F268971

General Info

Members Datasets Scaffolds Average Seq Length
176 134 352 256

Family's Representative Sequence

Representative Sequence 3300048914|Ga0496111_0184338|Ga0496111_0184338_243_1100
Length 285
Sequence VTVEYLDPVELPILGSVTDATTEQTADRTRPLALVTGGGTGIGAAIARRLSRDGFDVVVAGRRKDRLDEVVAGIEQSGGTARALVMDVTDPESVTTGTGSLGRCDVVVNNAGGALGVTRVEDGDPEEWERMYATNVVGTLRVTQAVLPLLRRSARATVVDISSIAGERVYEGGGGYVAAKHGTSVVSETLRLELNGENIRVVDIRPGMVRTEEFSLTRLHGDQAAADKVYDDVDRPLVADDVAECVGFVVGLPQHVNIDTMVIKPVAQAAPHKIHRGPIDWKDAR

Samples

Sample ID Description Type Environment
1 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
5 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
6 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
7 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
8 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
9 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
10 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
11 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
12 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
13 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
18 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
19 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
20 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
21 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
22 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
23 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
24 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
25 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
26 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
27 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
28 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
29 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
30 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
31 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
32 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
33 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
34 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
35 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
42 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
43 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
44 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
45 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
46 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
47 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
48 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
49 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
50 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
51 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
52 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
53 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
54 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
55 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
56 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
57 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
58 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
59 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
60 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
61 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
62 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
63 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
64 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
65 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
66 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
67 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
68 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
69 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
70 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
71 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
72 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
73 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
74 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
75 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
76 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
77 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
78 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
79 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
80 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
81 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
82 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
83 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
84 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
85 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
86 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
87 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
88 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
89 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
90 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
91 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
92 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
93 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
94 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
95 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
96 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
97 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
98 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
99 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
100 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
101 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
102 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
103 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
104 2626541554 Frankia sp. AvcI.1 Isolate Nodule
105 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
106 2643221616 Leifsonia sp. Root227 Isolate Unclassified
107 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
108 2643221679 Angustibacter sp. Root456 Isolate Unclassified
109 2643221711 Terrabacter sp. Root85 Isolate Unclassified
110 2808606700 Arthrobacter agilis UMCV2 Isolate Rhizosphere
111 2811994882 Terrabacter sp. SLBN-196 Isolate Unclassified
112 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified
113 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
114 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
115 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
116 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
117 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
118 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
119 2862574272 Streptomyces sp. AcE210 Isolate Nodule
120 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
121 2887443736 Ruania rhizosphaerae LNNU 22110 Isolate Rhizosphere
122 2904501621 Curtobacterium sp. 1909 Isolate Unclassified
123 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
124 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
125 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
126 2919523602 Leifsonia shinshuensis 3821 Isolate Unclassified
127 2928153084 Leifsonia sp. 563 Isolate Unclassified
128 2964326757 Planctomonas psychrotolerans J5903 Isolate Rhizosphere
129 2984592036 Aeromicrobium sp. SORGH_AS981 Isolate Aerial Root
130 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
131 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere
132 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
133 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
134 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 79.55
Metatranscriptomes 2.84
Isolates 17.61

Biome Distribution

Category Percentage (%)
Aerial Root 0.57
Bulb 0
Endosphere 17.05
Nodule 1.14
Rhizoplane 11.93
Rhizosphere 57.39
Stem 0
Stem Tuber 0.57
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496111_0184338 3300048914 Bacteria 1552
2 JGI24735J21928_10001102 3300002067 Bacteria 9670
3 JGI25162J39368_1008484 3300002737 Bacteria 1470
4 JGI25164J39214_1000917 3300002772 Bacteria 9799
5 JGI25165J46597_1000044 3300003214 Bacteria 263289
6 Ga0006562J51391_1014374 3300003578 Bacteria 18050
7 Ga0006562J51391_1014378 3300003578 Bacteria 9390
8 Ga0006562J51391_1102973 3300003578 Bacteria 2140
9 Ga0006562J51391_1102974 3300003578 Bacteria 2021
10 Ga0055539_1000027 3300003752 Bacteria 258020
11 Ga0055533_1000020 3300003756 Bacteria 353998
12 Ga0055525_1000296 3300003759 Bacteria 43199
13 Ga0055525_1003675 3300003759 Bacteria 1356
14 Ga0055527_1000005 3300003760 Bacteria 504776
15 Ga0055542_1000006 3300003762 Bacteria 504776
16 Ga0055529_1000013 3300003763 Bacteria 373267
17 Ga0055541_1002903 3300003841 Bacteria 3310
18 Ga0070658_10007450 3300005327 Bacteria 8835
19 Ga0070658_10305364 3300005327 Bacteria 1357
20 Ga0070660_100407286 3300005339 Bacteria 1125
21 Ga0070661_100091217 3300005344 Bacteria 2257
22 Ga0070664_100079362 3300005564 Bacteria 2825
23 Ga0068860_100324720 3300005843 Bacteria 1511
24 Ga0081455_10003571 3300005937 Bacteria 17853
25 Ga0105237_10488007 3300009545 Bacteria 1238
26 Ga0157369_10042139 3300013105 Bacteria 4981
27 Ga0157369_10473648 3300013105 Bacteria 1296
28 Ga0157375_10477389 3300013308 Bacteria 1412
29 Ga0206353_11269635 3300020082 Bacteria 2796
30 Ga0209566_100043 3300025225 Bacteria 266609
31 Ga0209674_100001 3300025226 Bacteria 4013750
32 Ga0209672_100003 3300025228 Bacteria 1560476
33 Ga0209147_100561 3300025229 Bacteria 20914
34 Ga0209563_100001 3300025230 Bacteria 4013775
35 Ga0209563_100497 3300025230 Bacteria 13325
36 Ga0207427_100126 3300025231 Bacteria 95170
37 Ga0209437_101068 3300025233 Bacteria 8913
38 Ga0209677_100001 3300025253 Bacteria 4013787
39 Ga0209148_1000004 3300025254 Bacteria 1844481
40 Ga0209233_1000014 3300025261 Bacteria 996641
41 Ga0209455_1000046 3300025272 Bacteria 382681
42 Ga0207705_10057962 3300025909 Bacteria 2794
43 Ga0207657_10119479 3300025919 Bacteria 2169
44 Ga0207649_10298594 3300025920 Bacteria 1177
45 Ga0207706_10035334 3300025933 Bacteria 4444
46 Ga0207679_10063085 3300025945 Bacteria 2764
47 Ga0207658_10258571 3300025986 Bacteria 1483
48 Ga0307407_10325167 3300031903 Bacteria 1081
49 Ga0307409_100170572 3300031995 Bacteria 1915
50 Ga0395899_0101689 3300037312 Bacteria 2074
51 Ga0395899_0199608 3300037312 Bacteria 1396
52 Ga0395899_0237411 3300037312 Bacteria 1256
53 Ga0395900_0008066 3300037418 Bacteria 10838
54 Ga0395900_0223855 3300037418 Bacteria 1895
55 Ga0395898_0000098 3300037466 Bacteria 229806
56 Ga0395898_0091433 3300037466 Bacteria 2928
57 Ga0395905_0290319 3300037471 Bacteria 1522
58 Ga0395905_0600025 3300037471 Bacteria 1003
59 Ga0395901_0071704 3300038443 Bacteria 3610
60 Ga0395901_0076573 3300038443 Bacteria 3490
61 Ga0395901_0167493 3300038443 Bacteria 2306
62 Ga0395901_0229049 3300038443 Bacteria 1940
63 Ga0395901_0363241 3300038443 Bacteria 1492
64 Ga0439465_0093897 3300041413 Bacteria 1030
65 Ga0451797_0853218 3300041453 Bacteria 896
66 Ga0451806_478366 3300041462 Bacteria 2468
67 Ga0466972_0002889 3300044658 Bacteria 8505
68 Ga0466972_0057927 3300044658 Bacteria 1860
69 Ga0466972_0062066 3300044658 Bacteria 1791
70 Ga0466972_0084354 3300044658 Bacteria 1510
71 Ga0466972_0107284 3300044658 Bacteria 1320
72 Ga0466965_0005401 3300044683 Bacteria 5759
73 Ga0466965_0023460 3300044683 Bacteria 2980
74 Ga0466965_0030277 3300044683 Bacteria 2637
75 Ga0466965_0054636 3300044683 Bacteria 1986
76 Ga0466966_0021373 3300044684 Bacteria 4249
77 Ga0466966_0022616 3300044684 Bacteria 4124
78 Ga0466966_0096424 3300044684 Bacteria 1832
79 Ga0466961_0010395 3300044693 Bacteria 5939
80 Ga0466961_0032645 3300044693 Bacteria 3346
81 Ga0466961_0032783 3300044693 Bacteria 3338
82 Ga0466961_0097447 3300044693 Bacteria 1854
83 Ga0466963_0000571 3300044694 Bacteria 17434
84 Ga0466963_0109166 3300044694 Bacteria 1898
85 Ga0466968_0009831 3300044735 Bacteria 3692
86 Ga0466970_0002080 3300044765 Bacteria 9679
87 Ga0466970_0021018 3300044765 Bacteria 3397
88 Ga0466970_0054902 3300044765 Bacteria 2127
89 Ga0466957_0044761 3300044842 Bacteria 2683
90 Ga0466960_0003931 3300044901 Bacteria 5768
91 Ga0466960_0405949 3300044901 Bacteria 785
92 Ga0466959_0033465 3300045049 Bacteria 3801
93 Ga0466959_0033760 3300045049 Bacteria 3784
94 Ga0466959_0248042 3300045049 Bacteria 1228
95 Ga0466959_0252554 3300045049 Bacteria 1216
96 Ga0466967_0000298 3300045976 Bacteria 22217
97 Ga0495605_0061363 3300046474 Bacteria 1799
98 Ga0495585_0009399 3300046492 Bacteria 5865
99 Ga0495607_0075552 3300046501 Bacteria 1867
100 Ga0495631_0131525 3300046518 Bacteria 1075
101 Ga0495611_0095019 3300046648 Bacteria 1379
102 Ga0495661_0148548 3300046665 Bacteria 1268
103 Ga0495599_0193085 3300046678 Bacteria 1252
104 Ga0495589_0003376 3300046794 Bacteria 8654
105 Ga0495589_0007755 3300046794 Bacteria 5619
106 Ga0495636_0080471 3300047318 Bacteria 1402
107 Ga0495685_001981 3300047447 Bacteria 6353
108 Ga0496100_0032570 3300048903 Bacteria 3253
109 Ga0496100_0152342 3300048903 Bacteria 1650
110 Ga0496101_0002462 3300048904 Bacteria 11371
111 Ga0496102_0021995 3300048905 Bacteria 5647
112 Ga0496102_0423307 3300048905 Bacteria 1251
113 Ga0496103_0020725 3300048906 Bacteria 3952
114 Ga0496104_0007992 3300048907 Bacteria 9379
115 Ga0496104_0028366 3300048907 Bacteria 5188
116 Ga0496105_0029860 3300048908 Bacteria 4463
117 Ga0496108_0255746 3300048911 Bacteria 1524
118 Ga0496108_0346180 3300048911 Bacteria 1297
119 Ga0496109_0356025 3300048912 Bacteria 1383
120 Ga0496111_0408832 3300048914 Bacteria 1003
121 Ga0496112_0309709 3300048915 Bacteria 1524
122 Ga0496113_0258153 3300048916 Bacteria 1392
123 Ga0496114_0018350 3300048917 Bacteria 5657
124 Ga0496114_0081996 3300048917 Bacteria 2725
125 Ga0496115_0576503 3300048918 Bacteria 897
126 Ga0496116_0058606 3300048919 Bacteria 2510
127 Ga0496117_0000214 3300048920 Bacteria 111723
128 Ga0496118_0003500 3300048921 Bacteria 19693
129 Ga0496122_0006061 3300048925 Bacteria 14088
130 Ga0496123_0011537 3300048926 Bacteria 7647
131 Ga0501034_0051826 3300049571 Bacteria 4137
132 Ga0501046_0128469 3300049580 Bacteria 1923
133 Ga0501047_0006440 3300049581 Bacteria 11047
134 Ga0501070_0000044 3300049586 Bacteria 108859
135 Ga0501083_0007852 3300049744 Bacteria 7558
136 Ga0501035_0440019 3300049822 Bacteria 1080
137 Ga0501044_0014846 3300049823 Bacteria 8395
138 Ga0500635_0000004 3300053080 Bacteria 210675
139 Ga0500573_0152245 3300053140 Bacteria 1265
140 Ga0500577_0031328 3300053142 Bacteria 1859
141 Ga0500590_020603 3300053148 Bacteria 3423
142 Ga0500616_0000021 3300053153 Bacteria 484527
143 Ga0500620_000319 3300053155 Bacteria 9097
144 Ga0500645_069863 3300053730 Bacteria 1009
145 Ga0466962_0061785 3300061719 Bacteria 1788
146 2626637962 2626541554 Bacteria 7741902
147 2643852440 2643221567 Bacteria 4163945
148 2644095116 2643221616 Bacteria 4066575
149 2644136963 2643221624 Bacteria 4384879
150 2644444773 2643221679 Bacteria 3839507
151 2644607744 2643221711 Bacteria 4865335
152 2810363931 2808606700 Bacteria 3482157
153 2812373253 2811994882 Bacteria 4688362
154 2819426053 2818991318 Bacteria 5266538
155 2819665111 2818991458 Bacteria 4794049
156 2819692826 2818991462 Bacteria 4320267
157 2819727225 2818991469 Bacteria 4644110
158 2844841595 2844841374 Bacteria 3917147
159 2844855739 2844852863 Bacteria 3849151
160 2862514513 2862507626 Bacteria 9425308
161 2862578346 2862574272 Bacteria 10567477
162 2884764516 2884763398 Bacteria 4091164
163 2887443873 2887443736 Bacteria 4426037
164 2904503278 2904501621 Bacteria 3401437
165 2912730951 2912723979 Bacteria 8557534
166 2919057251 2919055335 Bacteria 3875751
167 2919448129 2919446982 Bacteria 3994487
168 2919523603 2919523602 Bacteria 3788128
169 2928155029 2928153084 Bacteria 4020257
170 2964329087 2964326757 Bacteria 3290868
171 2984593461 2984592036 Bacteria 3670284
172 3006494404 3006493962 Bacteria 8825450
173 8056039607 8056037122 Bacteria 3854319
174 8056454389 8056447290 Bacteria 7680491
175 8056672750 8056667051 Bacteria 6953971
176 8057348500 8057345674 Bacteria 4160394
177 Ga0496111_0184338
178 JGI24735J21928_10001102
179 JGI25162J39368_1008484
180 JGI25164J39214_1000917
181 JGI25165J46597_1000044
182 Ga0006562J51391_1014374
183 Ga0006562J51391_1014378
184 Ga0006562J51391_1102973
185 Ga0006562J51391_1102974
186 Ga0055539_1000027
187 Ga0055533_1000020
188 Ga0055525_1000296
189 Ga0055525_1003675
190 Ga0055527_1000005
191 Ga0055542_1000006
192 Ga0055529_1000013
193 Ga0055541_1002903
194 Ga0070658_10007450
195 Ga0070658_10305364
196 Ga0070660_100407286
197 Ga0070661_100091217
198 Ga0070664_100079362
199 Ga0068860_100324720
200 Ga0081455_10003571
201 Ga0105237_10488007
202 Ga0157369_10042139
203 Ga0157369_10473648
204 Ga0157375_10477389
205 Ga0206353_11269635
206 Ga0209566_100043
207 Ga0209674_100001
208 Ga0209672_100003
209 Ga0209147_100561
210 Ga0209563_100001
211 Ga0209563_100497
212 Ga0207427_100126
213 Ga0209437_101068
214 Ga0209677_100001
215 Ga0209148_1000004
216 Ga0209233_1000014
217 Ga0209455_1000046
218 Ga0207705_10057962
219 Ga0207657_10119479
220 Ga0207649_10298594
221 Ga0207706_10035334
222 Ga0207679_10063085
223 Ga0207658_10258571
224 Ga0307407_10325167
225 Ga0307409_100170572
226 Ga0395899_0101689
227 Ga0395899_0199608
228 Ga0395899_0237411
229 Ga0395900_0008066
230 Ga0395900_0223855
231 Ga0395898_0000098
232 Ga0395898_0091433
233 Ga0395905_0290319
234 Ga0395905_0600025
235 Ga0395901_0071704
236 Ga0395901_0076573
237 Ga0395901_0167493
238 Ga0395901_0229049
239 Ga0395901_0363241
240 Ga0439465_0093897
241 Ga0451797_0853218
242 Ga0451806_478366
243 Ga0466972_0002889
244 Ga0466972_0057927
245 Ga0466972_0062066
246 Ga0466972_0084354
247 Ga0466972_0107284
248 Ga0466965_0005401
249 Ga0466965_0023460
250 Ga0466965_0030277
251 Ga0466965_0054636
252 Ga0466966_0021373
253 Ga0466966_0022616
254 Ga0466966_0096424
255 Ga0466961_0010395
256 Ga0466961_0032645
257 Ga0466961_0032783
258 Ga0466961_0097447
259 Ga0466963_0000571
260 Ga0466963_0109166
261 Ga0466968_0009831
262 Ga0466970_0002080
263 Ga0466970_0021018
264 Ga0466970_0054902
265 Ga0466957_0044761
266 Ga0466960_0003931
267 Ga0466960_0405949
268 Ga0466959_0033465
269 Ga0466959_0033760
270 Ga0466959_0248042
271 Ga0466959_0252554
272 Ga0466967_0000298
273 Ga0495605_0061363
274 Ga0495585_0009399
275 Ga0495607_0075552
276 Ga0495631_0131525
277 Ga0495611_0095019
278 Ga0495661_0148548
279 Ga0495599_0193085
280 Ga0495589_0003376
281 Ga0495589_0007755
282 Ga0495636_0080471
283 Ga0495685_001981
284 Ga0496100_0032570
285 Ga0496100_0152342
286 Ga0496101_0002462
287 Ga0496102_0021995
288 Ga0496102_0423307
289 Ga0496103_0020725
290 Ga0496104_0007992
291 Ga0496104_0028366
292 Ga0496105_0029860
293 Ga0496108_0255746
294 Ga0496108_0346180
295 Ga0496109_0356025
296 Ga0496111_0408832
297 Ga0496112_0309709
298 Ga0496113_0258153
299 Ga0496114_0018350
300 Ga0496114_0081996
301 Ga0496115_0576503
302 Ga0496116_0058606
303 Ga0496117_0000214
304 Ga0496118_0003500
305 Ga0496122_0006061
306 Ga0496123_0011537
307 Ga0501034_0051826
308 Ga0501046_0128469
309 Ga0501047_0006440
310 Ga0501070_0000044
311 Ga0501083_0007852
312 Ga0501035_0440019
313 Ga0501044_0014846
314 Ga0500635_0000004
315 Ga0500573_0152245
316 Ga0500577_0031328
317 Ga0500590_020603
318 Ga0500616_0000021
319 Ga0500620_000319
320 Ga0500645_069863
321 Ga0466962_0061785
322 2626637962
323 2643852440
324 2644095116
325 2644136963
326 2644444773
327 2644607744
328 2810363931
329 2812373253
330 2819426053
331 2819665111
332 2819692826
333 2819727225
334 2844841595
335 2844855739
336 2862514513
337 2862578346
338 2884764516
339 2887443873
340 2904503278
341 2912730951
342 2919057251
343 2919448129
344 2919523603
345 2928155029
346 2964329087
347 2984593461
348 3006494404
349 8056039607
350 8056454389
351 8056672750
352 8057348500

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

31

219

0.97

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

37

251

0.92

PF08659

KR

KR domain

32

204

0.87

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

33

175

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
3asu-assembly1.cif.gz_A-2 crystal structure of serine dehydrogenase from escherichia coli 0.9253 4 244
3asu-assembly1.cif.gz_B-2 crystal structure of serine dehydrogenase from escherichia coli 0.9215 4 244
3p19-assembly1.cif.gz_B improved nadph-dependent blue fluorescent protein 0.9181 3 242
3asu-assembly1.cif.gz_A-2 crystal structure of serine dehydrogenase from escherichia coli 0.9171 4 244
1xg5-assembly1.cif.gz_C structure of human putative dehydrogenase mgc4172 in complex with nadp 0.9152 2 242
ID Description Score Start End Superfamily
af_P9WGR5_6_248_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9773 2 250 3.40.50.720
af_P9WGR5_6_248_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9615 2 250 3.40.50.720
af_A0A0P0WC51_15_133_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.951 3 77 3.40.50.720
af_A0A0R0HUJ2_8_65_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9227 4 47 3.40.50.720
af_A0A0P0Y501_3_211_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9216 3 186 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7C8BTM6-F1-model_v4 SDR family oxidoreductase 0.9892 1 256 GO:0016491
AF-A0A0Q5MPN0-F1-model_v4 Oxidoreductase 0.9865 1 256 GO:0016491
AF-A0A169C1S1-F1-model_v4 Oxidoreductase 0.9865 7 257 GO:0016491
AF-A0A5P9Q8R2-F1-model_v4 Putative oxidoreductase 0.9837 2 252 GO:0016491
AF-A0A2T6LFU9-F1-model_v4 NADP-dependent 3-hydroxy acid dehydrogenase YdfG 0.9836 2 253 GO:0016491

Map