F267233

General Info

Members Datasets Scaffolds Average Seq Length
175 129 350 236

Family's Representative Sequence

Representative Sequence 3300053087|Ga0500643_009410|Ga0500643_009410_1063_1965
Length 287
Sequence LDGRSGGGADAHHIDLSKPDNADQGRLVILKEWLAEIDEIKGRHGDTVSTTPNCAIRQHGEHGAIARLLTPDAGLVAGYVRGGRSSRMRPILIPGNIVQADFRTRAGGQLAGLTVELEHSRAPLFSEPLPAAAIEWACALTAATLPDDHGYPALFSALSGLLDAVEAAPAARGWAVALVQYERLLLGELGFGLDLSTCTVAGNANDLAYVSPSTGRAVSRLGAIGYEPRLLPLPFFLLSGGEAGWDDIMDGFALTGHFLRRDLLADRRTDVLAGRDRLIERLKRAIA

Samples

Sample ID Description Type Environment
1 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
23 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
24 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
25 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
32 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
33 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
34 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
35 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
36 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
37 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
38 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
39 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
40 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
41 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
42 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
73 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
74 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
75 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
76 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
77 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
78 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
79 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
80 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
81 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
82 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
83 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
84 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
85 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
86 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
87 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
88 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
89 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
90 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
91 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
92 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
93 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
94 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
95 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
96 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
97 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
98 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
99 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
100 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
101 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
102 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
103 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
104 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
105 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
106 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
107 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
108 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
109 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
110 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
111 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
112 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
113 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
114 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
115 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
116 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
117 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
118 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
119 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
120 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
121 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
122 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
123 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
124 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
125 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
126 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
127 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
128 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
129 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.43
Metatranscriptomes 0
Isolates 0.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.29
Nodule 0
Rhizoplane 0.57
Rhizosphere 90.86
Stem 0
Stem Tuber 0
Unclassified 2.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500643_009410 3300053087 Bacteria 3737
2 Ga0065715_10249593 3300005293 Bacteria 1172
3 Ga0070683_100170365 3300005329 Bacteria 2067
4 Ga0070670_100042908 3300005331 Bacteria 3889
5 Ga0070670_100256959 3300005331 Bacteria 1522
6 Ga0070677_10004777 3300005333 Bacteria 4440
7 Ga0070666_10000068 3300005335 Bacteria 76194
8 Ga0068868_100000122 3300005338 Bacteria 49376
9 Ga0070660_100000521 3300005339 Bacteria 25661
10 Ga0070687_100122629 3300005343 Bacteria 1489
11 Ga0070661_100068561 3300005344 Bacteria 2607
12 Ga0070669_100000018 3300005353 Bacteria 195789
13 Ga0070669_100009465 3300005353 Bacteria 6939
14 Ga0070675_100021066 3300005354 Bacteria 5205
15 Ga0070675_100774958 3300005354 Bacteria 876
16 Ga0070671_100000011 3300005355 Bacteria 202057
17 Ga0070671_100548924 3300005355 Unclassified 996
18 Ga0070674_100038838 3300005356 Bacteria 3211
19 Ga0070659_100000032 3300005366 Bacteria 120241
20 Ga0070667_100861476 3300005367 Bacteria 842
21 Ga0070701_10180497 3300005438 Bacteria 1235
22 Ga0070662_100017312 3300005457 Bacteria 4857
23 Ga0070684_100125059 3300005535 Bacteria 2316
24 Ga0070684_100438502 3300005535 Bacteria 1206
25 Ga0070665_100592161 3300005548 Bacteria 1122
26 Ga0068857_100125058 3300005577 Bacteria 2317
27 Ga0068857_100854250 3300005577 Bacteria 871
28 Ga0068859_100007283 3300005617 Bacteria 11222
29 Ga0068859_100094704 3300005617 Bacteria 3038
30 Ga0068864_100001740 3300005618 Bacteria 17896
31 Ga0068864_100097874 3300005618 Bacteria 2598
32 Ga0068861_100007610 3300005719 Bacteria 7433
33 Ga0068861_100070809 3300005719 Bacteria 2701
34 Ga0068851_10053766 3300005834 Bacteria 2051
35 Ga0068863_100003685 3300005841 Bacteria 15137
36 Ga0068858_100006381 3300005842 Bacteria 11489
37 Ga0068860_100004003 3300005843 Bacteria 15124
38 Ga0068862_100000543 3300005844 Bacteria 39504
39 Ga0097620_100007283 3300006931 Bacteria 11222
40 Ga0097620_100094707 3300006931 Bacteria 3038
41 Ga0105247_10021599 3300009101 Bacteria 3875
42 Ga0105243_10861115 3300009148 Bacteria 898
43 Ga0105248_10255818 3300009177 Bacteria 1971
44 Ga0105248_11435235 3300009177 Bacteria 781
45 Ga0105249_10015304 3300009553 Bacteria 6789
46 Ga0105249_10051755 3300009553 Bacteria 3747
47 Ga0105239_10368916 3300010375 Bacteria 1622
48 Ga0157370_10044225 3300013104 Bacteria 4282
49 Ga0157370_11066811 3300013104 Bacteria 730
50 Ga0157374_10353612 3300013296 Bacteria 1460
51 Ga0163162_10008723 3300013306 Bacteria 9865
52 Ga0163163_10039118 3300014325 Bacteria 4627
53 Ga0157380_10110417 3300014326 Bacteria 2309
54 Ga0157379_10154855 3300014968 Bacteria 2067
55 Ga0209050_1041976 3300025298 Bacteria 1255
56 Ga0209257_1051714 3300025304 Bacteria 1156
57 Ga0207697_10000184 3300025315 Bacteria 32509
58 Ga0207697_10010809 3300025315 Bacteria 3884
59 Ga0207710_10036440 3300025900 Bacteria 2169
60 Ga0207645_10306153 3300025907 Bacteria 1058
61 Ga0207657_10002315 3300025919 Bacteria 20657
62 Ga0207681_10000008 3300025923 Bacteria 414329
63 Ga0207681_10007378 3300025923 Bacteria 6734
64 Ga0207650_10009314 3300025925 Bacteria 6710
65 Ga0207650_10099256 3300025925 Bacteria 2238
66 Ga0207659_10012289 3300025926 Bacteria 5441
67 Ga0207659_10181913 3300025926 Bacteria 1666
68 Ga0207644_10000006 3300025931 Bacteria 408793
69 Ga0207644_10371927 3300025931 Bacteria 1164
70 Ga0207690_10000001 3300025932 Bacteria 807539
71 Ga0207706_10010340 3300025933 Bacteria 8530
72 Ga0207691_10005027 3300025940 Bacteria 12756
73 Ga0207711_10016515 3300025941 Bacteria 6132
74 Ga0207712_10006483 3300025961 Bacteria 7381
75 Ga0207712_10009274 3300025961 Bacteria 6226
76 Ga0207668_10000706 3300025972 Bacteria 20420
77 Ga0207668_10108065 3300025972 Bacteria 2081
78 Ga0207668_10244834 3300025972 Bacteria 1453
79 Ga0207658_10004644 3300025986 Bacteria 9522
80 Ga0207677_10000176 3300026023 Bacteria 50717
81 Ga0207703_10007829 3300026035 Bacteria 8451
82 Ga0207639_10000912 3300026041 Bacteria 19997
83 Ga0207639_10002373 3300026041 Bacteria 12654
84 Ga0207678_10664929 3300026067 Bacteria 915
85 Ga0207641_10012207 3300026088 Bacteria 7050
86 Ga0207648_10024705 3300026089 Bacteria 5359
87 Ga0207676_10003099 3300026095 Bacteria 11861
88 Ga0207676_10050562 3300026095 Bacteria 3241
89 Ga0207674_10003071 3300026116 Bacteria 20652
90 Ga0207674_10526757 3300026116 Bacteria 1141
91 Ga0207675_100000341 3300026118 Bacteria 44495
92 Ga0207675_100011433 3300026118 Bacteria 8304
93 Ga0207683_10552973 3300026121 Bacteria 1064
94 Ga0268266_10311958 3300028379 Bacteria 1470
95 Ga0268265_10000433 3300028380 Bacteria 44275
96 Ga0268264_10000010 3300028381 Bacteria 596543
97 Ga0307408_100005065 3300031548 Bacteria 8843
98 Ga0307405_10510307 3300031731 Bacteria 965
99 Ga0307413_10099161 3300031824 Bacteria 1920
100 Ga0307406_10010255 3300031901 Bacteria 5280
101 Ga0307406_10102148 3300031901 Bacteria 1955
102 Ga0307406_10323138 3300031901 Bacteria 1194
103 Ga0307412_10273784 3300031911 Bacteria 1322
104 Ga0307416_100131021 3300032002 Bacteria 2257
105 Ga0307416_100159143 3300032002 Bacteria 2084
106 Ga0307416_100175144 3300032002 Bacteria 2003
107 Ga0307414_10003057 3300032004 Bacteria 8877
108 Ga0307414_10276016 3300032004 Bacteria 1410
109 Ga0307414_10490287 3300032004 Bacteria 1085
110 Ga0395899_0060087 3300037312 Bacteria 2800
111 Ga0395899_0070168 3300037312 Bacteria 2564
112 Ga0395900_0043727 3300037418 Bacteria 4617
113 Ga0395900_0131328 3300037418 Bacteria 2566
114 Ga0395900_0166709 3300037418 Bacteria 2244
115 Ga0395900_0643110 3300037418 Bacteria 998
116 Ga0395898_0134773 3300037466 Bacteria 2364
117 Ga0395905_0002897 3300037471 Bacteria 18745
118 Ga0395905_0143740 3300037471 Bacteria 2244
119 Ga0395905_0150219 3300037471 Bacteria 2191
120 Ga0395901_0036272 3300038443 Bacteria 5095
121 Ga0395901_0175983 3300038443 Bacteria 2244
122 Ga0395901_0294741 3300038443 Bacteria 1682
123 Ga0439464_0130269 3300042439 Unclassified 779
124 Ga0466957_0006023 3300044842 Bacteria 6842
125 Ga0466967_0049348 3300045976 Bacteria 3680
126 Ga0466967_0965678 3300045976 Bacteria 848
127 Ga0495627_000332 3300046453 Bacteria 45347
128 Ga0495632_0000039 3300046519 Bacteria 150268
129 Ga0495648_0033329 3300046524 Bacteria 3364
130 Ga0495663_0000006 3300046525 Bacteria 306938
131 Ga0495621_0094778 3300046539 Bacteria 1129
132 Ga0495597_0086446 3300046542 Bacteria 1335
133 Ga0495633_0000967 3300046558 Bacteria 23580
134 Ga0495633_0001121 3300046558 Bacteria 21501
135 Ga0495668_0072491 3300046616 Bacteria 1892
136 Ga0495659_0010955 3300046664 Unclassified 2921
137 Ga0495669_0036794 3300046684 Bacteria 2165
138 Ga0495670_0104086 3300046691 Bacteria 1464
139 Ga0496109_0037721 3300048912 Bacteria 4367
140 Ga0496122_0001436 3300048925 Bacteria 38534
141 Ga0496123_0000521 3300048926 Bacteria 66722
142 Ga0496126_0098778 3300048929 Bacteria 2558
143 Ga0501292_000094 3300049515 Bacteria 15813
144 Ga0501293_000855 3300049516 Bacteria 2296
145 Ga0501294_001978 3300049517 Bacteria 1978
146 Ga0501300_000889 3300049523 Bacteria 4573
147 Ga0501202_025885 3300049652 Unclassified 1198
148 Ga0501206_000877 3300049653 Bacteria 3706
149 Ga0501222_000371 3300049662 Bacteria 6921
150 Ga0501223_001453 3300049663 Bacteria 5478
151 Ga0501224_000151 3300049664 Bacteria 7571
152 Ga0501227_004597 3300049665 Bacteria 2965
153 Ga0501235_003449 3300049669 Bacteria 3420
154 Ga0501257_000008 3300049686 Bacteria 54624
155 Ga0501261_000051 3300049690 Bacteria 22280
156 Ga0501221_004167 3300049704 Bacteria 2395
157 Ga0501225_0005102 3300049705 Bacteria 3869
158 Ga0501225_0006637 3300049705 Bacteria 3374
159 Ga0501225_0117468 3300049705 Unclassified 788
160 Ga0501276_009251 3300049773 Bacteria 814
161 Ga0501279_000077 3300049775 Bacteria 16519
162 Ga0501280_000100 3300049776 Bacteria 22874
163 Ga0501280_005719 3300049776 Bacteria 1771
164 Ga0501281_00058 3300049777 Bacteria 13111
165 Ga0501282_000196 3300049778 Bacteria 7432
166 Ga0501044_0296733 3300049823 Bacteria 1546
167 Ga0500643_000203 3300053087 Bacteria 56433
168 Ga0500643_023179 3300053087 Bacteria 1986
169 Ga0500556_0000013 3300053104 Bacteria 243797
170 Ga0500618_005929 3300053125 Bacteria 3648
171 Ga0500642_0000002 3300053130 Bacteria 795093
172 Ga0500624_000324 3300053157 Bacteria 16298
173 Ga0500636_0019298 3300053177 Bacteria 4034
174 Ga0500645_000105 3300053730 Bacteria 67078
175 2919713335 2919709256 Bacteria 4318106
176 Ga0500643_009410
177 Ga0065715_10249593
178 Ga0070683_100170365
179 Ga0070670_100042908
180 Ga0070670_100256959
181 Ga0070677_10004777
182 Ga0070666_10000068
183 Ga0068868_100000122
184 Ga0070660_100000521
185 Ga0070687_100122629
186 Ga0070661_100068561
187 Ga0070669_100000018
188 Ga0070669_100009465
189 Ga0070675_100021066
190 Ga0070675_100774958
191 Ga0070671_100000011
192 Ga0070671_100548924
193 Ga0070674_100038838
194 Ga0070659_100000032
195 Ga0070667_100861476
196 Ga0070701_10180497
197 Ga0070662_100017312
198 Ga0070684_100125059
199 Ga0070684_100438502
200 Ga0070665_100592161
201 Ga0068857_100125058
202 Ga0068857_100854250
203 Ga0068859_100007283
204 Ga0068859_100094704
205 Ga0068864_100001740
206 Ga0068864_100097874
207 Ga0068861_100007610
208 Ga0068861_100070809
209 Ga0068851_10053766
210 Ga0068863_100003685
211 Ga0068858_100006381
212 Ga0068860_100004003
213 Ga0068862_100000543
214 Ga0097620_100007283
215 Ga0097620_100094707
216 Ga0105247_10021599
217 Ga0105243_10861115
218 Ga0105248_10255818
219 Ga0105248_11435235
220 Ga0105249_10015304
221 Ga0105249_10051755
222 Ga0105239_10368916
223 Ga0157370_10044225
224 Ga0157370_11066811
225 Ga0157374_10353612
226 Ga0163162_10008723
227 Ga0163163_10039118
228 Ga0157380_10110417
229 Ga0157379_10154855
230 Ga0209050_1041976
231 Ga0209257_1051714
232 Ga0207697_10000184
233 Ga0207697_10010809
234 Ga0207710_10036440
235 Ga0207645_10306153
236 Ga0207657_10002315
237 Ga0207681_10000008
238 Ga0207681_10007378
239 Ga0207650_10009314
240 Ga0207650_10099256
241 Ga0207659_10012289
242 Ga0207659_10181913
243 Ga0207644_10000006
244 Ga0207644_10371927
245 Ga0207690_10000001
246 Ga0207706_10010340
247 Ga0207691_10005027
248 Ga0207711_10016515
249 Ga0207712_10006483
250 Ga0207712_10009274
251 Ga0207668_10000706
252 Ga0207668_10108065
253 Ga0207668_10244834
254 Ga0207658_10004644
255 Ga0207677_10000176
256 Ga0207703_10007829
257 Ga0207639_10000912
258 Ga0207639_10002373
259 Ga0207678_10664929
260 Ga0207641_10012207
261 Ga0207648_10024705
262 Ga0207676_10003099
263 Ga0207676_10050562
264 Ga0207674_10003071
265 Ga0207674_10526757
266 Ga0207675_100000341
267 Ga0207675_100011433
268 Ga0207683_10552973
269 Ga0268266_10311958
270 Ga0268265_10000433
271 Ga0268264_10000010
272 Ga0307408_100005065
273 Ga0307405_10510307
274 Ga0307413_10099161
275 Ga0307406_10010255
276 Ga0307406_10102148
277 Ga0307406_10323138
278 Ga0307412_10273784
279 Ga0307416_100131021
280 Ga0307416_100159143
281 Ga0307416_100175144
282 Ga0307414_10003057
283 Ga0307414_10276016
284 Ga0307414_10490287
285 Ga0395899_0060087
286 Ga0395899_0070168
287 Ga0395900_0043727
288 Ga0395900_0131328
289 Ga0395900_0166709
290 Ga0395900_0643110
291 Ga0395898_0134773
292 Ga0395905_0002897
293 Ga0395905_0143740
294 Ga0395905_0150219
295 Ga0395901_0036272
296 Ga0395901_0175983
297 Ga0395901_0294741
298 Ga0439464_0130269
299 Ga0466957_0006023
300 Ga0466967_0049348
301 Ga0466967_0965678
302 Ga0495627_000332
303 Ga0495632_0000039
304 Ga0495648_0033329
305 Ga0495663_0000006
306 Ga0495621_0094778
307 Ga0495597_0086446
308 Ga0495633_0000967
309 Ga0495633_0001121
310 Ga0495668_0072491
311 Ga0495659_0010955
312 Ga0495669_0036794
313 Ga0495670_0104086
314 Ga0496109_0037721
315 Ga0496122_0001436
316 Ga0496123_0000521
317 Ga0496126_0098778
318 Ga0501292_000094
319 Ga0501293_000855
320 Ga0501294_001978
321 Ga0501300_000889
322 Ga0501202_025885
323 Ga0501206_000877
324 Ga0501222_000371
325 Ga0501223_001453
326 Ga0501224_000151
327 Ga0501227_004597
328 Ga0501235_003449
329 Ga0501257_000008
330 Ga0501261_000051
331 Ga0501221_004167
332 Ga0501225_0005102
333 Ga0501225_0006637
334 Ga0501225_0117468
335 Ga0501276_009251
336 Ga0501279_000077
337 Ga0501280_000100
338 Ga0501280_005719
339 Ga0501281_00058
340 Ga0501282_000196
341 Ga0501044_0296733
342 Ga0500643_000203
343 Ga0500643_023179
344 Ga0500556_0000013
345 Ga0500618_005929
346 Ga0500642_0000002
347 Ga0500624_000324
348 Ga0500636_0019298
349 Ga0500645_000105
350 2919713335

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02565

RecO_C

Recombination protein O C terminal

127

270

0.93

PF11967

RecO_N

Recombination protein O N terminal

53

121

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3q8d-assembly1.cif.gz_A e. coli reco complex with ssb c-terminus 0.8296 4 233
3q8d-assembly1.cif.gz_A e. coli reco complex with ssb c-terminus 0.8133 4 233
2v1c-assembly1.cif.gz_C-2 crystal structure and mutational study of recor provide insight into its role in dna repair 0.7524 2 231
1h9m-assembly1.cif.gz_A two crystal structures of the cytoplasmic molybdate-binding protein modg suggest a novel cooperative binding mechanism and provide insights into ligand-binding specificity. peg-grown form with molybdate bound 0.7469 3 60
1u5k-assembly1.cif.gz_B recombinational repair protein reco 0.7465 2 231
ID Description Score Start End Superfamily
af_P9WHI5_1_82_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8487 1 79 2.40.50.140
3q8dB01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8338 4 74 2.40.50.140
4jcvF01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8204 3 80 2.40.50.140
af_P9WHI5_1_82_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8117 1 79 2.40.50.140
4jcvF01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7907 3 80 2.40.50.140
ID Description Score Start End GO Terms
AF-A5VEW5-F1-model_v4 DNA repair protein RecO (Recombination protein O) 0.9783 1 243 GO:0006302
GO:0006310
GO:0043590
AF-A0A358PD05-F1-model_v4 DNA repair protein RecO 0.9748 1 74 GO:0006302
GO:0006310
GO:0043590
AF-A5VEW5-F1-model_v4 DNA repair protein RecO (Recombination protein O) 0.9743 1 243 GO:0006302
GO:0006310
GO:0043590
AF-A0A5A7N7C2-F1-model_v4 DNA replication/recombination mediator RecO N-terminal domain-containing protein 0.97 1 125 GO:0006302
GO:0006310
GO:0043590
AF-A0A355BZV3-F1-model_v4 DNA repair protein RecO 0.9652 1 125 GO:0006302
GO:0006310
GO:0043590

Map