F267472

General Info

Members Datasets Scaffolds Average Seq Length
176 144 174 155

Family's Representative Sequence

Representative Sequence 3300003203|JGI25406J46586_10085958|JGI25406J46586_100859581
Length 167
Sequence MPKKAKPIPEGFHSLTPHLVVKGASQAIEFYQKAFGAQENSRNMGPDGKSIMHADLTIGDSHLFIVDEFPAWNSLGPQAIGGTPVSIHIYVDDVDKVFNQAVAAGAQVKMPLTDMFWGDRFGKLTDPFGHEWTVATHIEDVSPEEMMKRAQGAFKEWDSSENPSNRQ

Samples

Sample ID Description Type Environment
1 2791355199
2 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
38 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
42 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
43 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
59 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
62 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
63 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
65 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
93 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
94 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
95 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
96 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
97 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
98 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
99 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
100 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
101 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
102 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
103 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
104 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
105 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
106 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
107 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
108 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
109 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
110 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
111 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
112 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
113 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
114 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
115 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
116 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
117 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
118 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
119 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
120 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
121 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
122 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
123 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
124 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
125 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
126 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
127 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
128 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
129 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
130 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
131 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
132 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
133 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
134 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
135 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
136 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
137 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
138 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
139 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
140 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
141 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
142 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
143 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
144 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.86
Metatranscriptomes 0.57
Isolates 0.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.57
Nodule 0
Rhizoplane 9.66
Rhizosphere 87.5
Stem 0
Stem Tuber 0
Unclassified 2.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10085958 3300003203 Unclassified 956
2 JGI25406J46586_10126374 3300003203 Bacteria 751
3 rootH1_10013015 3300003323 Bacteria 5899
4 JGI25405J52794_10015672 3300003911 Bacteria 1491
5 Ga0070658_10681843 3300005327 Bacteria 892
6 Ga0070683_100111611 3300005329 Bacteria 2579
7 Ga0070683_101965702 3300005329 Bacteria 562
8 Ga0070682_100087140 3300005337 Unclassified 2035
9 Ga0070682_100267686 3300005337 Unclassified 1240
10 Ga0068868_100072501 3300005338 Bacteria 2748
11 Ga0068868_101055686 3300005338 Bacteria 746
12 Ga0070689_101104421 3300005340 Bacteria 709
13 Ga0070674_100421656 3300005356 Bacteria 1095
14 Ga0070659_100232770 3300005366 Unclassified 1523
15 Ga0070667_100059956 3300005367 Unclassified 3220
16 Ga0070713_100069050 3300005436 Bacteria 2979
17 Ga0070710_10211987 3300005437 Bacteria 1228
18 Ga0070701_10366539 3300005438 Bacteria 904
19 Ga0070700_100382647 3300005441 Unclassified 1053
20 Ga0070694_100000511 3300005444 Bacteria 21322
21 Ga0070708_100098684 3300005445 Unclassified 2671
22 Ga0070678_100774946 3300005456 Bacteria 869
23 Ga0070706_100009770 3300005467 Bacteria 8914
24 Ga0070699_100944849 3300005518 Bacteria 790
25 Ga0070697_100008106 3300005536 Bacteria 8195
26 Ga0070697_100830912 3300005536 Bacteria 818
27 Ga0068853_100757986 3300005539 Bacteria 928
28 Ga0070672_100041477 3300005543 Unclassified 3538
29 Ga0070665_100249612 3300005548 Bacteria 1775
30 Ga0070665_100385217 3300005548 Unclassified 1410
31 Ga0070704_100483051 3300005549 Unclassified 1072
32 Ga0068857_100102280 3300005577 Bacteria 2572
33 Ga0070702_100368977 3300005615 Bacteria 1017
34 Ga0068852_100102290 3300005616 Bacteria 2588
35 Ga0068864_100577146 3300005618 Bacteria 1089
36 Ga0068864_100635006 3300005618 Bacteria 1039
37 Ga0068863_100724463 3300005841 Unclassified 989
38 Ga0068858_101285558 3300005842 Unclassified 720
39 Ga0068860_100099522 3300005843 Bacteria 2773
40 Ga0068862_100036266 3300005844 Bacteria 4180
41 Ga0081455_10001309 3300005937 Bacteria 30858
42 Ga0081455_10912000 3300005937 Bacteria 546
43 Ga0081538_10233237 3300005981 Unclassified 717
44 Ga0081539_10006404 3300005985 Bacteria 11319
45 Ga0081539_10042158 3300005985 Bacteria 2661
46 Ga0081539_10209818 3300005985 Unclassified 893
47 Ga0068871_101334570 3300006358 Bacteria 675
48 Ga0068871_101343637 3300006358 Bacteria 673
49 Ga0075428_100015988 3300006844 Bacteria 8300
50 Ga0075428_100455950 3300006844 Bacteria 1369
51 Ga0075430_100355337 3300006846 Bacteria 1210
52 Ga0075431_100182614 3300006847 Bacteria 2153
53 Ga0075433_11388873 3300006852 Unclassified 608
54 Ga0075434_100545685 3300006871 Bacteria 1179
55 Ga0075429_100054510 3300006880 Bacteria 3478
56 Ga0111539_10565428 3300009094 Bacteria 1324
57 Ga0111539_10821057 3300009094 Bacteria 1082
58 Ga0105245_10031689 3300009098 Bacteria 4680
59 Ga0105245_10546990 3300009098 Bacteria 1179
60 Ga0105245_11474213 3300009098 Bacteria 731
61 Ga0105243_11226961 3300009148 Bacteria 764
62 Ga0105241_11407822 3300009174 Bacteria 668
63 Ga0105242_11006315 3300009176 Bacteria 841
64 Ga0105242_12232362 3300009176 Bacteria 593
65 Ga0105238_10125367 3300009551 Bacteria 2547
66 Ga0105249_10073193 3300009553 Bacteria 3170
67 Ga0105249_11596153 3300009553 Unclassified 725
68 Ga0157371_10318999 3300013102 Bacteria 1127
69 Ga0163162_10022056 3300013306 Bacteria 6274
70 Ga0163162_10324355 3300013306 Bacteria 1672
71 Ga0157372_11442405 3300013307 Bacteria 793
72 Ga0157375_10061373 3300013308 Unclassified 3732
73 Ga0157375_11626578 3300013308 Bacteria 764
74 Ga0157375_11807549 3300013308 Bacteria 725
75 Ga0157375_12903356 3300013308 Bacteria 573
76 Ga0163163_10277524 3300014325 Unclassified 1727
77 Ga0163163_10404864 3300014325 Bacteria 1423
78 Ga0157380_10877317 3300014326 Bacteria 921
79 Ga0182008_10002763 3300014497 Bacteria 10880
80 Ga0157379_11134522 3300014968 Bacteria 750
81 Ga0157376_10036419 3300014969 Unclassified 3986
82 Ga0182006_1038197 3300015261 Bacteria 1899
83 Ga0206356_10435222 3300020070 Bacteria 750
84 Ga0213873_10007957 3300021358 Bacteria 2145
85 Ga0207642_10429884 3300025899 Bacteria 796
86 Ga0207688_10573377 3300025901 Unclassified 710
87 Ga0207680_10919230 3300025903 Bacteria 627
88 Ga0207705_10739943 3300025909 Bacteria 764
89 Ga0207654_10028915 3300025911 Bacteria 3027
90 Ga0207657_10199917 3300025919 Bacteria 1608
91 Ga0207649_10640216 3300025920 Bacteria 821
92 Ga0207646_10028192 3300025922 Bacteria 5114
93 Ga0207700_10246086 3300025928 Bacteria 1526
94 Ga0207664_10617660 3300025929 Bacteria 974
95 Ga0207669_10269077 3300025937 Bacteria 1279
96 Ga0207665_10160045 3300025939 Bacteria 1619
97 Ga0207711_11259145 3300025941 Bacteria 681
98 Ga0207651_10802077 3300025960 Bacteria 835
99 Ga0207712_10738066 3300025961 Bacteria 862
100 Ga0207677_10602307 3300026023 Bacteria 964
101 Ga0207708_10236602 3300026075 Bacteria 1468
102 Ga0207702_11375881 3300026078 Bacteria 700
103 Ga0207648_10769778 3300026089 Bacteria 895
104 Ga0207676_11362321 3300026095 Bacteria 705
105 Ga0207674_10081060 3300026116 Bacteria 3247
106 Ga0207674_11110212 3300026116 Bacteria 760
107 Ga0207675_100026638 3300026118 Bacteria 5382
108 Ga0207683_10220043 3300026121 Bacteria 1730
109 Ga0207698_10015496 3300026142 Bacteria 5105
110 Ga0268266_10966337 3300028379 Bacteria 824
111 Ga0268266_11159070 3300028379 Bacteria 748
112 Ga0268265_10189113 3300028380 Bacteria 1776
113 Ga0268264_10177222 3300028381 Bacteria 1933
114 Ga0265327_10163499 3300031251 Bacteria 1027
115 Ga0316576_10119801 3300031727 Bacteria 1976
116 Ga0307415_100946943 3300032126 Bacteria 797
117 Ga0373951_0227900 3300035091 Unclassified 552
118 Ga0373931_0079637 3300035691 Bacteria 1805
119 Ga0373931_0228349 3300035691 Unclassified 1124
120 Ga0373935_0656026 3300035692 Unclassified 770
121 Ga0373937_1219695 3300036401 Bacteria 701
122 Ga0316584_0521272 3300036712 Bacteria 833
123 Ga0373925_0088212 3300037068 Bacteria 2369
124 Ga0436360_0700926 3300039438 Bacteria 760
125 Ga0453683_0006382 3300044673 Bacteria 8096
126 Ga0466960_0548642 3300044901 Unclassified 682
127 Ga0495592_0306485 3300046454 Bacteria 1031
128 Ga0495629_0471881 3300046459 Bacteria 848
129 Ga0495653_0299506 3300046463 Unclassified 1049
130 Ga0495580_0003873 3300046472 Bacteria 12664
131 Ga0495594_0072815 3300046499 Bacteria 1912
132 Ga0495596_0228355 3300046500 Unclassified 723
133 Ga0495628_0262415 3300046516 Bacteria 1287
134 Ga0495630_0394974 3300046517 Bacteria 1059
135 Ga0495640_0534937 3300046533 Unclassified 711
136 Ga0495667_0302557 3300046559 Unclassified 1013
137 Ga0495635_0549183 3300046663 Bacteria 757
138 Ga0495658_0129490 3300046683 Bacteria 1535
139 Ga0495674_0503009 3300047319 Bacteria 969
140 Ga0495680_0175507 3300047322 Bacteria 1550
141 Ga0495684_0170903 3300047471 Unclassified 1617
142 Ga0495684_0265799 3300047471 Bacteria 1243
143 Ga0495602_0255035 3300048088 Bacteria 1305
144 Ga0496100_0031046 3300048903 Bacteria 3318
145 Ga0496101_0063142 3300048904 Bacteria 2695
146 Ga0496102_0000002 3300048905 Bacteria 814588
147 Ga0496103_0000066 3300048906 Bacteria 126247
148 Ga0496103_0201473 3300048906 Bacteria 1280
149 Ga0496104_0055438 3300048907 Bacteria 3748
150 Ga0496104_0712756 3300048907 Bacteria 911
151 Ga0496105_0082790 3300048908 Bacteria 2650
152 Ga0496106_0295693 3300048909 Bacteria 1298
153 Ga0496107_0239186 3300048910 Bacteria 1351
154 Ga0496108_1038103 3300048911 Bacteria 699
155 Ga0496109_0504697 3300048912 Bacteria 1142
156 Ga0496109_0718756 3300048912 Bacteria 936
157 Ga0496110_0397724 3300048913 Bacteria 1256
158 Ga0496114_0036288 3300048917 Bacteria 4074
159 Ga0496114_0648661 3300048917 Bacteria 929
160 Ga0496115_0002469 3300048918 Bacteria 13283
161 Ga0496121_0443846 3300048924 Bacteria 838
162 Ga0501044_0613362 3300049823 Bacteria 980
163 nmdc:mga05p37_321070_c1 3300050507 Bacteria 1833
164 nmdc:mga05p37_804238_c1 3300050507 Bacteria 1028
165 nmdc:mga09592_36273_c1 3300050508 Bacteria 4130
166 nmdc:mga06r32_935328_c1 3300050510 Unclassified 822
167 nmdc:mga08y16_1272123_c1 3300050511 Bacteria 703
168 nmdc:mga08y16_373542_c1 3300050511 Bacteria 1462
169 nmdc:mga0n895_281780_c1 3300050512 Bacteria 1685
170 nmdc:mga0a205_946978_c1 3300050515 Unclassified 708
171 Ga0495601_0127673 3300053077 Bacteria 1655
172 Ga0495595_0183537 3300053084 Bacteria 1038
173 Ga0495619_0357878 3300053085 Bacteria 1009
174 Ga0500568_0103661 3300053139 Bacteria 1066

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005937 Ga0081455_10912000 Ga0081455_109120001 138
2 3300005985 Ga0081539_10209818 Ga0081539_102098182 138
3 3300005444 Ga0070694_100000511 Ga0070694_10000051117 139
4 3300006852 Ga0075433_11388873 Ga0075433_113888731 142
5 3300039438 Ga0436360_0700926 Ga0436360_0700926_26_454 142
6 3300050515 nmdc:mga0a205_946978_c1 nmdc:mga0a205_946978_c1_174_659 142
7 3300003911 JGI25405J52794_10015672 JGI25405J52794_100156721 145
8 3300005937 Ga0081455_10001309 Ga0081455_100013095 145
9 iso_pu_bacteria 2791355199 2793076711 148
10 iso_pu_bacteria 2889033259 2889041061 148
11 3300005841 Ga0068863_100724463 Ga0068863_1007244632 149
12 3300014325 Ga0163163_10277524 Ga0163163_102775242 149
13 3300035091 Ga0373951_0227900 Ga0373951_0227900_18_470 149
14 3300035691 Ga0373931_0228349 Ga0373931_0228349_412_864 149
15 3300005548 Ga0070665_100249612 Ga0070665_1002496121 151
16 3300006844 Ga0075428_100015988 Ga0075428_1000159886 151
17 3300006846 Ga0075430_100355337 Ga0075430_1003553372 151
18 3300021358 Ga0213873_10007957 Ga0213873_100079572 151
19 3300028379 Ga0268266_10966337 Ga0268266_109663371 151
20 3300003323 rootH1_10013015 rootH1_100130156 152
21 3300005577 Ga0068857_100102280 Ga0068857_1001022804 152
22 3300005981 Ga0081538_10233237 Ga0081538_102332371 152
23 3300009551 Ga0105238_10125367 Ga0105238_101253674 152
24 3300020070 Ga0206356_10435222 Ga0206356_104352221 152
25 3300025911 Ga0207654_10028915 Ga0207654_100289154 152
26 3300026078 Ga0207702_11375881 Ga0207702_113758812 152
27 3300026116 Ga0207674_10081060 Ga0207674_100810604 152
28 3300048905 Ga0496102_0000002 Ga0496102_0000002_215440_215898 152
29 3300048906 Ga0496103_0000066 Ga0496103_0000066_116880_117338 152
30 3300048924 Ga0496121_0443846 Ga0496121_0443846_316_777 152
31 3300050507 nmdc:mga05p37_804238_c1 nmdc:mga05p37_804238_c1_158_640 152
32 3300005456 Ga0070678_100774946 Ga0070678_1007749462 153
33 3300006358 Ga0068871_101334570 Ga0068871_1013345702 153
34 3300006844 Ga0075428_100455950 Ga0075428_1004559502 153
35 3300009098 Ga0105245_11474213 Ga0105245_114742131 153
36 3300009553 Ga0105249_11596153 Ga0105249_115961531 153
37 3300013308 Ga0157375_11626578 Ga0157375_116265781 153
38 3300013308 Ga0157375_11807549 Ga0157375_118075491 153
39 3300014326 Ga0157380_10877317 Ga0157380_108773172 153
40 3300028379 Ga0268266_11159070 Ga0268266_111590702 153
41 3300046517 Ga0495630_0394974 Ga0495630_0394974_437_901 153
42 3300046683 Ga0495658_0129490 Ga0495658_0129490_10_477 153
43 3300047322 Ga0495680_0175507 Ga0495680_0175507_704_1168 153
44 3300048907 Ga0496104_0712756 Ga0496104_0712756_426_890 153
45 3300048911 Ga0496108_1038103 Ga0496108_1038103_73_537 153
46 3300049823 Ga0501044_0613362 Ga0501044_0613362_297_761 153
47 3300050507 nmdc:mga05p37_321070_c1 nmdc:mga05p37_321070_c1_587_1072 153
48 3300005327 Ga0070658_10681843 Ga0070658_106818432 154
49 3300005329 Ga0070683_100111611 Ga0070683_1001116112 154
50 3300005337 Ga0070682_100087140 Ga0070682_1000871402 154
51 3300005337 Ga0070682_100267686 Ga0070682_1002676862 154
52 3300005338 Ga0068868_100072501 Ga0068868_1000725013 154
53 3300005338 Ga0068868_101055686 Ga0068868_1010556861 154
54 3300005340 Ga0070689_101104421 Ga0070689_1011044211 154
55 3300005356 Ga0070674_100421656 Ga0070674_1004216562 154
56 3300005366 Ga0070659_100232770 Ga0070659_1002327702 154
57 3300005367 Ga0070667_100059956 Ga0070667_1000599564 154
58 3300005436 Ga0070713_100069050 Ga0070713_1000690504 154
59 3300005437 Ga0070710_10211987 Ga0070710_102119872 154
60 3300005438 Ga0070701_10366539 Ga0070701_103665392 154
61 3300005441 Ga0070700_100382647 Ga0070700_1003826472 154
62 3300005536 Ga0070697_100830912 Ga0070697_1008309122 154
63 3300005539 Ga0068853_100757986 Ga0068853_1007579862 154
64 3300005543 Ga0070672_100041477 Ga0070672_1000414772 154
65 3300005548 Ga0070665_100385217 Ga0070665_1003852172 154
66 3300005615 Ga0070702_100368977 Ga0070702_1003689772 154
67 3300005616 Ga0068852_100102290 Ga0068852_1001022903 154
68 3300005618 Ga0068864_100577146 Ga0068864_1005771461 154
69 3300005618 Ga0068864_100635006 Ga0068864_1006350062 154
70 3300005842 Ga0068858_101285558 Ga0068858_1012855582 154
71 3300005843 Ga0068860_100099522 Ga0068860_1000995225 154
72 3300005844 Ga0068862_100036266 Ga0068862_1000362664 154
73 3300006358 Ga0068871_101343637 Ga0068871_1013436372 154
74 3300006871 Ga0075434_100545685 Ga0075434_1005456852 154
75 3300009094 Ga0111539_10821057 Ga0111539_108210572 154
76 3300009098 Ga0105245_10031689 Ga0105245_100316896 154
77 3300009098 Ga0105245_10546990 Ga0105245_105469902 154
78 3300009148 Ga0105243_11226961 Ga0105243_112269612 154
79 3300009174 Ga0105241_11407822 Ga0105241_114078221 154
80 3300009176 Ga0105242_11006315 Ga0105242_110063151 154
81 3300009176 Ga0105242_12232362 Ga0105242_122323621 154
82 3300009553 Ga0105249_10073193 Ga0105249_100731933 154
83 3300013102 Ga0157371_10318999 Ga0157371_103189992 154
84 3300013306 Ga0163162_10022056 Ga0163162_100220563 154
85 3300013306 Ga0163162_10324355 Ga0163162_103243552 154
86 3300013307 Ga0157372_11442405 Ga0157372_114424051 154
87 3300013308 Ga0157375_10061373 Ga0157375_100613734 154
88 3300014497 Ga0182008_10002763 Ga0182008_1000276310 154
89 3300014968 Ga0157379_11134522 Ga0157379_111345222 154
90 3300014969 Ga0157376_10036419 Ga0157376_100364192 154
91 3300015261 Ga0182006_1038197 Ga0182006_10381972 154
92 3300025899 Ga0207642_10429884 Ga0207642_104298842 154
93 3300025901 Ga0207688_10573377 Ga0207688_105733772 154
94 3300025903 Ga0207680_10919230 Ga0207680_109192302 154
95 3300025909 Ga0207705_10739943 Ga0207705_107399432 154
96 3300025919 Ga0207657_10199917 Ga0207657_101999172 154
97 3300025920 Ga0207649_10640216 Ga0207649_106402161 154
98 3300025928 Ga0207700_10246086 Ga0207700_102460863 154
99 3300025929 Ga0207664_10617660 Ga0207664_106176601 154
100 3300025937 Ga0207669_10269077 Ga0207669_102690772 154
101 3300025939 Ga0207665_10160045 Ga0207665_101600452 154
102 3300025941 Ga0207711_11259145 Ga0207711_112591452 154
103 3300025960 Ga0207651_10802077 Ga0207651_108020772 154
104 3300025961 Ga0207712_10738066 Ga0207712_107380661 154
105 3300026023 Ga0207677_10602307 Ga0207677_106023072 154
106 3300026075 Ga0207708_10236602 Ga0207708_102366022 154
107 3300026089 Ga0207648_10769778 Ga0207648_107697782 154
108 3300026095 Ga0207676_11362321 Ga0207676_113623211 154
109 3300026116 Ga0207674_11110212 Ga0207674_111102122 154
110 3300026118 Ga0207675_100026638 Ga0207675_1000266385 154
111 3300026121 Ga0207683_10220043 Ga0207683_102200432 154
112 3300026142 Ga0207698_10015496 Ga0207698_100154965 154
113 3300028380 Ga0268265_10189113 Ga0268265_101891131 154
114 3300028381 Ga0268264_10177222 Ga0268264_101772223 154
115 3300031251 Ga0265327_10163499 Ga0265327_101634992 154
116 3300032126 Ga0307415_100946943 Ga0307415_1009469432 154
117 3300035691 Ga0373931_0079637 Ga0373931_0079637_1274_1741 154
118 3300036401 Ga0373937_1219695 Ga0373937_1219695_92_559 154
119 3300044901 Ga0466960_0548642 Ga0466960_0548642_53_517 154
120 3300046454 Ga0495592_0306485 Ga0495592_0306485_277_744 154
121 3300046459 Ga0495629_0471881 Ga0495629_0471881_60_527 154
122 3300046463 Ga0495653_0299506 Ga0495653_0299506_289_756 154
123 3300046500 Ga0495596_0228355 Ga0495596_0228355_27_491 154
124 3300046516 Ga0495628_0262415 Ga0495628_0262415_781_1248 154
125 3300046533 Ga0495640_0534937 Ga0495640_0534937_95_562 154
126 3300046559 Ga0495667_0302557 Ga0495667_0302557_311_778 154
127 3300046663 Ga0495635_0549183 Ga0495635_0549183_261_728 154
128 3300047319 Ga0495674_0503009 Ga0495674_0503009_81_548 154
129 3300047471 Ga0495684_0170903 Ga0495684_0170903_774_1241 154
130 3300047471 Ga0495684_0265799 Ga0495684_0265799_142_609 154
131 3300048088 Ga0495602_0255035 Ga0495602_0255035_549_1016 154
132 3300048903 Ga0496100_0031046 Ga0496100_0031046_1875_2342 154
133 3300048904 Ga0496101_0063142 Ga0496101_0063142_446_913 154
134 3300048906 Ga0496103_0201473 Ga0496103_0201473_427_894 154
135 3300048907 Ga0496104_0055438 Ga0496104_0055438_446_913 154
136 3300048908 Ga0496105_0082790 Ga0496105_0082790_755_1222 154
137 3300048909 Ga0496106_0295693 Ga0496106_0295693_249_716 154
138 3300048910 Ga0496107_0239186 Ga0496107_0239186_410_877 154
139 3300048912 Ga0496109_0718756 Ga0496109_0718756_275_742 154
140 3300048913 Ga0496110_0397724 Ga0496110_0397724_36_500 154
141 3300048917 Ga0496114_0036288 Ga0496114_0036288_1674_2141 154
142 3300048917 Ga0496114_0648661 Ga0496114_0648661_124_588 154
143 3300048918 Ga0496115_0002469 Ga0496115_0002469_5647_6114 154
144 3300050511 nmdc:mga08y16_1272123_c1 nmdc:mga08y16_1272123_c1_62_526 154
145 3300050512 nmdc:mga0n895_281780_c1 nmdc:mga0n895_281780_c1_484_951 154
146 3300053077 Ga0495601_0127673 Ga0495601_0127673_775_1242 154
147 3300053084 Ga0495595_0183537 Ga0495595_0183537_346_813 154
148 3300053085 Ga0495619_0357878 Ga0495619_0357878_523_990 154
149 3300053139 Ga0500568_0103661 Ga0500568_0103661_368_832 154
150 3300003203 JGI25406J46586_10126374 JGI25406J46586_101263741 155
151 3300005329 Ga0070683_101965702 Ga0070683_1019657021 155
152 3300005985 Ga0081539_10042158 Ga0081539_100421583 155
153 3300013308 Ga0157375_12903356 Ga0157375_129033561 155
154 3300014325 Ga0163163_10404864 Ga0163163_104048641 155
155 3300048912 Ga0496109_0504697 Ga0496109_0504697_144_614 155
156 3300050510 nmdc:mga06r32_935328_c1 nmdc:mga06r32_935328_c1_238_732 155
157 3300006847 Ga0075431_100182614 Ga0075431_1001826142 156
158 3300006880 Ga0075429_100054510 Ga0075429_1000545102 156
159 3300031727 Ga0316576_10119801 Ga0316576_101198012 156
160 3300036712 Ga0316584_0521272 Ga0316584_0521272_60_551 156
161 3300050508 nmdc:mga09592_36273_c1 nmdc:mga09592_36273_c1_926_1423 156
162 3300005549 Ga0070704_100483051 Ga0070704_1004830512 158
163 3300009094 Ga0111539_10565428 Ga0111539_105654282 158
164 3300050511 nmdc:mga08y16_373542_c1 nmdc:mga08y16_373542_c1_635_1117 158
165 3300005445 Ga0070708_100098684 Ga0070708_1000986842 161
166 3300005467 Ga0070706_100009770 Ga0070706_10000977010 161
167 3300005518 Ga0070699_100944849 Ga0070699_1009448491 161
168 3300005536 Ga0070697_100008106 Ga0070697_1000081067 161
169 3300025922 Ga0207646_10028192 Ga0207646_100281923 161
170 3300035692 Ga0373935_0656026 Ga0373935_0656026_258_746 161
171 3300037068 Ga0373925_0088212 Ga0373925_0088212_1308_1796 161
172 3300046472 Ga0495580_0003873 Ga0495580_0003873_8925_9413 161
173 3300046499 Ga0495594_0072815 Ga0495594_0072815_1341_1829 161
174 3300044673 Ga0453683_0006382 Ga0453683_0006382_417_908 163
175 3300003203 JGI25406J46586_10085958 JGI25406J46586_100859581 167
176 3300005985 Ga0081539_10006404 Ga0081539_100064047 167

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

11

134

0.95

PF18029

Glyoxalase_6

Glyoxalase-like domain

18

135

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
4pav-assembly4.cif.gz_D structure of hypothetical protein sa1046 from s. aureus. 0.8319 13 136
3itw-assembly1.cif.gz_A-2 crystal structure of tiox from micromonospora sp. ml1 0.8156 15 138
1xy7-assembly1.cif.gz_B x-ray structure of gene product from arabidopsis thaliana at5g48480 0.8064 12 135
1fa5-assembly1.cif.gz_B crystal structure of the zn(ii)-bound glyoxalase i of escherichia coli 0.8005 12 136
4pav-assembly4.cif.gz_D structure of hypothetical protein sa1046 from s. aureus. 0.7988 13 136
ID Description Score Start End Superfamily
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9522 84 154 3.30.720.110
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.925 84 154 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8717 83 138 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.858 83 138 3.30.720.110
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8375 85 139 3.30.720.110
ID Description Score Start End GO Terms
AF-A0A7W1CUC1-F1-model_v4 VOC family protein 0.9876 89 154
AF-A0A5C6BDK7-F1-model_v4 VOC domain-containing protein 0.9845 5 149
AF-A0A4Q7JG45-F1-model_v4 VOC family protein 0.9839 12 156
AF-A0A2S9FKJ5-F1-model_v4 Glyoxalase 0.983 87 156
AF-A0A1I3XZE8-F1-model_v4 Uncharacterized conserved protein PhnB, glyoxalase superfamily 0.9827 1 155

Feature Viewer

pLDDT pTM Quality
92 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map