 3300033180 | Ga0307510_10008895 | Ga0307510_100088958 | 385 |
| 110 | 3300046506 | Ga0495583_0022510 | Ga0495583_0022510_608_1807 | 385 |
| 111 | 3300046522 | Ga0495643_0001059 | Ga0495643_0001059_9551_10852 | 385 |
| 112 | 3300046530 | Ga0495654_0065712 | Ga0495654_0065712_364_1566 | 385 |
| 113 | 3300046538 | Ga0495609_0014894 | Ga0495609_0014894_1467_2768 | 385 |
| 114 | 3300047445 | Ga0495677_0003401 | Ga0495677_0003401_1916_3115 | 385 |
| 115 | 3300047472 | Ga0495686_0000260 | Ga0495686_0000260_70141_71343 | 385 |
| 116 | 3300048090 | Ga0495615_0000007 | Ga0495615_0000007_61324_62625 | 385 |
| 117 | 3300048924 | Ga0496121_0015865 | Ga0496121_0015865_5986_7203 | 385 |
| 118 | 3300049822 | Ga0501035_0179465 | Ga0501035_0179465_218_1420 | 385 |
| 119 | 3300053087 | Ga0500643_000386 | Ga0500643_000386_29194_30396 | 385 |
| 120 | 3300053087 | Ga0500643_002276 | Ga0500643_002276_81_1292 | 385 |
| 121 | 3300053116 | Ga0500592_000010 | Ga0500592_000010_15445_16647 | 385 |
| 122 | 3300053122 | Ga0500608_000458 | Ga0500608_000458_2200_3408 | 385 |
| 123 | 3300053158 | Ga0500627_0000036 | Ga0500627_0000036_45357_46559 | 385 |
| 124 | iso_pu_bacteria | 2643221541 | 2643727263 | 385 |
| 125 | iso_pu_bacteria | 2643221605 | 2644040596 | 385 |
| 126 | iso_pu_bacteria | 2643221606 | 2644041576 | 385 |
| 127 | iso_pu_bacteria | 2643221671 | 2644395116 | 385 |
| 128 | 3300003781 | Ga0055536_1003474 | Ga0055536_10034745 | 386 |
| 129 | 3300006058 | Ga0075432_10003304 | Ga0075432_100033044 | 386 |
| 130 | 3300006195 | Ga0075366_10086175 | Ga0075366_100861751 | 386 |
| 131 | 3300006353 | Ga0075370_10062516 | Ga0075370_100625163 | 386 |
| 132 | 3300053121 | Ga0500607_000305 | Ga0500607_000305_37223_38401 | 386 |
| 133 | 3300053136 | Ga0500559_0001810 | Ga0500559_0001810_7670_8848 | 386 |
| 134 | 3300053156 | Ga0500622_0002604 | Ga0500622_0002604_10689_11867 | 386 |
| 135 | 3300053178 | Ga0500637_0003517 | Ga0500637_0003517_702_1880 | 386 |
| 136 | 3300039447 | Ga0436361_0868236 | Ga0436361_0868236_141_1340 | 387 |
| 137 | 3300046460 | Ga0495638_0019466 | Ga0495638_0019466_248_1465 | 387 |
| 138 | 3300046471 | Ga0495650_0000093 | Ga0495650_0000093_51170_52387 | 387 |
| 139 | 3300046506 | Ga0495583_0000474 | Ga0495583_0000474_37491_38708 | 387 |
| 140 | 3300046512 | Ga0495610_0000018 | Ga0495610_0000018_278974_280185 | 387 |
| 141 | 3300046665 | Ga0495661_0009545 | Ga0495661_0009545_5279_6496 | 387 |
| 142 | 3300047472 | Ga0495686_0093502 | Ga0495686_0093502_102_1274 | 387 |
| 143 | 3300053103 | Ga0500555_000477 | Ga0500555_000477_4157_5374 | 387 |
| 144 | 3300053125 | Ga0500618_019117 | Ga0500618_019117_88_1302 | 387 |
| 145 | 3300053157 | Ga0500624_000018 | Ga0500624_000018_51676_52911 | 387 |
| 146 | 3300053157 | Ga0500624_000205 | Ga0500624_000205_7868_9082 | 387 |
| 147 | 3300053177 | Ga0500636_0009686 | Ga0500636_0009686_2904_4118 | 387 |
| 148 | 3300053730 | Ga0500645_005578 | Ga0500645_005578_1238_2671 | 387 |
| 149 | iso_pu_bacteria | 2643221588 | 2643950890 | 387 |
| 150 | iso_pu_bacteria | 2896253425 | 2896256313 | 387 |
| 151 | iso_pu_bacteria | 2928027323 | 2928027690 | 387 |
| 152 | iso_pu_bacteria | 2984555340 | 2984558017 | 387 |
| 153 | iso_pu_bacteria | 2984564862 | 2984567616 | 387 |
| 154 | iso_pu_bacteria | 2993356040 | 2993358669 | 387 |
| 155 | iso_pu_bacteria | 3000865235 | 3000867015 | 387 |
| 156 | 3300039453 | Ga0436362_0208270 | Ga0436362_0208270_390_1571 | 388 |
| 157 | iso_pu_bacteria | 2510917021 | 2511127369 | 388 |
| 158 | 3300053140 | Ga0500573_0000082 | Ga0500573_0000082_11676_12854 | 389 |
| 159 | 3300005347 | Ga0070668_100159581 | Ga0070668_1001595812 | 390 |
| 160 | 3300032133 | Ga0316583_10026492 | Ga0316583_100264922 | 391 |
| 161 | 2162886007 | SwRhRL2b_contig_307682 | SwRhRL2b_0018.00005230 | 392 |
| 162 | 3300005289 | Ga0065704_10000192 | Ga0065704_10000192151 | 392 |
| 163 | 3300005295 | Ga0065707_10102494 | Ga0065707_101024942 | 392 |
| 164 | 3300025315 | Ga0207697_10038312 | Ga0207697_100383122 | 392 |
| 165 | 3300048919 | Ga0496116_0000011 | Ga0496116_0000011_244745_245923 | 392 |
| 166 | 3300048920 | Ga0496117_0163512 | Ga0496117_0163512_112_1290 | 392 |
| 167 | 3300048921 | Ga0496118_0049459 | Ga0496118_0049459_338_1516 | 392 |
| 168 | 3300048924 | Ga0496121_0000620 | Ga0496121_0000620_5688_6866 | 392 |
| 169 | 3300048925 | Ga0496122_0001060 | Ga0496122_0001060_5884_7062 | 392 |
| 170 | 3300048926 | Ga0496123_0003719 | Ga0496123_0003719_10547_11725 | 392 |
| 171 | 3300048927 | Ga0496124_0005101 | Ga0496124_0005101_9587_10765 | 392 |
| 172 | 3300048927 | Ga0496124_0006074 | Ga0496124_0006074_1943_3121 | 392 |
| 173 | 3300048929 | Ga0496126_0077324 | Ga0496126_0077324_870_2048 | 392 |
| 174 | 3300049581 | Ga0501047_0130580 | Ga0501047_0130580_1150_2328 | 392 |
| 175 | 3300049823 | Ga0501044_0001276 | Ga0501044_0001276_13944_15122 | 392 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1toj-assembly1.cif.gz_A | hydrocinnamic acid-bound structure of srhept mutant of e. coli aspartate aminotransferase | 0.9621 | 1 | 390 |
| 1ahx-assembly1.cif.gz_A | aspartate aminotransferase hexamutant | 0.9618 | 1 | 390 |
| 1qis-assembly1.cif.gz_A-2 | aspartate aminotransferase from escherichia coli, c191f mutation, with bound maleate | 0.9616 | 1 | 390 |
| 1toe-assembly1.cif.gz_A | unliganded structure of hexamutant + a293d mutant of e. coli aspartate aminotransferase | 0.9605 | 1 | 390 |
| 1asg-assembly1.cif.gz_A-2 | the structural basis for the reduced activity of the y226f(y225f) active site mutant of e. coli aspartate aminotransferase | 0.9602 | 1 | 390 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1ay4A02 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9611 | 45 | 310 | 3.40.640.10 |
| 2aatA02 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9559 | 45 | 310 | 3.40.640.10 |
| af_Q7ZUW8_47_325_3.40.640.10 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9558 | 45 | 311 | 3.40.640.10 |
| 4f4eB02 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9537 | 62 | 297 | 3.40.640.10 |
| 1ay4A02 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9507 | 45 | 310 | 3.40.640.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2N3DJF1-F1-model_v4 | Aromatic amino acid aminotransferase | 0.995 | 301 | 392 |
GO:0006520
GO:0008483 GO:0009058 GO:0030170 GO:0042802 |
| AF-A0A850HC93-F1-model_v4 | Aspartate/tyrosine/aromatic aminotransferase | 0.9864 | 1 | 392 |
GO:0004069
GO:0004838 GO:0005829 GO:0030170 GO:0033585 GO:0042802 |
| AF-A0A850HC93-F1-model_v4 | Aspartate/tyrosine/aromatic aminotransferase | 0.9839 | 1 | 392 |
GO:0004069
GO:0004838 GO:0005829 GO:0030170 GO:0033585 GO:0042802 |
| AF-A0A2N3ATG2-F1-model_v4 | Aromatic amino acid aminotransferase | 0.982 | 1 | 337 |
GO:0004069
GO:0004838 GO:0005829 GO:0030170 GO:0033585 GO:0042802 |
| AF-A0A0N9HN11-F1-model_v4 | Aromatic-amino-acid transaminase | 0.9798 | 157 | 392 |
GO:0004069
GO:0004838 GO:0005829 GO:0030170 GO:0033585 GO:0042802 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar