F268281

General Info

Members Datasets Scaffolds Average Seq Length
176 115 176 264

Family's Representative Sequence

Representative Sequence 3300013102|Ga0157371_10041600|Ga0157371_100416003
Length 269
Sequence MDLHPYWHKQTPEKPLYPDIEWSKPEQRALRGKLGIIGGNKLGFAGVAESYSTALASGVGEVRILLPDILKKTVPPSITEAIFGASNPAGGLAKDARIEMLALGQWANGILFAGDAGRNSETAILYEDFLADYRGPLTITRDAIDLIKNSPQALAERPNTLLVMSFAQLQKLFQSVYYPKILTFSMQLASLVEALHKFTITYPITIAVLHKDYLLVASGGEVTSTEWQNPMAIWRGSVATKAAAYWLWTPSKPLEAVTASFIMSGAKEL

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
16 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
17 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
18 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
19 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
20 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
21 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
22 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
23 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
24 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
25 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
26 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
27 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
28 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
29 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
30 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
33 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
34 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
35 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
36 3300009984 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG Metagenome Rhizosphere
37 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
38 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
39 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
40 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
44 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
45 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
46 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
47 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
63 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
64 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
65 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
66 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
67 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
68 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
69 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
70 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
71 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
72 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
73 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
74 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
75 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
76 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
77 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
78 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
79 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
80 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
81 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
82 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
83 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
84 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
85 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
86 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
87 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
88 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
89 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
90 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
91 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
93 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
94 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
95 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
96 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
97 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
98 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
99 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
100 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
101 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
102 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
103 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
104 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
105 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
106 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
107 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
108 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
109 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
110 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
111 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
112 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
113 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
114 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
115 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 26.7
Nodule 0
Rhizoplane 1.14
Rhizosphere 69.32
Stem 0
Stem Tuber 0
Unclassified 2.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10006929 3300001979 Bacteria 4653
2 JGI24740J21852_10049287 3300001979 Unclassified 1218
3 JGI24739J22299_10010492 3300001989 Bacteria 3440
4 JGI24735J21928_10000054 3300002067 Bacteria 49038
5 JGI24735J21928_10047169 3300002067 Bacteria 1249
6 JGI24738J21930_10001831 3300002075 Bacteria 5761
7 rootH2_10000659 3300003320 Bacteria 146718
8 rootL2_10049622 3300003322 Bacteria 8823
9 rootL2_10286456 3300003322 Bacteria 2071
10 rootH1_10000983 3300003323 Bacteria 67573
11 Ga0065715_10006403 3300005293 Bacteria 3638
12 Ga0070658_10000063 3300005327 Bacteria 107300
13 Ga0070683_100126289 3300005329 Bacteria 2418
14 Ga0070660_100000896 3300005339 Bacteria 19910
15 Ga0070660_100010908 3300005339 Bacteria 6433
16 Ga0070661_100066411 3300005344 Bacteria 2650
17 Ga0070659_100041195 3300005366 Bacteria 3609
18 Ga0070684_100094482 3300005535 Unclassified 2663
19 Ga0068855_100000050 3300005563 Bacteria 143762
20 Ga0068855_100027430 3300005563 Bacteria 6813
21 Ga0070664_100000051 3300005564 Bacteria 70646
22 Ga0070664_100727497 3300005564 Bacteria 925
23 Ga0068857_100000018 3300005577 Bacteria 93371
24 Ga0068856_100000018 3300005614 Bacteria 151165
25 Ga0068856_100002398 3300005614 Bacteria 19281
26 Ga0068852_100000001 3300005616 Bacteria 716526
27 Ga0068852_100000045 3300005616 Bacteria 88494
28 Ga0068852_100149400 3300005616 Bacteria 2171
29 Ga0081455_10000680 3300005937 Bacteria 44122
30 Ga0075365_10000006 3300006038 Bacteria 123233
31 Ga0075365_10000026 3300006038 Bacteria 61245
32 Ga0075365_10001036 3300006038 Bacteria 11962
33 Ga0075368_10000128 3300006042 Bacteria 20142
34 Ga0075363_100136350 3300006048 Bacteria 1379
35 Ga0075364_10000781 3300006051 Bacteria 16736
36 Ga0075364_10043813 3300006051 Bacteria 2909
37 Ga0075364_10094962 3300006051 Bacteria 1982
38 Ga0075367_10001381 3300006178 Bacteria 10368
39 Ga0075369_10001029 3300006186 Bacteria 9322
40 Ga0075369_10027771 3300006186 Bacteria 2367
41 Ga0075366_10008047 3300006195 Bacteria 5844
42 Ga0075366_10009705 3300006195 Bacteria 5381
43 Ga0075370_10016837 3300006353 Bacteria 3940
44 Ga0075428_100010367 3300006844 Bacteria 10345
45 Ga0068865_100016264 3300006881 Bacteria 4757
46 Ga0105240_10000004 3300009093 Bacteria 708156
47 Ga0105240_10001718 3300009093 Bacteria 36965
48 Ga0105240_10014184 3300009093 Bacteria 10884
49 Ga0105241_10089332 3300009174 Unclassified 2427
50 Ga0105241_10163402 3300009174 Bacteria 1832
51 Ga0105241_10836964 3300009174 Bacteria 850
52 Ga0105237_10000001 3300009545 Bacteria 1009213
53 Ga0105237_10000002 3300009545 Bacteria 702357
54 Ga0105238_10002660 3300009551 Bacteria 17764
55 Ga0105032_100003 3300009979 Bacteria 186985
56 Ga0105032_100004 3300009979 Bacteria 172013
57 Ga0105029_100039 3300009984 Bacteria 6028
58 Ga0105239_10000722 3300010375 Bacteria 46895
59 Ga0105246_10005517 3300011119 Bacteria 7717
60 Ga0105246_10023727 3300011119 Bacteria 3972
61 Ga0105246_10121837 3300011119 Unclassified 1934
62 Ga0157373_10004189 3300013100 Bacteria 10877
63 Ga0157373_10095534 3300013100 Unclassified 2092
64 Ga0157371_10041600 3300013102 Bacteria 3278
65 Ga0157370_10001979 3300013104 Bacteria 25174
66 Ga0157370_10004469 3300013104 Bacteria 16019
67 Ga0157369_10000024 3300013105 Bacteria 225851
68 Ga0157369_10003704 3300013105 Bacteria 18169
69 Ga0157369_10005601 3300013105 Bacteria 14584
70 Ga0157369_10006357 3300013105 Bacteria 13711
71 Ga0157369_10008946 3300013105 Bacteria 11470
72 Ga0157369_10012651 3300013105 Bacteria 9570
73 Ga0157374_10097151 3300013296 Bacteria 2818
74 Ga0157372_10000002 3300013307 Bacteria 687862
75 Ga0157372_10714624 3300013307 Bacteria 1166
76 Ga0157377_10002200 3300014745 Bacteria 8571
77 Ga0157376_10000035 3300014969 Bacteria 151993
78 Ga0157376_10092104 3300014969 Bacteria 2627
79 Ga0207647_10000640 3300025904 Bacteria 27311
80 Ga0207705_10000093 3300025909 Bacteria 107314
81 Ga0207654_10104321 3300025911 Bacteria 1752
82 Ga0207654_10175082 3300025911 Unclassified 1396
83 Ga0207695_10000009 3300025913 Bacteria 1034276
84 Ga0207695_10002102 3300025913 Bacteria 30254
85 Ga0207695_10002605 3300025913 Bacteria 26438
86 Ga0207671_10000003 3300025914 Bacteria 1065461
87 Ga0207671_10000008 3300025914 Bacteria 798229
88 Ga0207657_10006518 3300025919 Bacteria 12092
89 Ga0207657_10046784 3300025919 Bacteria 3788
90 Ga0207690_10034975 3300025932 Bacteria 3240
91 Ga0207706_10000209 3300025933 Bacteria 64890
92 Ga0207704_10037872 3300025938 Unclassified 2790
93 Ga0207661_10022900 3300025944 Bacteria 4712
94 Ga0207679_10001761 3300025945 Bacteria 13482
95 Ga0207667_10000005 3300025949 Bacteria 715503
96 Ga0207667_10000096 3300025949 Bacteria 143776
97 Ga0207667_10002265 3300025949 Bacteria 24185
98 Ga0207702_10000100 3300026078 Bacteria 99927
99 Ga0207702_10000112 3300026078 Bacteria 94838
100 Ga0207674_10000215 3300026116 Bacteria 71809
101 Ga0207674_10204321 3300026116 Unclassified 1925
102 Ga0207698_10000022 3300026142 Bacteria 131985
103 Ga0207698_10000165 3300026142 Bacteria 41957
104 Ga0207698_10124655 3300026142 Bacteria 2188
105 Ga0209813_10000234 3300027866 Bacteria 16776
106 Ga0314311_1234855 3300030733 Bacteria 3580
107 Ga0316179_1058425 3300030734 Bacteria 13049
108 Ga0316183_1040992 3300030742 Bacteria 14844
109 Ga0316183_1063317 3300030742 Bacteria 16136
110 Ga0316183_1126512 3300030742 Bacteria 2273
111 Ga0316181_1063761 3300030744 Bacteria 284591
112 Ga0316181_1189033 3300030744 Bacteria 1742
113 Ga0316182_1086796 3300030745 Bacteria 4280
114 Ga0316182_1366183 3300030745 Bacteria 7057
115 Ga0316182_1406370 3300030745 Bacteria 2659
116 Ga0307516_10013501 3300031730 Bacteria 8694
117 Ga0307406_10000002 3300031901 Bacteria 255753
118 Ga0307406_10000102 3300031901 Bacteria 49288
119 Ga0307412_10232850 3300031911 Bacteria 1419
120 Ga0395899_0021442 3300037312 Bacteria 4901
121 Ga0395899_0132178 3300037312 Bacteria 1781
122 Ga0395900_0000001 3300037418 Bacteria 931146
123 Ga0395898_0000002 3300037466 Bacteria 931013
124 Ga0395901_0000072 3300038443 Bacteria 140394
125 Ga0439438_021478 3300041405 Bacteria 1799
126 Ga0439447_016858 3300041407 Bacteria 1998
127 Ga0439461_0000477 3300041410 Bacteria 5774
128 Ga0439461_0002653 3300041410 Bacteria 2885
129 Ga0439445_0004722 3300042004 Bacteria 3090
130 Ga0439432_054568 3300042006 Unclassified 1241
131 Ga0450910_013887 3300042147 Bacteria 1175
132 Ga0439446_0000033 3300042156 Bacteria 21721
133 Ga0450909_015700 3300042185 Bacteria 1118
134 Ga0439464_0000043 3300042439 Bacteria 16217
135 Ga0466972_0152975 3300044658 Unclassified 1084
136 Ga0466965_0000072 3300044683 Bacteria 29926
137 Ga0495638_0000245 3300046460 Bacteria 74379
138 Ga0495638_0000682 3300046460 Bacteria 36908
139 Ga0495671_0030548 3300046692 Bacteria 2759
140 Ga0495660_0000175 3300046810 Bacteria 69454
141 Ga0496100_0020286 3300048903 Unclassified 3982
142 Ga0496115_0000007 3300048918 Bacteria 244991
143 Ga0501034_0000090 3300049571 Bacteria 165117
144 Ga0501037_0000001 3300049573 Bacteria 753276
145 nmdc:mga00v17_101_c1 3300050491 Bacteria 50798
146 nmdc:mga00v17_84900_c1 3300050491 Bacteria 1982
147 nmdc:mga0yw44_15_c2 3300050492 Bacteria 56226
148 nmdc:mga0yw44_1_c1 3300050492 Bacteria 702221
149 nmdc:mga0yw44_258_c1 3300050492 Bacteria 18119
150 nmdc:mga0yw44_6_c1 3300050492 Bacteria 272478
151 nmdc:mga0k408_4680_c1 3300050493 Bacteria 7251
152 nmdc:mga06z11_233280_c1 3300050494 Unclassified 1079
153 nmdc:mga04h51_219_c1 3300050495 Bacteria 15308
154 nmdc:mga07m45_16971_c1 3300050496 Bacteria 3903
155 nmdc:mga07m45_6758_c2 3300050496 Bacteria 4112
156 nmdc:mga0sz30_3080_c1 3300050516 Bacteria 5970
157 Ga0500643_003210 3300053087 Bacteria 7975
158 Ga0500644_0006919 3300053088 Bacteria 2929
159 Ga0500646_0000001 3300053090 Bacteria 273936
160 Ga0500651_0000001 3300053093 Bacteria 529808
161 Ga0500641_0000001 3300053096 Bacteria 1115973
162 Ga0500650_0009862 3300053098 Bacteria 3853
163 Ga0500555_000005 3300053103 Bacteria 342334
164 Ga0500569_000025 3300053109 Bacteria 36908
165 Ga0500593_040766 3300053117 Bacteria 2076
166 Ga0500594_0000059 3300053118 Bacteria 34051
167 Ga0500652_000007 3300053131 Bacteria 165913
168 Ga0500655_000377 3300053133 Bacteria 9587
169 Ga0500577_0008252 3300053142 Unclassified 2961
170 Ga0500577_0030960 3300053142 Bacteria 1868
171 Ga0500588_0000020 3300053146 Bacteria 40592
172 Ga0500616_0000067 3300053153 Bacteria 236311
173 Ga0500616_0029480 3300053153 Bacteria 3018
174 Ga0500616_0030355 3300053153 Bacteria 2969
175 Ga0500570_039413 3300053724 Bacteria 2484
176 Ga0500570_091571 3300053724 Bacteria 1321

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005616 Ga0068852_100000001 Ga0068852_100000001735 259
2 3300006195 Ga0075366_10008047 Ga0075366_100080475 259
3 3300009174 Ga0105241_10163402 Ga0105241_101634023 259
4 3300009545 Ga0105237_10000002 Ga0105237_10000002628 259
5 3300009551 Ga0105238_10002660 Ga0105238_100026609 259
6 3300013296 Ga0157374_10097151 Ga0157374_100971513 259
7 3300025911 Ga0207654_10104321 Ga0207654_101043212 259
8 3300025914 Ga0207671_10000008 Ga0207671_10000008734 259
9 3300026142 Ga0207698_10000022 Ga0207698_10000022137 259
10 3300030742 Ga0316183_1126512 Ga0316183_11265122 259
11 3300044658 Ga0466972_0152975 Ga0466972_0152975_221_1009 259
12 3300044683 Ga0466965_0000072 Ga0466965_0000072_27399_28187 259
13 3300050493 nmdc:mga0k408_4680_c1 nmdc:mga0k408_4680_c1_5085_5870 259
14 3300053142 Ga0500577_0008252 Ga0500577_0008252_497_1285 259
15 3300053142 Ga0500577_0030960 Ga0500577_0030960_248_1036 259
16 3300053153 Ga0500616_0029480 Ga0500616_0029480_541_1329 259
17 3300003322 rootL2_10286456 rootL2_102864561 260
18 3300005616 Ga0068852_100149400 Ga0068852_1001494001 260
19 3300006038 Ga0075365_10000026 Ga0075365_1000002626 260
20 3300009093 Ga0105240_10014184 Ga0105240_100141846 260
21 3300009984 Ga0105029_100039 Ga0105029_1000395 260
22 3300013307 Ga0157372_10714624 Ga0157372_107146242 260
23 3300025913 Ga0207695_10002102 Ga0207695_100021026 260
24 3300026142 Ga0207698_10124655 Ga0207698_101246553 260
25 3300042147 Ga0450910_013887 Ga0450910_013887_190_981 260
26 3300046692 Ga0495671_0030548 Ga0495671_0030548_592_1383 260
27 3300046810 Ga0495660_0000175 Ga0495660_0000175_35611_36402 260
28 3300048903 Ga0496100_0020286 Ga0496100_0020286_1922_2710 260
29 3300050492 nmdc:mga0yw44_15_c2 nmdc:mga0yw44_15_c2_6602_7393 260
30 3300053088 Ga0500644_0006919 Ga0500644_0006919_1620_2411 260
31 3300053090 Ga0500646_0000001 Ga0500646_0000001_33689_34480 260
32 3300053096 Ga0500641_0000001 Ga0500641_0000001_395827_396618 260
33 3300053098 Ga0500650_0009862 Ga0500650_0009862_2172_2963 260
34 3300053131 Ga0500652_000007 Ga0500652_000007_131759_132550 260
35 3300003320 rootH2_10000659 rootH2_100006593 261
36 3300005293 Ga0065715_10006403 Ga0065715_100064031 261
37 3300005937 Ga0081455_10000680 Ga0081455_1000068036 261
38 3300006038 Ga0075365_10000006 Ga0075365_1000000665 261
39 3300006038 Ga0075365_10001036 Ga0075365_1000103610 261
40 3300006051 Ga0075364_10094962 Ga0075364_100949623 261
41 3300009979 Ga0105032_100004 Ga0105032_10000493 261
42 3300026116 Ga0207674_10204321 Ga0207674_102043212 261
43 3300030742 Ga0316183_1040992 Ga0316183_104099213 261
44 3300030742 Ga0316183_1063317 Ga0316183_10633175 261
45 3300030744 Ga0316181_1063761 Ga0316181_1063761153 261
46 3300030745 Ga0316182_1406370 Ga0316182_14063702 261
47 3300031730 Ga0307516_10013501 Ga0307516_100135011 261
48 3300031901 Ga0307406_10000102 Ga0307406_1000010225 261
49 3300037312 Ga0395899_0021442 Ga0395899_0021442_1511_2305 261
50 3300041410 Ga0439461_0000477 Ga0439461_0000477_2450_3244 261
51 3300042004 Ga0439445_0004722 Ga0439445_0004722_678_1472 261
52 3300042006 Ga0439432_054568 Ga0439432_054568_213_1007 261
53 3300046460 Ga0495638_0000245 Ga0495638_0000245_54793_55584 261
54 3300050491 nmdc:mga00v17_84900_c1 nmdc:mga00v17_84900_c1_443_1237 261
55 3300050492 nmdc:mga0yw44_1_c1 nmdc:mga0yw44_1_c1_631168_631959 261
56 3300050492 nmdc:mga0yw44_258_c1 nmdc:mga0yw44_258_c1_10483_11277 261
57 3300053087 Ga0500643_003210 Ga0500643_003210_252_1046 261
58 3300053093 Ga0500651_0000001 Ga0500651_0000001_35882_36676 261
59 3300053103 Ga0500555_000005 Ga0500555_000005_77085_77876 261
60 3300053118 Ga0500594_0000059 Ga0500594_0000059_1742_2536 261
61 3300053133 Ga0500655_000377 Ga0500655_000377_256_1047 261
62 3300053724 Ga0500570_039413 Ga0500570_039413_1249_2058 261
63 3300053724 Ga0500570_091571 Ga0500570_091571_147_941 261
64 3300001979 JGI24740J21852_10006929 JGI24740J21852_100069293 262
65 3300001979 JGI24740J21852_10049287 JGI24740J21852_100492872 262
66 3300001989 JGI24739J22299_10010492 JGI24739J22299_100104925 262
67 3300002067 JGI24735J21928_10000054 JGI24735J21928_1000005443 262
68 3300002067 JGI24735J21928_10047169 JGI24735J21928_100471692 262
69 3300002075 JGI24738J21930_10001831 JGI24738J21930_100018316 262
70 3300003322 rootL2_10049622 rootL2_100496222 262
71 3300003323 rootH1_10000983 rootH1_1000098363 262
72 3300005327 Ga0070658_10000063 Ga0070658_1000006382 262
73 3300005329 Ga0070683_100126289 Ga0070683_1001262893 262
74 3300005339 Ga0070660_100000896 Ga0070660_10000089615 262
75 3300005339 Ga0070660_100010908 Ga0070660_1000109086 262
76 3300005344 Ga0070661_100066411 Ga0070661_1000664111 262
77 3300005366 Ga0070659_100041195 Ga0070659_1000411951 262
78 3300005535 Ga0070684_100094482 Ga0070684_1000944821 262
79 3300005563 Ga0068855_100000050 Ga0068855_100000050132 262
80 3300005563 Ga0068855_100027430 Ga0068855_10002743011 262
81 3300005564 Ga0070664_100000051 Ga0070664_10000005181 262
82 3300005564 Ga0070664_100727497 Ga0070664_1007274971 262
83 3300005577 Ga0068857_100000018 Ga0068857_10000001863 262
84 3300005614 Ga0068856_100000018 Ga0068856_10000001890 262
85 3300005614 Ga0068856_100002398 Ga0068856_1000023981 262
86 3300005616 Ga0068852_100000045 Ga0068852_10000004519 262
87 3300006042 Ga0075368_10000128 Ga0075368_1000012810 262
88 3300006048 Ga0075363_100136350 Ga0075363_1001363502 262
89 3300006051 Ga0075364_10000781 Ga0075364_1000078112 262
90 3300006051 Ga0075364_10043813 Ga0075364_100438133 262
91 3300006178 Ga0075367_10001381 Ga0075367_100013818 262
92 3300006186 Ga0075369_10001029 Ga0075369_100010298 262
93 3300006186 Ga0075369_10027771 Ga0075369_100277713 262
94 3300006195 Ga0075366_10009705 Ga0075366_100097052 262
95 3300006353 Ga0075370_10016837 Ga0075370_100168375 262
96 3300006844 Ga0075428_100010367 Ga0075428_1000103672 262
97 3300006881 Ga0068865_100016264 Ga0068865_1000162644 262
98 3300009093 Ga0105240_10000004 Ga0105240_10000004598 262
99 3300009093 Ga0105240_10001718 Ga0105240_1000171843 262
100 3300009174 Ga0105241_10089332 Ga0105241_100893323 262
101 3300009174 Ga0105241_10836964 Ga0105241_108369641 262
102 3300009545 Ga0105237_10000001 Ga0105237_100000011030 262
103 3300009979 Ga0105032_100003 Ga0105032_10000338 262
104 3300010375 Ga0105239_10000722 Ga0105239_1000072226 262
105 3300011119 Ga0105246_10005517 Ga0105246_100055171 262
106 3300011119 Ga0105246_10023727 Ga0105246_100237271 262
107 3300011119 Ga0105246_10121837 Ga0105246_101218373 262
108 3300013100 Ga0157373_10004189 Ga0157373_1000418913 262
109 3300013100 Ga0157373_10095534 Ga0157373_100955343 262
110 3300013102 Ga0157371_10041600 Ga0157371_100416003 262
111 3300013104 Ga0157370_10001979 Ga0157370_1000197927 262
112 3300013104 Ga0157370_10004469 Ga0157370_1000446920 262
113 3300013105 Ga0157369_10000024 Ga0157369_10000024157 262
114 3300013105 Ga0157369_10003704 Ga0157369_1000370421 262
115 3300013105 Ga0157369_10005601 Ga0157369_1000560116 262
116 3300013105 Ga0157369_10006357 Ga0157369_1000635714 262
117 3300013105 Ga0157369_10008946 Ga0157369_1000894611 262
118 3300013105 Ga0157369_10012651 Ga0157369_1001265115 262
119 3300013307 Ga0157372_10000002 Ga0157372_10000002575 262
120 3300014745 Ga0157377_10002200 Ga0157377_100022007 262
121 3300014969 Ga0157376_10000035 Ga0157376_1000003585 262
122 3300014969 Ga0157376_10092104 Ga0157376_100921041 262
123 3300025904 Ga0207647_10000640 Ga0207647_1000064019 262
124 3300025909 Ga0207705_10000093 Ga0207705_1000009382 262
125 3300025911 Ga0207654_10175082 Ga0207654_101750822 262
126 3300025913 Ga0207695_10000009 Ga0207695_10000009978 262
127 3300025913 Ga0207695_10002605 Ga0207695_1000260530 262
128 3300025914 Ga0207671_10000003 Ga0207671_100000031034 262
129 3300025919 Ga0207657_10006518 Ga0207657_1000651810 262
130 3300025919 Ga0207657_10046784 Ga0207657_100467844 262
131 3300025932 Ga0207690_10034975 Ga0207690_100349753 262
132 3300025933 Ga0207706_10000209 Ga0207706_100002097 262
133 3300025938 Ga0207704_10037872 Ga0207704_100378723 262
134 3300025944 Ga0207661_10022900 Ga0207661_100229004 262
135 3300025945 Ga0207679_10001761 Ga0207679_1000176113 262
136 3300025949 Ga0207667_10000005 Ga0207667_10000005144 262
137 3300025949 Ga0207667_10000096 Ga0207667_10000096130 262
138 3300025949 Ga0207667_10002265 Ga0207667_1000226526 262
139 3300026078 Ga0207702_10000100 Ga0207702_10000100112 262
140 3300026078 Ga0207702_10000112 Ga0207702_10000112105 262
141 3300026116 Ga0207674_10000215 Ga0207674_1000021537 262
142 3300026142 Ga0207698_10000165 Ga0207698_1000016530 262
143 3300027866 Ga0209813_10000234 Ga0209813_100002346 262
144 3300030733 Ga0314311_1234855 Ga0314311_12348555 262
145 3300030734 Ga0316179_1058425 Ga0316179_10584259 262
146 3300030744 Ga0316181_1189033 Ga0316181_11890332 262
147 3300030745 Ga0316182_1086796 Ga0316182_10867964 262
148 3300030745 Ga0316182_1366183 Ga0316182_13661834 262
149 3300031901 Ga0307406_10000002 Ga0307406_10000002174 262
150 3300031911 Ga0307412_10232850 Ga0307412_102328502 262
151 3300037312 Ga0395899_0132178 Ga0395899_0132178_961_1752 262
152 3300037418 Ga0395900_0000001 Ga0395900_0000001_887075_887866 262
153 3300037466 Ga0395898_0000002 Ga0395898_0000002_218140_218931 262
154 3300038443 Ga0395901_0000072 Ga0395901_0000072_55807_56598 262
155 3300041405 Ga0439438_021478 Ga0439438_021478_801_1595 262
156 3300041407 Ga0439447_016858 Ga0439447_016858_301_1095 262
157 3300041410 Ga0439461_0002653 Ga0439461_0002653_237_1031 262
158 3300042156 Ga0439446_0000033 Ga0439446_0000033_11450_12247 262
159 3300042185 Ga0450909_015700 Ga0450909_015700_241_1035 262
160 3300042439 Ga0439464_0000043 Ga0439464_0000043_12048_12839 262
161 3300046460 Ga0495638_0000682 Ga0495638_0000682_19455_20252 262
162 3300048918 Ga0496115_0000007 Ga0496115_0000007_200753_201547 262
163 3300049571 Ga0501034_0000090 Ga0501034_0000090_4992_5795 262
164 3300049573 Ga0501037_0000001 Ga0501037_0000001_477678_478481 262
165 3300050491 nmdc:mga00v17_101_c1 nmdc:mga00v17_101_c1_26821_27618 262
166 3300050492 nmdc:mga0yw44_6_c1 nmdc:mga0yw44_6_c1_140012_140809 262
167 3300050494 nmdc:mga06z11_233280_c1 nmdc:mga06z11_233280_c1_164_961 262
168 3300050495 nmdc:mga04h51_219_c1 nmdc:mga04h51_219_c1_1409_2206 262
169 3300050496 nmdc:mga07m45_16971_c1 nmdc:mga07m45_16971_c1_2358_3152 262
170 3300050496 nmdc:mga07m45_6758_c2 nmdc:mga07m45_6758_c2_2430_3221 262
171 3300050516 nmdc:mga0sz30_3080_c1 nmdc:mga0sz30_3080_c1_4496_5293 262
172 3300053109 Ga0500569_000025 Ga0500569_000025_19455_20252 262
173 3300053117 Ga0500593_040766 Ga0500593_040766_524_1330 262
174 3300053146 Ga0500588_0000020 Ga0500588_0000020_19427_20224 262
175 3300053153 Ga0500616_0000067 Ga0500616_0000067_8500_9297 262
176 3300053153 Ga0500616_0030355 Ga0500616_0030355_1009_1809 262

Structural Annotation

Top 5 Hits

ID Description Score Start End
6efw-assembly1.cif.gz_A crystal structure of a yjef family protein from cryptococcus neoformans var. grubii serotype a 0.7945 17 259
3rss-assembly1.cif.gz_A crystal structure of tm0922, a fusion of a domain of unknown function and adp/atp-dependent nad(p)h-hydrate dehydratase from thermotoga maritima soaked with nadp 0.791 17 259
6efx-assembly1.cif.gz_A crystal structure of a yjef family protein from cryptococcus neoformans var. grubii serotype a in complex with amppnp 0.7902 17 259
3bgk-assembly1.cif.gz_A the crystal structure of hypothetic protein smu.573 from streptococcus mutans 0.754 17 259
6efw-assembly1.cif.gz_A crystal structure of a yjef family protein from cryptococcus neoformans var. grubii serotype a 0.7405 17 259
ID Description Score Start End Superfamily
af_A0A0P0VT24_14_97_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.8799 190 219 3.40.140.10
af_Q58981_237_491_3.40.1190.20 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.8711 23 259 3.40.1190.20
af_Q94AF2_52_361_3.40.1190.20 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.8344 17 259 3.40.1190.20
af_F1Q575_38_328_3.40.1190.20 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.8014 17 258 3.40.1190.20
af_P32740_1_306_3.40.1190.20 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.7937 24 259 3.40.1190.20
ID Description Score Start End GO Terms
AF-A0A839JJD9-F1-model_v4 deleted 0.9757 28 260
AF-A0A2E6BS84-F1-model_v4 Uncharacterized protein 0.9727 1 261
AF-A0A839JJD9-F1-model_v4 deleted 0.9675 28 260
AF-A0A2E6BS84-F1-model_v4 Uncharacterized protein 0.9655 1 261
AF-A0A7W4HK79-F1-model_v4 Uncharacterized protein 0.9606 1 259

Feature Viewer

pLDDT pTM Quality
89.54 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map