F268028

General Info

Members Datasets Scaffolds Average Seq Length
176 127 163 406

Family's Representative Sequence

Representative Sequence 3300006028|Ga0070717_10005819|Ga0070717_100058196
Length 472
Sequence MSTPPTNNPQTQTEASPPPQTGGCPFKHPAEIPAAPAGCPVLERDNPAFLQNAHHTYAMLREQGPVVRAPFAQTPLDGVRQDSRAPKQTGVVNQRLFVTRYDEAVEALLDERLSSDFRKGLPPEQRERLAYMPEEAKPLAYSLIMRDAPEHTRLRKLVQPSFTARAMEALRPSIQKITDALLDRAERDAAERGETGPNRRMNLVKAFAHPLPVTVISEMLGIPKEDQAQISAEADRLMNDESLGRDEKRRERFRAFSHYMEQLFERKRQAPGDDMISQMLMTAEDGDKLSHDEMMSMVFLLFFAGHITTVNLIGSGVVALLTHPEQHAKMIADPTLAKGLVEETLRYWGPVDFMGTARLVTDDVKLGETPIAKGELVMIGLASANRDPEKFPNPDAFDITRPEAHRNIAFGKGIHVCLGAPLARLEGQIAFETLFRRYPQMRLAVPVEELKWGVGAGSGAGLRGFSQIPVFF

Samples

Sample ID Description Type Environment
1 2512564039 Paenibacillus mucilaginosus 3016 Isolate Rhizosphere
2 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
3 2558860280 Kutzneria sp. 744 Isolate Unclassified
4 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
5 2671180531 Gemmata sp. SH-PL17 Isolate Unclassified
6 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
7 2818991441 Niallia circulans 3243 Isolate Rhizosphere
8 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
9 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
10 2936361878 Neobacillus endophyticus BRMEA1 Isolate Unclassified
11 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
12 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
31 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
32 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
33 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
34 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
43 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
44 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
45 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
46 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
58 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
59 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
60 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
61 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
62 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
63 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
64 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
65 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
66 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
67 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
68 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
69 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
70 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
71 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
72 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
73 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
74 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
75 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
76 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
77 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
78 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
79 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
80 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
81 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
82 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
83 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
84 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
85 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
86 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
87 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
88 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
89 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
90 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
91 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
92 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
93 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
94 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
95 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
96 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
97 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
98 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
99 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
100 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
101 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
102 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
103 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
104 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
105 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
106 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
107 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
108 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
109 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
110 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
111 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
112 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
113 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
114 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
115 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
116 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
117 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
118 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
119 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
120 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
121 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
122 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
123 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
124 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
125 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
126 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
127 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.61
Metatranscriptomes 0
Isolates 7.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.7
Nodule 0
Rhizoplane 1.7
Rhizosphere 82.95
Stem 0
Stem Tuber 0
Unclassified 13.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10001780 3300003320 Bacteria 64551
2 Ga0065707_10002683 3300005295 Bacteria 4673
3 Ga0065707_10095494 3300005295 Bacteria 3360
4 Ga0070689_100139214 3300005340 Bacteria 1951
5 Ga0070709_10235290 3300005434 Bacteria 1313
6 Ga0070714_100164917 3300005435 Bacteria 2007
7 Ga0070706_100000901 3300005467 Bacteria 32562
8 Ga0070706_100007062 3300005467 Bacteria 10576
9 Ga0070707_100000971 3300005468 Bacteria 28355
10 Ga0070707_100227889 3300005468 Unclassified 1814
11 Ga0070698_100288982 3300005471 Unclassified 1571
12 Ga0070699_100002137 3300005518 Bacteria 17924
13 Ga0070679_100037069 3300005530 Bacteria 4841
14 Ga0070697_100072799 3300005536 Bacteria 2820
15 Ga0070697_100080859 3300005536 Bacteria 2677
16 Ga0068853_100013171 3300005539 Bacteria 6749
17 Ga0068853_100115100 3300005539 Bacteria 2393
18 Ga0070696_100032976 3300005546 Bacteria 3556
19 Ga0070664_100087491 3300005564 Bacteria 2694
20 Ga0068857_100022222 3300005577 Bacteria 5581
21 Ga0081455_10002324 3300005937 Bacteria 22682
22 Ga0081539_10003612 3300005985 Bacteria 18689
23 Ga0070717_10005819 3300006028 Bacteria 9030
24 Ga0075365_10041297 3300006038 Bacteria 3013
25 Ga0070712_100005207 3300006175 Bacteria 8044
26 Ga0070712_100097096 3300006175 Bacteria 2171
27 Ga0075430_100000174 3300006846 Bacteria 42563
28 Ga0075431_100038724 3300006847 Bacteria 4911
29 Ga0075433_10002507 3300006852 Bacteria 13968
30 Ga0105240_10084457 3300009093 Bacteria 3893
31 Ga0111539_10369945 3300009094 Bacteria 1668
32 Ga0114129_10001962 3300009147 Bacteria 28150
33 Ga0114129_10079679 3300009147 Unclassified 4553
34 Ga0105237_10090631 3300009545 Bacteria 3046
35 Ga0105237_10163587 3300009545 Bacteria 2224
36 Ga0105237_10178460 3300009545 Bacteria 2124
37 Ga0105238_10022061 3300009551 Bacteria 6490
38 Ga0105238_10078333 3300009551 Bacteria 3295
39 Ga0105249_10031815 3300009553 Bacteria 4772
40 Ga0105239_10456461 3300010375 Bacteria 1450
41 Ga0213873_10000033 3300021358 Bacteria 36320
42 Ga0213876_10004164 3300021384 Bacteria 8113
43 Ga0213876_10011812 3300021384 Bacteria 4657
44 Ga0213876_10074420 3300021384 Bacteria 1794
45 Ga0213875_10000881 3300021388 Bacteria 22029
46 Ga0213875_10051269 3300021388 Bacteria 1933
47 Ga0209566_100054 3300025225 Bacteria 221422
48 Ga0207684_10000298 3300025910 Bacteria 71028
49 Ga0207684_10004685 3300025910 Bacteria 12844
50 Ga0207695_10126206 3300025913 Bacteria 2520
51 Ga0207671_10056673 3300025914 Bacteria 2904
52 Ga0207693_10011048 3300025915 Bacteria 7317
53 Ga0207693_10105230 3300025915 Bacteria 2213
54 Ga0207693_10192824 3300025915 Bacteria 1603
55 Ga0207663_10103318 3300025916 Bacteria 1919
56 Ga0207646_10003916 3300025922 Bacteria 16531
57 Ga0207681_10077593 3300025923 Bacteria 2336
58 Ga0207700_10042643 3300025928 Bacteria 3328
59 Ga0207700_10166855 3300025928 Bacteria 1833
60 Ga0207664_10029842 3300025929 Bacteria 4159
61 Ga0207712_10017497 3300025961 Bacteria 4656
62 Ga0207712_10075550 3300025961 Bacteria 2436
63 Ga0207639_10088269 3300026041 Bacteria 2474
64 Ga0265337_1001491 3300028556 Bacteria 11472
65 Ga0265326_10000845 3300028558 Bacteria 11214
66 Ga0265319_1001683 3300028563 Bacteria 12776
67 Ga0265334_10000121 3300028573 Bacteria 50668
68 Ga0265323_10001684 3300028653 Bacteria 10561
69 Ga0265322_10030588 3300028654 Bacteria 1537
70 Ga0265336_10001936 3300028666 Bacteria 8903
71 Ga0265338_10000059 3300028800 Bacteria 198047
72 Ga0265338_10027480 3300028800 Bacteria 5707
73 Ga0265324_10004673 3300029957 Bacteria 6094
74 Ga0307511_10000324 3300030521 Bacteria 50832
75 Ga0265332_10004871 3300031238 Bacteria 6241
76 Ga0265320_10005653 3300031240 Bacteria 7982
77 Ga0265325_10002259 3300031241 Bacteria 13056
78 Ga0265340_10006472 3300031247 Bacteria 6445
79 Ga0265316_10020883 3300031344 Bacteria 5562
80 Ga0307408_100071268 3300031548 Bacteria 2569
81 Ga0265313_10004322 3300031595 Bacteria 10996
82 Ga0265314_10013406 3300031711 Bacteria 6621
83 Ga0307405_10001195 3300031731 Bacteria 10738
84 Ga0307410_10014901 3300031852 Bacteria 4593
85 Ga0307406_10009320 3300031901 Bacteria 5501
86 Ga0307412_10051973 3300031911 Bacteria 2711
87 Ga0307412_10071045 3300031911 Bacteria 2375
88 Ga0307409_100010943 3300031995 Bacteria 5681
89 Ga0307416_100000750 3300032002 Bacteria 16983
90 Ga0307411_10004850 3300032005 Bacteria 6527
91 Ga0307415_100001242 3300032126 Bacteria 11971
92 Ga0307415_100003829 3300032126 Bacteria 7717
93 Ga0307415_100036275 3300032126 Bacteria 3229
94 Ga0373933_0005145 3300035724 Bacteria 7136
95 Ga0373933_0051643 3300035724 Bacteria 2458
96 Ga0373925_0009041 3300037068 Bacteria 7253
97 Ga0395900_0211597 3300037418 Bacteria 1958
98 Ga0395898_0301003 3300037466 Bacteria 1530
99 Ga0436364_0425205 3300037853 Bacteria 2412
100 Ga0436364_0648810 3300037853 Bacteria 14607
101 Ga0436364_1118079 3300037853 Bacteria 3513
102 Ga0436364_1501980 3300037853 Bacteria 10566
103 Ga0436364_1554164 3300037853 Bacteria 24981
104 Ga0436365_0034724 3300039437 Bacteria 1879
105 Ga0436365_0589592 3300039437 Bacteria 1898
106 Ga0436365_0995223 3300039437 Bacteria 4657
107 Ga0436365_1036137 3300039437 Bacteria 1982
108 Ga0436365_1287264 3300039437 Bacteria 15595
109 Ga0436362_0551347 3300039453 Bacteria 47047
110 Ga0466969_0002301 3300044656 Bacteria 10198
111 Ga0466969_0012020 3300044656 Bacteria 4575
112 Ga0466969_0077905 3300044656 Bacteria 1585
113 Ga0466972_0009052 3300044658 Bacteria 4999
114 Ga0466972_0027272 3300044658 Bacteria 2827
115 Ga0466972_0070215 3300044658 Bacteria 1671
116 Ga0466966_0000466 3300044684 Bacteria 25968
117 Ga0466966_0004002 3300044684 Bacteria 9734
118 Ga0466966_0100284 3300044684 Bacteria 1791
119 Ga0466961_0001382 3300044693 Bacteria 14995
120 Ga0466961_0044870 3300044693 Bacteria 2828
121 Ga0466961_0065493 3300044693 Bacteria 2309
122 Ga0466963_0006864 3300044694 Bacteria 6772
123 Ga0466968_0017805 3300044735 Bacteria 2845
124 Ga0466968_0052885 3300044735 Bacteria 1738
125 Ga0466970_0009054 3300044765 Bacteria 5025
126 Ga0466970_0031996 3300044765 Bacteria 2779
127 Ga0466970_0035270 3300044765 Bacteria 2650
128 Ga0466957_0075174 3300044842 Bacteria 2096
129 Ga0466960_0059249 3300044901 Bacteria 1872
130 Ga0466959_0000691 3300045049 Bacteria 19715
131 Ga0466959_0001964 3300045049 Bacteria 12968
132 Ga0466959_0051785 3300045049 Bacteria 3009
133 Ga0466959_0100755 3300045049 Unclassified 2067
134 Ga0466959_0137288 3300045049 Bacteria 1730
135 Ga0466967_0050330 3300045976 Bacteria 3648
136 Ga0466967_0217704 3300045976 Bacteria 1813
137 Ga0495650_0040900 3300046471 Bacteria 1986
138 Ga0495585_0100799 3300046492 Bacteria 1545
139 Ga0495606_0001048 3300046507 Bacteria 39899
140 Ga0495631_0116897 3300046518 Bacteria 1147
141 Ga0495668_0000246 3300046616 Bacteria 77015
142 Ga0495625_0002894 3300046660 Bacteria 17930
143 Ga0495636_0005664 3300047318 Bacteria 4898
144 Ga0495626_0000124 3300048091 Bacteria 99577
145 Ga0496101_0010931 3300048904 Bacteria 6009
146 Ga0496106_0014308 3300048909 Bacteria 5863
147 Ga0496108_0000379 3300048911 Bacteria 37030
148 Ga0496119_0028886 3300048922 Bacteria 3774
149 Ga0496126_0012943 3300048929 Bacteria 8518
150 Ga0501067_0098610 3300049583 Bacteria 1623
151 Ga0501072_0008427 3300049588 Bacteria 7824
152 Ga0501072_0021714 3300049588 Bacteria 4979
153 Ga0501075_0265428 3300049591 Bacteria 1308
154 Ga0501076_0105257 3300049592 Bacteria 2277
155 Ga0501080_0261861 3300049742 Bacteria 1575
156 Ga0501083_0008233 3300049744 Bacteria 7372
157 nmdc:mga05p37_41098_c1 3300050507 Bacteria 5678
158 nmdc:mga0qj67_9937_c1 3300050509 Bacteria 7097
159 nmdc:mga06r32_5688_c1 3300050510 Bacteria 11222
160 nmdc:mga0n895_47623_c1 3300050512 Bacteria 4192
161 nmdc:mga0a205_3577_c1 3300050515 Bacteria 5666
162 Ga0500646_0000403 3300053090 Bacteria 12818
163 Ga0466962_0018926 3300061719 Bacteria 3309

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046492 Ga0495585_0100799 Ga0495585_0100799_487_1533 341
2 3300025915 Ga0207693_10192824 Ga0207693_101928242 357
3 3300046518 Ga0495631_0116897 Ga0495631_0116897_16_1137 360
4 3300037466 Ga0395898_0301003 Ga0395898_0301003_300_1442 365
5 3300009545 Ga0105237_10178460 Ga0105237_101784602 374
6 iso_pu_bacteria 2558860280 2559431597 376
7 iso_pu_bacteria 2887478801 2887480813 376
8 3300005536 Ga0070697_100072799 Ga0070697_1000727993 377
9 3300039437 Ga0436365_0589592 Ga0436365_0589592_710_1888 380
10 3300044656 Ga0466969_0002301 Ga0466969_0002301_8392_9573 380
11 3300044684 Ga0466966_0004002 Ga0466966_0004002_3863_5044 380
12 3300044693 Ga0466961_0044870 Ga0466961_0044870_1243_2424 380
13 3300044765 Ga0466970_0031996 Ga0466970_0031996_526_1707 380
14 3300045049 Ga0466959_0001964 Ga0466959_0001964_7868_9049 380
15 3300046507 Ga0495606_0001048 Ga0495606_0001048_1660_2841 380
16 3300046616 Ga0495668_0000246 Ga0495668_0000246_72931_74112 380
17 3300046660 Ga0495625_0002894 Ga0495625_0002894_6507_7688 380
18 3300048091 Ga0495626_0000124 Ga0495626_0000124_91868_93049 380
19 3300061719 Ga0466962_0018926 Ga0466962_0018926_793_1974 380
20 3300005434 Ga0070709_10235290 Ga0070709_102352901 381
21 3300037853 Ga0436364_1118079 Ga0436364_1118079_1430_2611 381
22 3300021384 Ga0213876_10004164 Ga0213876_100041646 382
23 3300037853 Ga0436364_0425205 Ga0436364_0425205_398_1582 382
24 3300039437 Ga0436365_1287264 Ga0436365_1287264_4107_5291 382
25 3300005539 Ga0068853_100013171 Ga0068853_1000131715 383
26 3300006175 Ga0070712_100097096 Ga0070712_1000970962 383
27 3300009551 Ga0105238_10078333 Ga0105238_100783334 383
28 3300021388 Ga0213875_10000881 Ga0213875_1000088118 384
29 3300037853 Ga0436364_0648810 Ga0436364_0648810_11042_12232 384
30 3300037853 Ga0436364_1554164 Ga0436364_1554164_18067_19260 384
31 3300005539 Ga0068853_100115100 Ga0068853_1001151002 385
32 3300009093 Ga0105240_10084457 Ga0105240_100844572 385
33 3300009545 Ga0105237_10163587 Ga0105237_101635872 385
34 3300025225 Ga0209566_100054 Ga0209566_100054172 385
35 3300026041 Ga0207639_10088269 Ga0207639_100882692 385
36 3300005435 Ga0070714_100164917 Ga0070714_1001649171 386
37 3300025928 Ga0207700_10042643 Ga0207700_100426432 386
38 3300025929 Ga0207664_10029842 Ga0207664_100298422 386
39 3300048929 Ga0496126_0012943 Ga0496126_0012943_3534_4775 386
40 iso_pu_bacteria 2816332139 2816511384 386
41 iso_pu_bacteria 2936361878 2936366528 386
42 3300005564 Ga0070664_100087491 Ga0070664_1000874913 387
43 3300025915 Ga0207693_10105230 Ga0207693_101052302 387
44 3300025928 Ga0207700_10166855 Ga0207700_101668552 387
45 3300028556 Ga0265337_1001491 Ga0265337_10014916 387
46 3300028558 Ga0265326_10000845 Ga0265326_100008458 387
47 3300028563 Ga0265319_1001683 Ga0265319_10016836 387
48 3300028573 Ga0265334_10000121 Ga0265334_1000012118 387
49 3300028653 Ga0265323_10001684 Ga0265323_100016842 387
50 3300028666 Ga0265336_10001936 Ga0265336_100019366 387
51 3300028800 Ga0265338_10000059 Ga0265338_10000059156 387
52 3300029957 Ga0265324_10004673 Ga0265324_100046733 387
53 3300031238 Ga0265332_10004871 Ga0265332_100048715 387
54 3300031240 Ga0265320_10005653 Ga0265320_100056536 387
55 3300031241 Ga0265325_10002259 Ga0265325_100022596 387
56 3300031247 Ga0265340_10006472 Ga0265340_100064723 387
57 3300031344 Ga0265316_10020883 Ga0265316_100208832 387
58 3300031595 Ga0265313_10004322 Ga0265313_100043226 387
59 3300031711 Ga0265314_10013406 Ga0265314_100134064 387
60 3300048922 Ga0496119_0028886 Ga0496119_0028886_282_1493 387
61 iso_pu_bacteria 2558860280 2559429884 387
62 iso_pu_bacteria 2671180531 2673168551 387
63 3300005468 Ga0070707_100227889 Ga0070707_1002278891 388
64 3300005536 Ga0070697_100080859 Ga0070697_1000808591 388
65 3300009147 Ga0114129_10079679 Ga0114129_100796793 388
66 3300028654 Ga0265322_10030588 Ga0265322_100305882 388
67 3300028800 Ga0265338_10027480 Ga0265338_100274802 388
68 3300045976 Ga0466967_0050330 Ga0466967_0050330_1604_2818 388
69 iso_pu_bacteria 2515154155 2515855018 388
70 3300031548 Ga0307408_100071268 Ga0307408_1000712682 389
71 3300031731 Ga0307405_10001195 Ga0307405_100011954 389
72 3300031852 Ga0307410_10014901 Ga0307410_100149012 389
73 3300031901 Ga0307406_10009320 Ga0307406_100093203 389
74 3300031911 Ga0307412_10051973 Ga0307412_100519732 389
75 3300031995 Ga0307409_100010943 Ga0307409_1000109433 389
76 3300032002 Ga0307416_100000750 Ga0307416_1000007509 389
77 3300032005 Ga0307411_10004850 Ga0307411_100048502 389
78 3300032126 Ga0307415_100001242 Ga0307415_1000012423 389
79 3300032126 Ga0307415_100036275 Ga0307415_1000362754 389
80 iso_pu_bacteria 2818991441 2819567038 389
81 3300039437 Ga0436365_0034724 Ga0436365_0034724_273_1481 390
82 3300006852 Ga0075433_10002507 Ga0075433_1000250711 391
83 3300009551 Ga0105238_10022061 Ga0105238_100220612 391
84 3300021384 Ga0213876_10011812 Ga0213876_100118121 391
85 3300030521 Ga0307511_10000324 Ga0307511_100003243 391
86 3300037068 Ga0373925_0009041 Ga0373925_0009041_243_1457 391
87 3300039437 Ga0436365_0995223 Ga0436365_0995223_3114_4337 391
88 3300044656 Ga0466969_0012020 Ga0466969_0012020_2360_3574 391
89 3300044656 Ga0466969_0077905 Ga0466969_0077905_191_1405 391
90 3300044684 Ga0466966_0000466 Ga0466966_0000466_12627_13841 391
91 3300044684 Ga0466966_0100284 Ga0466966_0100284_174_1388 391
92 3300044693 Ga0466961_0001382 Ga0466961_0001382_5372_6586 391
93 3300044693 Ga0466961_0065493 Ga0466961_0065493_547_1761 391
94 3300044765 Ga0466970_0035270 Ga0466970_0035270_325_1539 391
95 3300045049 Ga0466959_0000691 Ga0466959_0000691_16589_17803 391
96 3300048911 Ga0496108_0000379 Ga0496108_0000379_24003_25214 391
97 3300050515 nmdc:mga0a205_3577_c1 nmdc:mga0a205_3577_c1_4212_5423 391
98 iso_pu_bacteria 2512564039 2512733767 391
99 iso_pu_bacteria 2616644941 2616906254 391
100 iso_pu_bacteria 2912715099 2912715323 391
101 iso_pu_bacteria 3006493962 3006500427 391
102 iso_pu_bacteria 8008574985 8008575240 391
103 3300009094 Ga0111539_10369945 Ga0111539_103699452 392
104 3300010375 Ga0105239_10456461 Ga0105239_104564611 392
105 3300025923 Ga0207681_10077593 Ga0207681_100775931 392
106 3300025961 Ga0207712_10075550 Ga0207712_100755502 392
107 3300039437 Ga0436365_1036137 Ga0436365_1036137_16_1254 392
108 3300050512 nmdc:mga0n895_47623_c1 nmdc:mga0n895_47623_c1_582_1781 392
109 3300005467 Ga0070706_100007062 Ga0070706_1000070622 393
110 3300005468 Ga0070707_100000971 Ga0070707_10000097113 393
111 3300006846 Ga0075430_100000174 Ga0075430_10000017437 393
112 3300006847 Ga0075431_100038724 Ga0075431_1000387243 393
113 3300009147 Ga0114129_10001962 Ga0114129_100019624 393
114 3300025910 Ga0207684_10004685 Ga0207684_100046858 393
115 3300025922 Ga0207646_10003916 Ga0207646_100039167 393
116 3300035724 Ga0373933_0051643 Ga0373933_0051643_896_2116 393
117 3300048904 Ga0496101_0010931 Ga0496101_0010931_241_1464 393
118 3300048909 Ga0496106_0014308 Ga0496106_0014308_2258_3481 393
119 3300049588 Ga0501072_0021714 Ga0501072_0021714_230_1432 393
120 3300049591 Ga0501075_0265428 Ga0501075_0265428_32_1234 393
121 3300049592 Ga0501076_0105257 Ga0501076_0105257_258_1460 393
122 3300049742 Ga0501080_0261861 Ga0501080_0261861_112_1314 393
123 3300050507 nmdc:mga05p37_41098_c1 nmdc:mga05p37_41098_c1_1081_2283 393
124 3300050509 nmdc:mga0qj67_9937_c1 nmdc:mga0qj67_9937_c1_2164_3366 393
125 3300050510 nmdc:mga06r32_5688_c1 nmdc:mga06r32_5688_c1_7031_8233 393
126 3300005546 Ga0070696_100032976 Ga0070696_1000329762 394
127 3300044658 Ga0466972_0009052 Ga0466972_0009052_3676_4923 394
128 3300045049 Ga0466959_0100755 Ga0466959_0100755_705_1952 394
129 3300053090 Ga0500646_0000403 Ga0500646_0000403_1018_2253 394
130 3300046471 Ga0495650_0040900 Ga0495650_0040900_407_1633 395
131 3300044658 Ga0466972_0027272 Ga0466972_0027272_1421_2758 396
132 3300005295 Ga0065707_10002683 Ga0065707_100026832 397
133 3300005295 Ga0065707_10095494 Ga0065707_100954942 397
134 3300005340 Ga0070689_100139214 Ga0070689_1001392142 397
135 3300005471 Ga0070698_100288982 Ga0070698_1002889822 397
136 3300005518 Ga0070699_100002137 Ga0070699_1000021378 397
137 3300005985 Ga0081539_10003612 Ga0081539_100036127 397
138 3300006175 Ga0070712_100005207 Ga0070712_1000052076 397
139 3300009545 Ga0105237_10090631 Ga0105237_100906312 397
140 3300009553 Ga0105249_10031815 Ga0105249_100318154 397
141 3300021384 Ga0213876_10074420 Ga0213876_100744202 397
142 3300025915 Ga0207693_10011048 Ga0207693_100110486 397
143 3300025916 Ga0207663_10103318 Ga0207663_101033182 397
144 3300025961 Ga0207712_10017497 Ga0207712_100174972 397
145 3300005467 Ga0070706_100000901 Ga0070706_10000090123 398
146 3300025910 Ga0207684_10000298 Ga0207684_1000029842 398
147 3300044658 Ga0466972_0070215 Ga0466972_0070215_299_1567 398
148 3300044694 Ga0466963_0006864 Ga0466963_0006864_4076_5314 398
149 3300044735 Ga0466968_0052885 Ga0466968_0052885_72_1340 398
150 3300044765 Ga0466970_0009054 Ga0466970_0009054_3280_4518 398
151 3300044842 Ga0466957_0075174 Ga0466957_0075174_149_1387 398
152 3300044901 Ga0466960_0059249 Ga0466960_0059249_535_1803 398
153 3300045976 Ga0466967_0217704 Ga0466967_0217704_224_1462 398
154 3300035724 Ga0373933_0005145 Ga0373933_0005145_4847_6091 399
155 3300005577 Ga0068857_100022222 Ga0068857_1000222223 400
156 3300044735 Ga0466968_0017805 Ga0466968_0017805_320_1558 400
157 3300045049 Ga0466959_0137288 Ga0466959_0137288_366_1604 400
158 3300025913 Ga0207695_10126206 Ga0207695_101262063 401
159 3300025914 Ga0207671_10056673 Ga0207671_100566733 401
160 3300037418 Ga0395900_0211597 Ga0395900_0211597_248_1543 401
161 3300005937 Ga0081455_10002324 Ga0081455_100023249 403
162 3300031911 Ga0307412_10071045 Ga0307412_100710452 403
163 3300047318 Ga0495636_0005664 Ga0495636_0005664_2487_3848 403
164 3300032126 Ga0307415_100003829 Ga0307415_1000038296 404
165 3300006028 Ga0070717_10005819 Ga0070717_100058196 405
166 3300021358 Ga0213873_10000033 Ga0213873_1000003329 405
167 3300039453 Ga0436362_0551347 Ga0436362_0551347_41432_42679 405
168 3300049583 Ga0501067_0098610 Ga0501067_0098610_299_1546 405
169 3300049588 Ga0501072_0008427 Ga0501072_0008427_5471_6718 405
170 3300049744 Ga0501083_0008233 Ga0501083_0008233_5670_6917 405
171 3300021388 Ga0213875_10051269 Ga0213875_100512692 407
172 3300037853 Ga0436364_1501980 Ga0436364_1501980_8707_9960 407
173 3300045049 Ga0466959_0051785 Ga0466959_0051785_446_1699 407
174 3300006038 Ga0075365_10041297 Ga0075365_100412972 408
175 3300005530 Ga0070679_100037069 Ga0070679_1000370692 410
176 3300003320 rootH2_10001780 rootH2_1000178035 420

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00067

p450

Cytochrome P450

117

443

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
5l94-assembly2.cif.gz_B the 2.25 a crystal structure of cyp109e1 from bacillus megaterium in complex with testosterone 0.956 30 413
5l94-assembly2.cif.gz_B the 2.25 a crystal structure of cyp109e1 from bacillus megaterium in complex with testosterone 0.9456 30 413
5l92-assembly2.cif.gz_B the 2.1 a crystal structure of cyp109e1 from bacillus megaterium in complex with corticosterone 0.9433 26 413
3ejd-assembly4.cif.gz_H crystal structure of p450bioi in complex with hexadec-9z-enoic acid ligated acyl carrier protein 0.941 24 413
3eje-assembly1.cif.gz_B crystal structure of p450bioi in complex with octadec-9z-enoic acid ligated acyl carrier protein 0.9408 26 414
ID Description Score Start End Superfamily
5l92B00 Mainly Alpha;Orthogonal Bundle;Cytochrome p450;Cytochrome P450 0.9433 26 413 1.10.630.10
5l92B00 Mainly Alpha;Orthogonal Bundle;Cytochrome p450;Cytochrome P450 0.9334 26 413 1.10.630.10
3ejbD02 Mainly Alpha;Orthogonal Bundle;Cytochrome p450;Cytochrome P450 0.9301 91 414 1.10.630.10
5ofqD00 Mainly Alpha;Orthogonal Bundle;Cytochrome p450;Cytochrome P450 0.9249 15 414 1.10.630.10
4rm4A00 Mainly Alpha;Orthogonal Bundle;Cytochrome p450;Cytochrome P450 0.9243 30 413 1.10.630.10
ID Description Score Start End GO Terms
AF-A0A4Q3SS38-F1-model_v4 Cytochrome P450 0.9697 247 412 GO:0004497
GO:0005506
GO:0016705
GO:0020037
AF-A0A534PBB6-F1-model_v4 Cytochrome P450 0.9601 240 413 GO:0004497
GO:0005506
GO:0016705
GO:0020037
AF-A0A535GC31-F1-model_v4 Cytochrome P450 0.9598 255 414 GO:0004497
GO:0005506
GO:0016705
GO:0020037
AF-A0A4Q3SS38-F1-model_v4 Cytochrome P450 0.9584 247 412 GO:0004497
GO:0005506
GO:0016705
GO:0020037
AF-A0A2D4WK97-F1-model_v4 Cytochrome P450 0.9576 130 415 GO:0004497
GO:0005506
GO:0016705
GO:0020037

Feature Viewer

pLDDT pTM Quality
88.15 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map