F268552

General Info

Members Datasets Scaffolds Average Seq Length
176 90 176 514

Family's Representative Sequence

Representative Sequence 3300031711|Ga0265314_10013274|Ga0265314_100132747
Length 608
Sequence MLKSSGAMAGATLVSRLLGMVREIVYARFMGDGWVAGAFQFAFTIPNLFRRLLGEGALTAAFIPIFKEKEKTHGEIEMWRAANAVISGLIVLAAHQFDAKTELMLRLLRVMFPYMILVCLAAAFMGMLNARGHFFIPAMGATMLNVVMIASVLWLAPTMGLDLPKEERLPHQIFALAIGVLAAGVAQAAFQLPTLWRDGFRYRWVSPWRDETVRRVVFKMIPGTIGVAAFQINVTLVLAIAFWVNPQIVASFNYAVRLMELPQGMFGISLATYLLPTLSGLAAEKNYAGFRGTLRHGLGTLLFLNLIAAVLLVVLAQPIVRLIFEHGRFNADSTDRAALALMCLAPGLVAFSSVNILARAFFALGDTQTPMKTSIVCLVLNFILAAILVEPLKQGGLGIANTVTSICNVGLLTFALRKKLGKLEMEPLRKTFLPLAVSGLLAGLLAWAGWRLWENSLGHQTIALKIGAVFVPAGIAGIVYWLVTLAFNIPAAKEMTAFALAKFKRSGRRAAASGRRSAPTLPSNRNHRRPSVAAELRFEFFRQRLAGNHIFNDGKRRGAAAGHERGQRAVFAQKFLVKRQNGKFVQRGRFKRIKKLCAGGAQISGLKL

Samples

Sample ID Description Type Environment
1 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
2 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
3 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
4 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
5 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
6 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
7 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
8 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
9 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
10 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
11 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
12 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
13 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
14 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
15 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
16 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
17 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
18 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
19 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
20 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
24 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
25 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
26 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
27 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
28 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
29 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
30 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
31 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
32 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
33 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
34 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
35 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
36 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
37 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
38 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
39 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
40 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
41 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
42 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
43 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
44 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
45 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
46 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
47 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
48 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
49 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
50 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
51 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
52 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
53 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
54 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
55 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
56 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
57 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
58 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
59 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
60 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
61 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
62 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
63 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
64 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
65 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
66 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
67 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
68 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
69 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
70 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
71 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
72 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
73 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
74 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
75 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
76 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
77 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
78 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
79 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
80 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
81 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
82 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
83 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
84 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
85 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
86 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
87 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
88 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
89 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
90 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.57
Nodule 0
Rhizoplane 0.57
Rhizosphere 98.86
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070690_100025263 3300005330 Bacteria 3658
2 Ga0070689_100011934 3300005340 Bacteria 6239
3 Ga0070689_100054589 3300005340 Unclassified 3093
4 Ga0070711_100000512 3300005439 Bacteria 20157
5 Ga0070672_100143239 3300005543 Unclassified 1973
6 Ga0070686_100002034 3300005544 Bacteria 11213
7 Ga0068855_100012591 3300005563 Bacteria 10207
8 Ga0068855_100126804 3300005563 Unclassified 2918
9 Ga0068857_100020203 3300005577 Bacteria 5856
10 Ga0068856_100000247 3300005614 Bacteria 58943
11 Ga0068859_100001997 3300005617 Bacteria 20834
12 Ga0068859_100091037 3300005617 Bacteria 3101
13 Ga0068859_100260109 3300005617 Bacteria 1827
14 Ga0068863_100037838 3300005841 Bacteria 4592
15 Ga0068871_100041496 3300006358 Bacteria 3690
16 Ga0075428_100001665 3300006844 Bacteria 23663
17 Ga0075428_100070775 3300006844 Unclassified 3813
18 Ga0097620_100001997 3300006931 Bacteria 20834
19 Ga0097620_100091035 3300006931 Bacteria 3101
20 Ga0097620_100260097 3300006931 Bacteria 1827
21 Ga0105240_10008746 3300009093 Bacteria 14435
22 Ga0105238_10001266 3300009551 Bacteria 25411
23 Ga0105238_10016925 3300009551 Bacteria 7399
24 Ga0105238_10076876 3300009551 Bacteria 3331
25 Ga0157375_10000017 3300013308 Bacteria 286152
26 Ga0163163_10000010 3300014325 Bacteria 264773
27 Ga0163163_10018008 3300014325 Bacteria 6599
28 Ga0207707_10070209 3300025912 Unclassified 3053
29 Ga0207695_10008807 3300025913 Bacteria 12571
30 Ga0207694_10004972 3300025924 Bacteria 10291
31 Ga0207694_10044552 3300025924 Bacteria 3425
32 Ga0207694_10123100 3300025924 Unclassified 2072
33 Ga0207664_10002022 3300025929 Bacteria 13346
34 Ga0207670_10000661 3300025936 Bacteria 18269
35 Ga0207670_10015749 3300025936 Unclassified 4526
36 Ga0207670_10037972 3300025936 Unclassified 3142
37 Ga0207670_10055523 3300025936 Unclassified 2677
38 Ga0207667_10022709 3300025949 Bacteria 6921
39 Ga0207702_10001127 3300026078 Bacteria 27289
40 Ga0207702_10045068 3300026078 Bacteria 3710
41 Ga0207674_10028605 3300026116 Bacteria 5880
42 Ga0207674_10067715 3300026116 Bacteria 3594
43 Ga0265337_1000172 3300028556 Bacteria 33853
44 Ga0265337_1000224 3300028556 Bacteria 30283
45 Ga0265337_1016922 3300028556 Bacteria 2347
46 Ga0265337_1018553 3300028556 Bacteria 2207
47 Ga0265326_10004044 3300028558 Unclassified 4740
48 Ga0265319_1000007 3300028563 Bacteria 217194
49 Ga0265319_1008051 3300028563 Bacteria 4660
50 Ga0265323_10000183 3300028653 Bacteria 37704
51 Ga0265323_10006585 3300028653 Bacteria 4875
52 Ga0265323_10014305 3300028653 Bacteria 3147
53 Ga0265323_10022176 3300028653 Bacteria 2428
54 Ga0265322_10005233 3300028654 Bacteria 3838
55 Ga0265336_10000757 3300028666 Bacteria 17176
56 Ga0265338_10000184 3300028800 Bacteria 116834
57 Ga0265338_10000263 3300028800 Bacteria 95638
58 Ga0265338_10000279 3300028800 Bacteria 92884
59 Ga0265338_10000848 3300028800 Bacteria 51617
60 Ga0265338_10001365 3300028800 Bacteria 39706
61 Ga0265338_10001733 3300028800 Bacteria 34498
62 Ga0265338_10002298 3300028800 Bacteria 29060
63 Ga0265338_10002872 3300028800 Bacteria 25145
64 Ga0265338_10003660 3300028800 Bacteria 21408
65 Ga0265338_10004907 3300028800 Bacteria 17796
66 Ga0265338_10006727 3300028800 Bacteria 14515
67 Ga0265338_10008583 3300028800 Bacteria 12364
68 Ga0265338_10010134 3300028800 Bacteria 11119
69 Ga0265338_10015660 3300028800 Bacteria 8308
70 Ga0265338_10020495 3300028800 Bacteria 6952
71 Ga0265338_10022151 3300028800 Bacteria 6593
72 Ga0265338_10028756 3300028800 Bacteria 5534
73 Ga0265338_10035733 3300028800 Bacteria 4768
74 Ga0265338_10036965 3300028800 Bacteria 4659
75 Ga0265338_10044436 3300028800 Bacteria 4102
76 Ga0265338_10059717 3300028800 Bacteria 3357
77 Ga0265338_10064217 3300028800 Bacteria 3195
78 Ga0265324_10000146 3300029957 Bacteria 54469
79 Ga0265324_10001547 3300029957 Bacteria 12883
80 Ga0265324_10008089 3300029957 Bacteria 4212
81 Ga0265324_10011881 3300029957 Bacteria 3305
82 Ga0265324_10012415 3300029957 Bacteria 3212
83 Ga0265332_10005347 3300031238 Bacteria 5932
84 Ga0265332_10041079 3300031238 Bacteria 2002
85 Ga0265320_10000296 3300031240 Bacteria 40524
86 Ga0265320_10005364 3300031240 Bacteria 8243
87 Ga0265320_10011044 3300031240 Bacteria 5335
88 Ga0265320_10045153 3300031240 Bacteria 2166
89 Ga0265325_10001910 3300031241 Bacteria 14389
90 Ga0265329_10000436 3300031242 Bacteria 21993
91 Ga0265340_10000859 3300031247 Bacteria 17275
92 Ga0265340_10019464 3300031247 Bacteria 3496
93 Ga0265339_10009706 3300031249 Bacteria 6020
94 Ga0265327_10001384 3300031251 Bacteria 30970
95 Ga0265327_10008512 3300031251 Bacteria 7625
96 Ga0265327_10009115 3300031251 Bacteria 7226
97 Ga0265316_10005083 3300031344 Bacteria 12899
98 Ga0265316_10007693 3300031344 Bacteria 10104
99 Ga0265316_10008162 3300031344 Bacteria 9742
100 Ga0265316_10012135 3300031344 Bacteria 7735
101 Ga0265313_10001258 3300031595 Bacteria 24105
102 Ga0265314_10000499 3300031711 Bacteria 50725
103 Ga0265314_10013274 3300031711 Bacteria 6665
104 Ga0316578_10033108 3300031728 Bacteria 2958
105 Ga0373930_0001951 3300034816 Bacteria 3155
106 Ga0373926_0029290 3300035083 Bacteria 1934
107 Ga0373928_0000452 3300035084 Bacteria 8078
108 Ga0373944_0000766 3300035089 Bacteria 7815
109 Ga0373951_0001905 3300035091 Bacteria 5378
110 Ga0373932_0000001 3300035112 Bacteria 1459067
111 Ga0373945_0007215 3300035116 Bacteria 3598
112 Ga0373954_0004356 3300035118 Bacteria 6086
113 Ga0373954_0016350 3300035118 Bacteria 3320
114 Ga0373956_0002799 3300035119 Bacteria 7048
115 Ga0373962_0000045 3300035242 Bacteria 28368
116 Ga0373931_0000002 3300035691 Bacteria 599830
117 Ga0373935_0059442 3300035692 Unclassified 2443
118 Ga0373927_0033796 3300035695 Bacteria 3327
119 Ga0373927_0090734 3300035695 Bacteria 1984
120 Ga0373947_0001872 3300035725 Bacteria 12836
121 Ga0373947_0085957 3300035725 Bacteria 1954
122 Ga0373937_0010639 3300036401 Bacteria 8041
123 Ga0373937_0039061 3300036401 Bacteria 4325
124 Ga0373937_0074431 3300036401 Unclassified 3134
125 Ga0373925_0009483 3300037068 Bacteria 7087
126 Ga0451577_0008847 3300042876 Bacteria 9748
127 Ga0451577_0047995 3300042876 Bacteria 3816
128 Ga0453684_0002805 3300044712 Bacteria 41191
129 Ga0453684_0058613 3300044712 Bacteria 4973
130 Ga0453684_0070871 3300044712 Bacteria 4410
131 Ga0453684_0095090 3300044712 Bacteria 3663
132 Ga0453684_0116760 3300044712 Bacteria 3231
133 Ga0453684_0188211 3300044712 Bacteria 2417
134 Ga0453684_0218418 3300044712 Unclassified 2210
135 Ga0451576_0037513 3300045051 Bacteria 5133
136 Ga0451576_0098817 3300045051 Bacteria 3036
137 Ga0451576_0144673 3300045051 Unclassified 2479
138 Ga0451576_0152976 3300045051 Bacteria 2406
139 Ga0451576_0332153 3300045051 Bacteria 1591
140 Ga0495592_0000035 3300046454 Bacteria 125802
141 Ga0495664_0076687 3300046477 Bacteria 2001
142 Ga0495628_0000046 3300046516 Bacteria 97902
143 Ga0495630_0000220 3300046517 Bacteria 45190
144 Ga0495630_0007026 3300046517 Bacteria 8022
145 Ga0495630_0081043 3300046517 Bacteria 2449
146 Ga0495640_0025422 3300046533 Unclassified 4296
147 Ga0495586_0000017 3300046535 Bacteria 116426
148 Ga0495586_0022455 3300046535 Unclassified 3367
149 Ga0495645_0005129 3300046543 Bacteria 8976
150 Ga0495634_0000900 3300046642 Bacteria 28505
151 Ga0495634_0039584 3300046642 Unclassified 3210
152 Ga0495635_0010693 3300046663 Bacteria 6426
153 Ga0495657_0034406 3300046675 Unclassified 3519
154 Ga0495599_0008458 3300046678 Bacteria 6256
155 Ga0495599_0104100 3300046678 Bacteria 1768
156 Ga0495613_0012355 3300046689 Bacteria 6345
157 Ga0495624_0014454 3300046690 Bacteria 5356
158 Ga0495674_0009782 3300047319 Bacteria 9103
159 Ga0495676_0032022 3300047321 Unclassified 4443
160 Ga0495680_0105791 3300047322 Bacteria 2092
161 Ga0495684_0085736 3300047471 Bacteria 2388
162 Ga0495684_0118528 3300047471 Bacteria 1995
163 Ga0496115_0005849 3300048918 Bacteria 8962
164 Ga0501031_0000239 3300049568 Bacteria 31192
165 Ga0501033_0001502 3300049570 Bacteria 20665
166 Ga0501033_0025846 3300049570 Bacteria 4421
167 Ga0501033_0093881 3300049570 Bacteria 2194
168 Ga0501036_0123176 3300049572 Bacteria 2190
169 Ga0501043_0037375 3300049579 Bacteria 3819
170 Ga0501080_0048909 3300049742 Bacteria 3935
171 Ga0501035_0004557 3300049822 Bacteria 13153
172 Ga0501035_0028325 3300049822 Bacteria 5114
173 Ga0501044_0000668 3300049823 Bacteria 41414
174 Ga0501044_0018648 3300049823 Bacteria 7432
175 nmdc:mga08y16_36908_c1 3300050511 Bacteria 5132
176 Ga0500650_0007551 3300053098 Unclassified 4242

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045051 Ga0451576_0144673 Ga0451576_0144673_1056_2456 448
2 3300035725 Ga0373947_0085957 Ga0373947_0085957_12_1397 450
3 3300028800 Ga0265338_10020495 Ga0265338_100204956 473
4 3300025912 Ga0207707_10070209 Ga0207707_100702091 480
5 3300014325 Ga0163163_10000010 Ga0163163_1000001077 481
6 3300005340 Ga0070689_100011934 Ga0070689_1000119344 482
7 3300005841 Ga0068863_100037838 Ga0068863_1000378385 482
8 3300006844 Ga0075428_100001665 Ga0075428_1000016656 482
9 3300025936 Ga0207670_10000661 Ga0207670_100006616 482
10 3300049568 Ga0501031_0000239 Ga0501031_0000239_7270_8817 482
11 3300049570 Ga0501033_0001502 Ga0501033_0001502_7248_8795 482
12 3300049822 Ga0501035_0004557 Ga0501035_0004557_6910_8457 482
13 3300050511 nmdc:mga08y16_36908_c1 nmdc:mga08y16_36908_c1_2430_3980 482
14 3300025929 Ga0207664_10002022 Ga0207664_1000202212 483
15 3300028800 Ga0265338_10015660 Ga0265338_100156601 484
16 3300031240 Ga0265320_10045153 Ga0265320_100451532 484
17 3300028800 Ga0265338_10002872 Ga0265338_100028726 486
18 3300025936 Ga0207670_10055523 Ga0207670_100555231 488
19 3300049823 Ga0501044_0000668 Ga0501044_0000668_32570_34138 489
20 3300006844 Ga0075428_100070775 Ga0075428_1000707753 491
21 3300028653 Ga0265323_10022176 Ga0265323_100221762 491
22 3300028800 Ga0265338_10035733 Ga0265338_100357332 491
23 3300046477 Ga0495664_0076687 Ga0495664_0076687_77_1741 491
24 3300046678 Ga0495599_0104100 Ga0495599_0104100_84_1748 491
25 3300047471 Ga0495684_0118528 Ga0495684_0118528_313_1977 491
26 3300028653 Ga0265323_10000183 Ga0265323_1000018335 492
27 3300028654 Ga0265322_10005233 Ga0265322_100052333 492
28 3300031728 Ga0316578_10033108 Ga0316578_100331082 492
29 3300035118 Ga0373954_0016350 Ga0373954_0016350_1007_2668 492
30 3300028800 Ga0265338_10004907 Ga0265338_1000490714 493
31 3300047322 Ga0495680_0105791 Ga0495680_0105791_18_1571 493
32 3300028800 Ga0265338_10010134 Ga0265338_100101344 495
33 3300031238 Ga0265332_10041079 Ga0265332_100410791 495
34 3300031241 Ga0265325_10001910 Ga0265325_100019103 495
35 3300031249 Ga0265339_10009706 Ga0265339_100097066 495
36 3300031344 Ga0265316_10005083 Ga0265316_1000508311 495
37 3300031595 Ga0265313_10001258 Ga0265313_1000125811 495
38 3300035118 Ga0373954_0004356 Ga0373954_0004356_716_2284 495
39 3300035119 Ga0373956_0002799 Ga0373956_0002799_58_1626 495
40 3300036401 Ga0373937_0039061 Ga0373937_0039061_1946_3514 495
41 3300046642 Ga0495634_0000900 Ga0495634_0000900_19528_21096 495
42 3300046663 Ga0495635_0010693 Ga0495635_0010693_2548_4116 495
43 3300046689 Ga0495613_0012355 Ga0495613_0012355_3929_5497 495
44 3300029957 Ga0265324_10011881 Ga0265324_100118813 496
45 3300031251 Ga0265327_10009115 Ga0265327_100091152 496
46 3300035083 Ga0373926_0029290 Ga0373926_0029290_67_1659 496
47 3300035692 Ga0373935_0059442 Ga0373935_0059442_730_2322 496
48 3300035725 Ga0373947_0001872 Ga0373947_0001872_4355_5947 496
49 3300046517 Ga0495630_0081043 Ga0495630_0081043_687_2279 496
50 3300005617 Ga0068859_100091037 Ga0068859_1000910372 497
51 3300006931 Ga0097620_100091035 Ga0097620_1000910352 497
52 3300014325 Ga0163163_10018008 Ga0163163_100180086 497
53 3300026116 Ga0207674_10067715 Ga0207674_100677152 497
54 3300036401 Ga0373937_0074431 Ga0373937_0074431_392_1948 497
55 3300048918 Ga0496115_0005849 Ga0496115_0005849_2478_4067 497
56 3300045051 Ga0451576_0332153 Ga0451576_0332153_12_1574 498
57 3300005617 Ga0068859_100001997 Ga0068859_1000019978 499
58 3300006931 Ga0097620_100001997 Ga0097620_1000019978 499
59 3300009551 Ga0105238_10076876 Ga0105238_100768762 499
60 3300025924 Ga0207694_10044552 Ga0207694_100445522 499
61 3300028558 Ga0265326_10004044 Ga0265326_100040443 499
62 3300028563 Ga0265319_1000007 Ga0265319_100000728 499
63 3300028800 Ga0265338_10000279 Ga0265338_1000027965 499
64 3300028800 Ga0265338_10002298 Ga0265338_100022982 499
65 3300031240 Ga0265320_10011044 Ga0265320_100110444 499
66 3300049742 Ga0501080_0048909 Ga0501080_0048909_518_2203 499
67 3300005544 Ga0070686_100002034 Ga0070686_1000020345 500
68 3300025936 Ga0207670_10037972 Ga0207670_100379722 500
69 3300028556 Ga0265337_1000224 Ga0265337_100022431 500
70 3300028666 Ga0265336_10000757 Ga0265336_1000075717 500
71 3300028800 Ga0265338_10003660 Ga0265338_1000366021 500
72 3300042876 Ga0451577_0047995 Ga0451577_0047995_1140_2720 500
73 3300044712 Ga0453684_0002805 Ga0453684_0002805_22067_23647 500
74 3300028800 Ga0265338_10059717 Ga0265338_100597173 501
75 3300046535 Ga0495586_0022455 Ga0495586_0022455_180_1727 501
76 3300006358 Ga0068871_100041496 Ga0068871_1000414963 502
77 3300028556 Ga0265337_1018553 Ga0265337_10185532 502
78 3300031247 Ga0265340_10000859 Ga0265340_1000085910 502
79 3300031344 Ga0265316_10012135 Ga0265316_100121354 502
80 3300049570 Ga0501033_0093881 Ga0501033_0093881_154_1725 503
81 3300049572 Ga0501036_0123176 Ga0501036_0123176_462_2033 503
82 3300049579 Ga0501043_0037375 Ga0501043_0037375_1405_2976 503
83 3300049822 Ga0501035_0028325 Ga0501035_0028325_3445_5016 503
84 3300049823 Ga0501044_0018648 Ga0501044_0018648_4702_6273 503
85 3300028800 Ga0265338_10028756 Ga0265338_100287563 504
86 3300028653 Ga0265323_10006585 Ga0265323_100065853 505
87 3300028800 Ga0265338_10001733 Ga0265338_1000173325 505
88 3300031344 Ga0265316_10007693 Ga0265316_100076939 505
89 3300031344 Ga0265316_10008162 Ga0265316_1000816211 505
90 3300031711 Ga0265314_10013274 Ga0265314_100132747 505
91 3300046517 Ga0495630_0000220 Ga0495630_0000220_21525_23099 505
92 3300046535 Ga0495586_0000017 Ga0495586_0000017_57530_59104 505
93 3300046642 Ga0495634_0039584 Ga0495634_0039584_1461_3035 505
94 3300046675 Ga0495657_0034406 Ga0495657_0034406_811_2394 505
95 3300047321 Ga0495676_0032022 Ga0495676_0032022_2343_3917 505
96 3300009551 Ga0105238_10001266 Ga0105238_1000126613 506
97 3300025924 Ga0207694_10004972 Ga0207694_100049723 506
98 3300028556 Ga0265337_1000172 Ga0265337_10001728 506
99 3300028800 Ga0265338_10000848 Ga0265338_1000084822 506
100 3300029957 Ga0265324_10001547 Ga0265324_1000154713 506
101 3300035695 Ga0373927_0033796 Ga0373927_0033796_1513_3198 506
102 3300005340 Ga0070689_100054589 Ga0070689_1000545892 507
103 3300005543 Ga0070672_100143239 Ga0070672_1001432391 507
104 3300005563 Ga0068855_100126804 Ga0068855_1001268045 507
105 3300005577 Ga0068857_100020203 Ga0068857_1000202034 507
106 3300005617 Ga0068859_100260109 Ga0068859_1002601091 507
107 3300006931 Ga0097620_100260097 Ga0097620_1002600971 507
108 3300009093 Ga0105240_10008746 Ga0105240_100087467 507
109 3300009551 Ga0105238_10016925 Ga0105238_100169252 507
110 3300013308 Ga0157375_10000017 Ga0157375_1000001786 507
111 3300025913 Ga0207695_10008807 Ga0207695_100088076 507
112 3300025924 Ga0207694_10123100 Ga0207694_101231002 507
113 3300025936 Ga0207670_10015749 Ga0207670_100157494 507
114 3300026116 Ga0207674_10028605 Ga0207674_100286054 507
115 3300028556 Ga0265337_1016922 Ga0265337_10169222 507
116 3300028800 Ga0265338_10000184 Ga0265338_1000018480 507
117 3300028800 Ga0265338_10001365 Ga0265338_1000136517 507
118 3300028800 Ga0265338_10006727 Ga0265338_100067279 507
119 3300029957 Ga0265324_10012415 Ga0265324_100124152 507
120 3300031238 Ga0265332_10005347 Ga0265332_100053471 507
121 3300031240 Ga0265320_10005364 Ga0265320_100053642 507
122 3300031242 Ga0265329_10000436 Ga0265329_1000043615 507
123 3300031247 Ga0265340_10019464 Ga0265340_100194642 507
124 3300031711 Ga0265314_10000499 Ga0265314_1000049932 507
125 3300034816 Ga0373930_0001951 Ga0373930_0001951_1019_2575 507
126 3300035084 Ga0373928_0000452 Ga0373928_0000452_5662_7218 507
127 3300035089 Ga0373944_0000766 Ga0373944_0000766_3281_4837 507
128 3300035091 Ga0373951_0001905 Ga0373951_0001905_3751_5307 507
129 3300035112 Ga0373932_0000001 Ga0373932_0000001_1092937_1094493 507
130 3300035116 Ga0373945_0007215 Ga0373945_0007215_64_1620 507
131 3300035242 Ga0373962_0000045 Ga0373962_0000045_10632_12188 507
132 3300035691 Ga0373931_0000002 Ga0373931_0000002_400905_402461 507
133 3300035695 Ga0373927_0090734 Ga0373927_0090734_180_1736 507
134 3300036401 Ga0373937_0010639 Ga0373937_0010639_1618_3201 507
135 3300037068 Ga0373925_0009483 Ga0373925_0009483_4130_5686 507
136 3300042876 Ga0451577_0008847 Ga0451577_0008847_1925_3508 507
137 3300044712 Ga0453684_0058613 Ga0453684_0058613_2190_3752 507
138 3300044712 Ga0453684_0070871 Ga0453684_0070871_2200_3783 507
139 3300044712 Ga0453684_0095090 Ga0453684_0095090_1569_3125 507
140 3300044712 Ga0453684_0116760 Ga0453684_0116760_931_2496 507
141 3300044712 Ga0453684_0188211 Ga0453684_0188211_143_1702 507
142 3300044712 Ga0453684_0218418 Ga0453684_0218418_79_1716 507
143 3300045051 Ga0451576_0037513 Ga0451576_0037513_655_2229 507
144 3300045051 Ga0451576_0098817 Ga0451576_0098817_1133_2692 507
145 3300045051 Ga0451576_0152976 Ga0451576_0152976_186_1748 507
146 3300046454 Ga0495592_0000035 Ga0495592_0000035_116514_118115 507
147 3300046516 Ga0495628_0000046 Ga0495628_0000046_22862_24463 507
148 3300046517 Ga0495630_0007026 Ga0495630_0007026_5345_6946 507
149 3300046533 Ga0495640_0025422 Ga0495640_0025422_811_2412 507
150 3300046543 Ga0495645_0005129 Ga0495645_0005129_4961_6562 507
151 3300046678 Ga0495599_0008458 Ga0495599_0008458_3993_5594 507
152 3300046690 Ga0495624_0014454 Ga0495624_0014454_1828_3429 507
153 3300047319 Ga0495674_0009782 Ga0495674_0009782_3409_5010 507
154 3300047471 Ga0495684_0085736 Ga0495684_0085736_329_1894 507
155 3300053098 Ga0500650_0007551 Ga0500650_0007551_2066_3643 507
156 3300005563 Ga0068855_100012591 Ga0068855_1000125913 508
157 3300005614 Ga0068856_100000247 Ga0068856_10000024725 508
158 3300025949 Ga0207667_10022709 Ga0207667_100227094 508
159 3300026078 Ga0207702_10001127 Ga0207702_100011272 508
160 3300028653 Ga0265323_10014305 Ga0265323_100143052 509
161 3300031251 Ga0265327_10008512 Ga0265327_100085122 509
162 3300028800 Ga0265338_10044436 Ga0265338_100444363 511
163 3300028800 Ga0265338_10022151 Ga0265338_100221516 512
164 3300005330 Ga0070690_100025263 Ga0070690_1000252632 513
165 3300005439 Ga0070711_100000512 Ga0070711_10000051211 513
166 3300026078 Ga0207702_10045068 Ga0207702_100450682 513
167 3300028563 Ga0265319_1008051 Ga0265319_10080513 513
168 3300028800 Ga0265338_10000263 Ga0265338_100002634 513
169 3300028800 Ga0265338_10008583 Ga0265338_100085834 513
170 3300028800 Ga0265338_10036965 Ga0265338_100369655 513
171 3300028800 Ga0265338_10064217 Ga0265338_100642172 513
172 3300029957 Ga0265324_10000146 Ga0265324_1000014624 513
173 3300029957 Ga0265324_10008089 Ga0265324_100080893 513
174 3300031240 Ga0265320_10000296 Ga0265320_100002966 513
175 3300031251 Ga0265327_10001384 Ga0265327_100013845 513
176 3300049570 Ga0501033_0025846 Ga0501033_0025846_1212_2798 513

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03023

MurJ

Lipid II flippase MurJ

26

467

0.92

PF01554

MatE

MatE

222

387

0.9

PF14667

Polysacc_synt_C

Polysaccharide biosynthesis C-terminal domain

340

489

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
7waw-assembly1.cif.gz_A murj inward closed form 0.8761 8 494
7wag-assembly1.cif.gz_A crystal structure of murj squeezed form 0.8645 15 505
7waw-assembly1.cif.gz_A murj inward closed form 0.8593 8 494
6cc4-assembly1.cif.gz_A structure of murj from escherichia coli 0.858 15 494
6nc6-assembly2.cif.gz_B lipid ii flippase murj, inward closed conformation 0.8493 8 493
ID Description Score Start End Superfamily
af_Q2FXH6_386_533_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.9124 349 496 1.10.1760.20
af_Q2FXH6_386_533_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.8952 349 496 1.10.1760.20
af_P0AAA7_285_416_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.8185 302 427 1.20.1070.10
af_P37340_17_177_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.8118 228 392 1.10.1760.20
af_Q2G0R7_343_485_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.8041 349 497 1.10.1760.20
ID Description Score Start End GO Terms
AF-X1VEC7-F1-model_v4 Polysaccharide biosynthesis protein C-terminal domain-containing protein 0.9772 244 497 GO:0005886
GO:0008360
GO:0009252
GO:0015648
GO:0034204
AF-X1VEC7-F1-model_v4 Polysaccharide biosynthesis protein C-terminal domain-containing protein 0.9697 244 497 GO:0005886
GO:0008360
GO:0009252
GO:0015648
GO:0034204
AF-A0A7S1EKD6-F1-model_v4 Polysaccharide biosynthesis protein C-terminal domain-containing protein 0.9556 228 426 GO:0005886
GO:0008360
GO:0015648
GO:0034204
AF-A0A7V9WK94-F1-model_v4 Polysaccharide biosynthesis C-terminal domain-containing protein 0.9345 299 509 GO:0005886
GO:0008360
GO:0009252
GO:0015648
GO:0034204
AF-A0A7V9WK94-F1-model_v4 Polysaccharide biosynthesis C-terminal domain-containing protein 0.922 299 509 GO:0005886
GO:0008360
GO:0009252
GO:0015648
GO:0034204

Feature Viewer

pLDDT pTM Quality
81.74 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map