F266941

General Info

Members Datasets Scaffolds Average Seq Length
175 130 152 395

Family's Representative Sequence

Representative Sequence 3300046522|Ga0495643_0001059|Ga0495643_0001059_9551_10852
Length 433
Sequence MSFDAFGRILFRYRFQNAETENLRLRRLAYSLLMTSLLHLPNLPLSKLAPVAPDPLLSLTSLFAKDTRDRKIDLGVGVYRNSHGVTPVFAAIKEAEQRLAACQPTKAYLGPDGNAAFVEVLSDVALGLDRPVRGLQTLGGTGALFLACVLLASEGTGPTIWLQTPTWSNHLPIFLSAGLAFRTVDSGASEGAGTAQFLAALEQANAGDAVLLQACCHNPTGVDFSSEDWAAVAALCGRKGLTPLVDIAYQGFGDGWDEDMIGLRTLAAAVPELLIAYSCDKNFGLYRERVGALFVAAETTAAMEAAHGHLMAHARGTYSMPADHGAAAVLAVLQDHRLTADWRAELENMRQRVTSVRSALARAGCIGACDLGRLEREHGMFSLLPLGPDTILQLRSRFGIYMAPSGRINLAGLRENDIAYFVDALQDVQEAFA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
3 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
4 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
5 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
6 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
7 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
8 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
9 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
10 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
11 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
12 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
13 2841760612 Bosea sp. Tri-49 Isolate Nodule
14 2844104063 Bosea sp. Tri-39 Isolate Nodule
15 2851182111 Bosea sp. Tri-44 Isolate Nodule
16 2851246043 Bosea sp. Tri-54 Isolate Nodule
17 2896253425 Aurantiacibacter rhizosphaerae GH3-10 Isolate Rhizosphere
18 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
19 2941485952 Brevundimonas faecalis 2814 Isolate Rhizosphere
20 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
21 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
22 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
23 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere
24 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
25 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
26 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
27 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
28 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
29 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
30 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
31 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
32 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
46 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
47 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
60 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
61 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
62 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
63 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
64 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
81 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
82 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
83 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
84 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
85 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
86 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
87 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
88 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
89 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
90 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
91 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
92 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
93 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
94 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
95 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
96 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
97 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
98 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
99 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
100 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
101 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
102 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
103 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
104 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
105 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
106 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
107 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
113 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
114 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
115 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
116 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
117 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
118 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
119 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
120 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
121 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
122 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
123 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
124 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
125 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
126 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
127 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
128 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
129 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
130 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 86.86
Metatranscriptomes 0
Isolates 13.14

Biome Distribution

Category Percentage (%)
Aerial Root 1.71
Bulb 0
Endosphere 15.43
Nodule 2.86
Rhizoplane 0
Rhizosphere 66.86
Stem 0
Stem Tuber 0
Unclassified 13.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_307682 2162886007 Bacteria 29333
2 JGI24740J21852_10010958 3300001979 Bacteria 3467
3 JGI24740J21852_10012291 3300001979 Bacteria 3231
4 JGI24740J21852_10026037 3300001979 Bacteria 1964
5 JGI24739J22299_10021476 3300001989 Bacteria 2297
6 JGI24739J22299_10024392 3300001989 Bacteria 2132
7 JGI24738J21930_10002928 3300002075 Bacteria 4366
8 Ga0055536_1003474 3300003781 Bacteria 8444
9 Ga0065165_1000048 3300005262 Bacteria 196539
10 Ga0065704_10000192 3300005289 Bacteria 216848
11 Ga0065707_10102494 3300005295 Bacteria 2802
12 Ga0070682_100147394 3300005337 Bacteria 1611
13 Ga0070660_100006385 3300005339 Bacteria 8170
14 Ga0070668_100159581 3300005347 Bacteria 1829
15 Ga0070659_100000984 3300005366 Bacteria 20941
16 Ga0070659_100042925 3300005366 Bacteria 3536
17 Ga0070663_100027332 3300005455 Bacteria 3874
18 Ga0070663_100033166 3300005455 Bacteria 3565
19 Ga0070684_100029220 3300005535 Bacteria 4670
20 Ga0068853_100081794 3300005539 Bacteria 2828
21 Ga0068853_100081796 3300005539 Bacteria 2828
22 Ga0068855_100044333 3300005563 Bacteria 5264
23 Ga0068855_100327200 3300005563 Bacteria 1692
24 Ga0068855_100388020 3300005563 Bacteria 1532
25 Ga0070664_100065760 3300005564 Bacteria 3095
26 Ga0068857_100033127 3300005577 Bacteria 4569
27 Ga0068857_100084500 3300005577 Bacteria 2836
28 Ga0068854_100001796 3300005578 Bacteria 13078
29 Ga0068854_100023306 3300005578 Bacteria 4227
30 Ga0068854_100047933 3300005578 Bacteria 3046
31 Ga0068856_100016897 3300005614 Bacteria 7072
32 Ga0068856_100024629 3300005614 Bacteria 5859
33 Ga0068856_100219500 3300005614 Bacteria 1917
34 Ga0068852_100013467 3300005616 Bacteria 6262
35 Ga0068852_100014776 3300005616 Bacteria 6028
36 Ga0068852_100332597 3300005616 Bacteria 1478
37 Ga0068851_10023398 3300005834 Bacteria 3020
38 Ga0075432_10003304 3300006058 Bacteria 5450
39 Ga0075366_10086175 3300006195 Bacteria 1879
40 Ga0075370_10062516 3300006353 Bacteria 2122
41 Ga0105240_10108062 3300009093 Bacteria 3371
42 Ga0105240_10132634 3300009093 Bacteria 2986
43 Ga0105240_10262886 3300009093 Bacteria 1990
44 Ga0105243_10000150 3300009148 Bacteria 79825
45 Ga0105241_10009912 3300009174 Bacteria 7001
46 Ga0105241_10038101 3300009174 Bacteria 3625
47 Ga0105237_10019521 3300009545 Bacteria 7001
48 Ga0105237_10094080 3300009545 Bacteria 2986
49 Ga0105238_10101822 3300009551 Bacteria 2854
50 Ga0105238_10108615 3300009551 Bacteria 2755
51 Ga0105239_10024092 3300010375 Bacteria 6703
52 Ga0105239_10165400 3300010375 Bacteria 2473
53 Ga0157373_10029122 3300013100 Bacteria 3980
54 Ga0157370_10087385 3300013104 Bacteria 2928
55 Ga0157369_10002565 3300013105 Bacteria 21747
56 Ga0163162_10116845 3300013306 Bacteria 2768
57 Ga0157372_10024345 3300013307 Bacteria 6575
58 Ga0163161_10138803 3300017792 Bacteria 1839
59 Ga0209026_1001756 3300025250 Bacteria 8978
60 Ga0209130_1000071 3300025284 Bacteria 178273
61 Ga0209025_1002646 3300025294 Bacteria 18319
62 Ga0207426_1022695 3300025302 Bacteria 2150
63 Ga0207697_10038312 3300025315 Bacteria 1965
64 Ga0207654_10000442 3300025911 Bacteria 23622
65 Ga0207654_10004226 3300025911 Bacteria 7246
66 Ga0207695_10003338 3300025913 Bacteria 22726
67 Ga0207695_10008582 3300025913 Bacteria 12767
68 Ga0207695_10105281 3300025913 Bacteria 2809
69 Ga0207671_10012484 3300025914 Bacteria 6825
70 Ga0207671_10083117 3300025914 Bacteria 2404
71 Ga0207657_10002610 3300025919 Bacteria 19473
72 Ga0207657_10051490 3300025919 Bacteria 3579
73 Ga0207694_10010416 3300025924 Bacteria 7009
74 Ga0207694_10041867 3300025924 Bacteria 3531
75 Ga0207690_10000052 3300025932 Bacteria 106112
76 Ga0207690_10034237 3300025932 Bacteria 3272
77 Ga0207706_10011533 3300025933 Bacteria 8049
78 Ga0207706_10086547 3300025933 Bacteria 2755
79 Ga0207709_10000005 3300025935 Bacteria 806813
80 Ga0207667_10007044 3300025949 Bacteria 13585
81 Ga0207640_10001866 3300025981 Bacteria 11302
82 Ga0207640_10066222 3300025981 Bacteria 2413
83 Ga0207639_10241673 3300026041 Bacteria 1570
84 Ga0207678_10003212 3300026067 Bacteria 14773
85 Ga0207678_10036933 3300026067 Bacteria 4253
86 Ga0207702_10002001 3300026078 Bacteria 19755
87 Ga0207702_10002550 3300026078 Bacteria 17144
88 Ga0207702_10020399 3300026078 Bacteria 5490
89 Ga0207674_10033943 3300026116 Bacteria 5337
90 Ga0207674_10056824 3300026116 Bacteria 3971
91 Ga0207698_10002024 3300026142 Bacteria 11965
92 Ga0207698_10059475 3300026142 Bacteria 2968
93 Ga0207698_10080245 3300026142 Bacteria 2627
94 Ga0307410_10174351 3300031852 Bacteria 1623
95 Ga0307414_10093161 3300032004 Bacteria 2245
96 Ga0316583_10026492 3300032133 Bacteria 2069
97 Ga0307510_10008895 3300033180 Bacteria 11965
98 Ga0436360_0666790 3300039438 Bacteria 7062
99 Ga0436361_0868236 3300039447 Bacteria 3273
100 Ga0436362_0208270 3300039453 Bacteria 1683
101 Ga0495638_0019466 3300046460 Bacteria 4491
102 Ga0495650_0000093 3300046471 Bacteria 221558
103 Ga0495583_0000474 3300046506 Bacteria 58751
104 Ga0495583_0022510 3300046506 Bacteria 3213
105 Ga0495610_0000018 3300046512 Bacteria 355044
106 Ga0495631_0028242 3300046518 Bacteria 2560
107 Ga0495643_0001059 3300046522 Bacteria 27569
108 Ga0495643_0064340 3300046522 Bacteria 1938
109 Ga0495654_0065712 3300046530 Bacteria 1730
110 Ga0495609_0014894 3300046538 Bacteria 3648
111 Ga0495661_0009545 3300046665 Bacteria 6655
112 Ga0495677_0003401 3300047445 Bacteria 6184
113 Ga0495686_0000260 3300047472 Bacteria 94551
114 Ga0495686_0093502 3300047472 Bacteria 1823
115 Ga0495615_0000007 3300048090 Bacteria 90892
116 Ga0496116_0000011 3300048919 Bacteria 646953
117 Ga0496117_0163512 3300048920 Bacteria 1301
118 Ga0496118_0049459 3300048921 Bacteria 3237
119 Ga0496121_0000620 3300048924 Bacteria 66051
120 Ga0496121_0015865 3300048924 Bacteria 7832
121 Ga0496122_0001060 3300048925 Bacteria 47797
122 Ga0496123_0003719 3300048926 Bacteria 16783
123 Ga0496124_0005101 3300048927 Bacteria 14955
124 Ga0496124_0006074 3300048927 Bacteria 13283
125 Ga0496126_0077324 3300048929 Bacteria 2950
126 Ga0501032_0022626 3300049569 Bacteria 4356
127 Ga0501043_0017383 3300049579 Bacteria 5639
128 Ga0501046_0043067 3300049580 Bacteria 3596
129 Ga0501047_0000070 3300049581 Bacteria 127146
130 Ga0501047_0130580 3300049581 Bacteria 2393
131 Ga0501035_0179465 3300049822 Bacteria 1825
132 Ga0501044_0001276 3300049823 Bacteria 29754
133 nmdc:mga0k408_66577_c1 3300050493 Bacteria 2098
134 nmdc:mga07m45_76729_c1 3300050496 Bacteria 1905
135 nmdc:mga0sz30_15812_c1 3300050516 Bacteria 2986
136 Ga0500643_000386 3300053087 Bacteria 34137
137 Ga0500643_002276 3300053087 Bacteria 10073
138 Ga0500555_000477 3300053103 Bacteria 16617
139 Ga0500592_000010 3300053116 Bacteria 76714
140 Ga0500607_000305 3300053121 Bacteria 46428
141 Ga0500608_000458 3300053122 Bacteria 15296
142 Ga0500618_019117 3300053125 Bacteria 1688
143 Ga0500559_0000007 3300053136 Bacteria 226236
144 Ga0500559_0001810 3300053136 Bacteria 11688
145 Ga0500573_0000082 3300053140 Bacteria 45547
146 Ga0500622_0002604 3300053156 Bacteria 12850
147 Ga0500624_000018 3300053157 Bacteria 131677
148 Ga0500624_000205 3300053157 Bacteria 22830
149 Ga0500627_0000036 3300053158 Bacteria 79400
150 Ga0500636_0009686 3300053177 Bacteria 5608
151 Ga0500637_0003517 3300053178 Bacteria 7255
152 Ga0500645_005578 3300053730 Bacteria 4608

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050496 nmdc:mga07m45_76729_c1 nmdc:mga07m45_76729_c1_854_1894 341
2 3300046522 Ga0495643_0064340 Ga0495643_0064340_306_1535 349
3 3300017792 Ga0163161_10138803 Ga0163161_101388031 366
4 3300053136 Ga0500559_0000007 Ga0500559_0000007_53641_54822 367
5 3300032004 Ga0307414_10093161 Ga0307414_100931612 368
6 3300001979 JGI24740J21852_10010958 JGI24740J21852_100109583 372
7 3300005337 Ga0070682_100147394 Ga0070682_1001473941 372
8 3300005455 Ga0070663_100033166 Ga0070663_1000331663 372
9 3300005535 Ga0070684_100029220 Ga0070684_1000292206 372
10 3300005539 Ga0068853_100081796 Ga0068853_1000817962 372
11 3300005563 Ga0068855_100327200 Ga0068855_1003272002 372
12 3300005564 Ga0070664_100065760 Ga0070664_1000657602 372
13 3300005577 Ga0068857_100084500 Ga0068857_1000845002 372
14 3300005578 Ga0068854_100023306 Ga0068854_1000233064 372
15 3300005614 Ga0068856_100219500 Ga0068856_1002195002 372
16 3300005616 Ga0068852_100332597 Ga0068852_1003325971 372
17 3300005834 Ga0068851_10023398 Ga0068851_100233982 372
18 3300009093 Ga0105240_10132634 Ga0105240_101326342 372
19 3300009174 Ga0105241_10038101 Ga0105241_100381012 372
20 3300009545 Ga0105237_10094080 Ga0105237_100940802 372
21 3300009551 Ga0105238_10101822 Ga0105238_101018222 372
22 3300010375 Ga0105239_10165400 Ga0105239_101654002 372
23 3300013100 Ga0157373_10029122 Ga0157373_100291225 372
24 3300013104 Ga0157370_10087385 Ga0157370_100873852 372
25 3300013105 Ga0157369_10002565 Ga0157369_1000256510 372
26 3300013307 Ga0157372_10024345 Ga0157372_100243452 372
27 3300025911 Ga0207654_10000442 Ga0207654_1000044211 372
28 3300025913 Ga0207695_10003338 Ga0207695_1000333813 372
29 3300025914 Ga0207671_10083117 Ga0207671_100831172 372
30 3300025924 Ga0207694_10010416 Ga0207694_100104166 372
31 3300025933 Ga0207706_10086547 Ga0207706_100865472 372
32 3300025981 Ga0207640_10066222 Ga0207640_100662222 372
33 3300026067 Ga0207678_10003212 Ga0207678_1000321213 372
34 3300026078 Ga0207702_10002550 Ga0207702_100025506 372
35 3300026116 Ga0207674_10056824 Ga0207674_100568243 372
36 3300026142 Ga0207698_10059475 Ga0207698_100594752 372
37 3300046518 Ga0495631_0028242 Ga0495631_0028242_1360_2499 374
38 3300050493 nmdc:mga0k408_66577_c1 nmdc:mga0k408_66577_c1_928_2067 374
39 3300050516 nmdc:mga0sz30_15812_c1 nmdc:mga0sz30_15812_c1_962_2146 374
40 3300049569 Ga0501032_0022626 Ga0501032_0022626_1186_2391 377
41 3300049579 Ga0501043_0017383 Ga0501043_0017383_3422_4627 377
42 3300049580 Ga0501046_0043067 Ga0501046_0043067_2095_3300 377
43 3300049581 Ga0501047_0000070 Ga0501047_0000070_69145_70350 377
44 iso_pu_bacteria 2841760612 2841766400 379
45 iso_pu_bacteria 2844104063 2844106167 379
46 iso_pu_bacteria 2851182111 2851186668 379
47 iso_pu_bacteria 2851246043 2851246523 379
48 iso_pu_bacteria 8057529695 8057531283 379
49 3300026142 Ga0207698_10080245 Ga0207698_100802453 381
50 iso_pu_bacteria 2523231067 2523467282 381
51 iso_pu_bacteria 2738543031 2739347786 381
52 iso_pu_bacteria 2941485952 2941488168 382
53 3300001989 JGI24739J22299_10024392 JGI24739J22299_100243923 383
54 3300005262 Ga0065165_1000048 Ga0065165_100004879 383
55 3300025284 Ga0209130_1000071 Ga0209130_100007161 383
56 3300025294 Ga0209025_1002646 Ga0209025_10026464 383
57 3300025302 Ga0207426_1022695 Ga0207426_10226952 383
58 3300039438 Ga0436360_0666790 Ga0436360_0666790_4968_6149 383
59 iso_pu_bacteria 2524023250 2524612361 383
60 iso_pu_bacteria 2739367664 2739650103 384
61 iso_pu_bacteria 2739367865 2740028576 384
62 3300001979 JGI24740J21852_10012291 JGI24740J21852_100122913 385
63 3300001979 JGI24740J21852_10026037 JGI24740J21852_100260372 385
64 3300001989 JGI24739J22299_10021476 JGI24739J22299_100214763 385
65 3300002075 JGI24738J21930_10002928 JGI24738J21930_100029282 385
66 3300005339 Ga0070660_100006385 Ga0070660_1000063856 385
67 3300005366 Ga0070659_100000984 Ga0070659_10000098416 385
68 3300005366 Ga0070659_100042925 Ga0070659_1000429252 385
69 3300005455 Ga0070663_100027332 Ga0070663_1000273322 385
70 3300005539 Ga0068853_100081794 Ga0068853_1000817942 385
71 3300005563 Ga0068855_100044333 Ga0068855_1000443335 385
72 3300005563 Ga0068855_100388020 Ga0068855_1003880202 385
73 3300005577 Ga0068857_100033127 Ga0068857_1000331272 385
74 3300005578 Ga0068854_100001796 Ga0068854_10000179613 385
75 3300005578 Ga0068854_100047933 Ga0068854_1000479332 385
76 3300005614 Ga0068856_100016897 Ga0068856_1000168972 385
77 3300005614 Ga0068856_100024629 Ga0068856_1000246292 385
78 3300005616 Ga0068852_100013467 Ga0068852_1000134674 385
79 3300005616 Ga0068852_100014776 Ga0068852_1000147762 385
80 3300009093 Ga0105240_10108062 Ga0105240_101080622 385
81 3300009093 Ga0105240_10262886 Ga0105240_102628862 385
82 3300009148 Ga0105243_10000150 Ga0105243_1000015038 385
83 3300009174 Ga0105241_10009912 Ga0105241_100099126 385
84 3300009545 Ga0105237_10019521 Ga0105237_100195216 385
85 3300009551 Ga0105238_10108615 Ga0105238_101086152 385
86 3300010375 Ga0105239_10024092 Ga0105239_100240922 385
87 3300013306 Ga0163162_10116845 Ga0163162_101168452 385
88 3300025250 Ga0209026_1001756 Ga0209026_10017569 385
89 3300025911 Ga0207654_10004226 Ga0207654_100042262 385
90 3300025913 Ga0207695_10008582 Ga0207695_100085822 385
91 3300025913 Ga0207695_10105281 Ga0207695_101052812 385
92 3300025914 Ga0207671_10012484 Ga0207671_100124842 385
93 3300025919 Ga0207657_10002610 Ga0207657_1000261010 385
94 3300025919 Ga0207657_10051490 Ga0207657_100514902 385
95 3300025924 Ga0207694_10041867 Ga0207694_100418672 385
96 3300025932 Ga0207690_10000052 Ga0207690_1000005218 385
97 3300025932 Ga0207690_10034237 Ga0207690_100342372 385
98 3300025933 Ga0207706_10011533 Ga0207706_100115332 385
99 3300025935 Ga0207709_10000005 Ga0207709_1000000578 385
100 3300025949 Ga0207667_10007044 Ga0207667_100070442 385
101 3300025981 Ga0207640_10001866 Ga0207640_100018665 385
102 3300026041 Ga0207639_10241673 Ga0207639_102416731 385
103 3300026067 Ga0207678_10036933 Ga0207678_100369332 385
104 3300026078 Ga0207702_10002001 Ga0207702_100020016 385
105 3300026078 Ga0207702_10020399 Ga0207702_100203992 385
106 3300026116 Ga0207674_10033943 Ga0207674_100339435 385
107 3300026142 Ga0207698_10002024 Ga0207698_100020248 385
108 3300031852 Ga0307410_10174351 Ga0307410_101743512 385
109 3300033180 Ga0307510_10008895 Ga0307510_100088958 385
110 3300046506 Ga0495583_0022510 Ga0495583_0022510_608_1807 385
111 3300046522 Ga0495643_0001059 Ga0495643_0001059_9551_10852 385
112 3300046530 Ga0495654_0065712 Ga0495654_0065712_364_1566 385
113 3300046538 Ga0495609_0014894 Ga0495609_0014894_1467_2768 385
114 3300047445 Ga0495677_0003401 Ga0495677_0003401_1916_3115 385
115 3300047472 Ga0495686_0000260 Ga0495686_0000260_70141_71343 385
116 3300048090 Ga0495615_0000007 Ga0495615_0000007_61324_62625 385
117 3300048924 Ga0496121_0015865 Ga0496121_0015865_5986_7203 385
118 3300049822 Ga0501035_0179465 Ga0501035_0179465_218_1420 385
119 3300053087 Ga0500643_000386 Ga0500643_000386_29194_30396 385
120 3300053087 Ga0500643_002276 Ga0500643_002276_81_1292 385
121 3300053116 Ga0500592_000010 Ga0500592_000010_15445_16647 385
122 3300053122 Ga0500608_000458 Ga0500608_000458_2200_3408 385
123 3300053158 Ga0500627_0000036 Ga0500627_0000036_45357_46559 385
124 iso_pu_bacteria 2643221541 2643727263 385
125 iso_pu_bacteria 2643221605 2644040596 385
126 iso_pu_bacteria 2643221606 2644041576 385
127 iso_pu_bacteria 2643221671 2644395116 385
128 3300003781 Ga0055536_1003474 Ga0055536_10034745 386
129 3300006058 Ga0075432_10003304 Ga0075432_100033044 386
130 3300006195 Ga0075366_10086175 Ga0075366_100861751 386
131 3300006353 Ga0075370_10062516 Ga0075370_100625163 386
132 3300053121 Ga0500607_000305 Ga0500607_000305_37223_38401 386
133 3300053136 Ga0500559_0001810 Ga0500559_0001810_7670_8848 386
134 3300053156 Ga0500622_0002604 Ga0500622_0002604_10689_11867 386
135 3300053178 Ga0500637_0003517 Ga0500637_0003517_702_1880 386
136 3300039447 Ga0436361_0868236 Ga0436361_0868236_141_1340 387
137 3300046460 Ga0495638_0019466 Ga0495638_0019466_248_1465 387
138 3300046471 Ga0495650_0000093 Ga0495650_0000093_51170_52387 387
139 3300046506 Ga0495583_0000474 Ga0495583_0000474_37491_38708 387
140 3300046512 Ga0495610_0000018 Ga0495610_0000018_278974_280185 387
141 3300046665 Ga0495661_0009545 Ga0495661_0009545_5279_6496 387
142 3300047472 Ga0495686_0093502 Ga0495686_0093502_102_1274 387
143 3300053103 Ga0500555_000477 Ga0500555_000477_4157_5374 387
144 3300053125 Ga0500618_019117 Ga0500618_019117_88_1302 387
145 3300053157 Ga0500624_000018 Ga0500624_000018_51676_52911 387
146 3300053157 Ga0500624_000205 Ga0500624_000205_7868_9082 387
147 3300053177 Ga0500636_0009686 Ga0500636_0009686_2904_4118 387
148 3300053730 Ga0500645_005578 Ga0500645_005578_1238_2671 387
149 iso_pu_bacteria 2643221588 2643950890 387
150 iso_pu_bacteria 2896253425 2896256313 387
151 iso_pu_bacteria 2928027323 2928027690 387
152 iso_pu_bacteria 2984555340 2984558017 387
153 iso_pu_bacteria 2984564862 2984567616 387
154 iso_pu_bacteria 2993356040 2993358669 387
155 iso_pu_bacteria 3000865235 3000867015 387
156 3300039453 Ga0436362_0208270 Ga0436362_0208270_390_1571 388
157 iso_pu_bacteria 2510917021 2511127369 388
158 3300053140 Ga0500573_0000082 Ga0500573_0000082_11676_12854 389
159 3300005347 Ga0070668_100159581 Ga0070668_1001595812 390
160 3300032133 Ga0316583_10026492 Ga0316583_100264922 391
161 2162886007 SwRhRL2b_contig_307682 SwRhRL2b_0018.00005230 392
162 3300005289 Ga0065704_10000192 Ga0065704_10000192151 392
163 3300005295 Ga0065707_10102494 Ga0065707_101024942 392
164 3300025315 Ga0207697_10038312 Ga0207697_100383122 392
165 3300048919 Ga0496116_0000011 Ga0496116_0000011_244745_245923 392
166 3300048920 Ga0496117_0163512 Ga0496117_0163512_112_1290 392
167 3300048921 Ga0496118_0049459 Ga0496118_0049459_338_1516 392
168 3300048924 Ga0496121_0000620 Ga0496121_0000620_5688_6866 392
169 3300048925 Ga0496122_0001060 Ga0496122_0001060_5884_7062 392
170 3300048926 Ga0496123_0003719 Ga0496123_0003719_10547_11725 392
171 3300048927 Ga0496124_0005101 Ga0496124_0005101_9587_10765 392
172 3300048927 Ga0496124_0006074 Ga0496124_0006074_1943_3121 392
173 3300048929 Ga0496126_0077324 Ga0496126_0077324_870_2048 392
174 3300049581 Ga0501047_0130580 Ga0501047_0130580_1150_2328 392
175 3300049823 Ga0501044_0001276 Ga0501044_0001276_13944_15122 392

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00155

Aminotran_1_2

Aminotransferase class I and II

69

425

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1toj-assembly1.cif.gz_A hydrocinnamic acid-bound structure of srhept mutant of e. coli aspartate aminotransferase 0.9621 1 390
1ahx-assembly1.cif.gz_A aspartate aminotransferase hexamutant 0.9618 1 390
1qis-assembly1.cif.gz_A-2 aspartate aminotransferase from escherichia coli, c191f mutation, with bound maleate 0.9616 1 390
1toe-assembly1.cif.gz_A unliganded structure of hexamutant + a293d mutant of e. coli aspartate aminotransferase 0.9605 1 390
1asg-assembly1.cif.gz_A-2 the structural basis for the reduced activity of the y226f(y225f) active site mutant of e. coli aspartate aminotransferase 0.9602 1 390
ID Description Score Start End Superfamily
1ay4A02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9611 45 310 3.40.640.10
2aatA02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9559 45 310 3.40.640.10
af_Q7ZUW8_47_325_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9558 45 311 3.40.640.10
4f4eB02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9537 62 297 3.40.640.10
1ay4A02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9507 45 310 3.40.640.10
ID Description Score Start End GO Terms
AF-A0A2N3DJF1-F1-model_v4 Aromatic amino acid aminotransferase 0.995 301 392 GO:0006520
GO:0008483
GO:0009058
GO:0030170
GO:0042802
AF-A0A850HC93-F1-model_v4 Aspartate/tyrosine/aromatic aminotransferase 0.9864 1 392 GO:0004069
GO:0004838
GO:0005829
GO:0030170
GO:0033585
GO:0042802
AF-A0A850HC93-F1-model_v4 Aspartate/tyrosine/aromatic aminotransferase 0.9839 1 392 GO:0004069
GO:0004838
GO:0005829
GO:0030170
GO:0033585
GO:0042802
AF-A0A2N3ATG2-F1-model_v4 Aromatic amino acid aminotransferase 0.982 1 337 GO:0004069
GO:0004838
GO:0005829
GO:0030170
GO:0033585
GO:0042802
AF-A0A0N9HN11-F1-model_v4 Aromatic-amino-acid transaminase 0.9798 157 392 GO:0004069
GO:0004838
GO:0005829
GO:0030170
GO:0033585
GO:0042802

Feature Viewer

pLDDT pTM Quality
93.16 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map