F269017

General Info

Members Datasets Scaffolds Average Seq Length
176 126 353 408

Family's Representative Sequence

Representative Sequence 3300049570|Ga0501033_0055800|Ga0501033_0055800_1224_2603
Length 459
Sequence MAETKVAPAQQDTEAGHALPPDGSARDLRPPAEAMDGAAANGSGQSDPTAGRPGGSGAFGRGSNQAGVRLYNERLVLSLIRHHSSLPKADIARLTGLTPQTISLIINQLTADGLLLKGKPQRGRVGQPSVPYSLNPEGAFSFGLKIGRRSADLYLINFDGKVLKLLHEVYRYPTPEGIRRFAVEGVDELLQGLPAEWIGRIAGLGIAAPYEMWTWPEELGAPQADCDAWRTADMRAELARFCSWPVYFHNDITAACAAELMFGRGSDYIDYLYVFIGSFIGGGLVLDGHLFPGRTLNAGALGSIPAHDADPAAPQLMNRASIYVLERKLEAQGRNADILWRSPDDWGDDLGPALDEWIEEVAVSLAYAIIAAIAVIDVETVIIDGAFPRHVRARIIERTRWAIERINRQGLSPFTLVEGSIGNAARAMGGAAIPLLANFTQDREVLFKDRPAASPLAHN

Samples

Sample ID Description Type Environment
1 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
2 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
3 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
29 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
33 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
35 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
36 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
37 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
38 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
39 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
40 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
41 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
42 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
43 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
44 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
45 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
46 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
47 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
48 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
49 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
50 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
51 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
52 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
67 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
68 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
69 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
70 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
71 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
72 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
73 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
74 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
75 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
76 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
77 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
78 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
79 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
80 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
81 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
82 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
83 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
84 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
85 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
86 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
87 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
88 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
89 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
90 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
91 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
92 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
93 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
94 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
95 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
96 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
97 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
98 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
99 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
100 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
110 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
111 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
113 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
114 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
115 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
116 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
117 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
118 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
119 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
120 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
121 2643221629 Devosia sp. Root105 Isolate Unclassified
122 2643221662 Devosia sp. Root413D1 Isolate Unclassified
123 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
124 2854681122 Luteovulum sphaeroides SCJ Isolate Unclassified
125 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
126 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.02
Metatranscriptomes 0
Isolates 3.98

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.09
Nodule 0
Rhizoplane 1.14
Rhizosphere 74.43
Stem 0
Stem Tuber 0
Unclassified 6.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501033_0055800 3300049570 Bacteria 2920
2 JGI25150J39212_1000026 3300002774 Bacteria 107804
3 JGI25159J45721_1000003 3300002987 Bacteria 274069
4 JGI25151J46595_10000053 3300003187 Bacteria 156841
5 JGI25151J46595_10005983 3300003187 Bacteria 6193
6 JGI25153J46596_10002629 3300003215 Bacteria 10274
7 rootH2_10102181 3300003320 Bacteria 2848
8 rootH1_10035930 3300003316 Bacteria 3678
9 rootH1_10035930 3300003323 Bacteria 9579
10 rootH1_10162429 3300003323 Bacteria 2247
11 Ga0070658_10002384 3300005327 Bacteria 15783
12 Ga0070658_10068797 3300005327 Bacteria 2895
13 Ga0070660_100004356 3300005339 Bacteria 9776
14 Ga0070661_100002956 3300005344 Bacteria 11725
15 Ga0070661_100036130 3300005344 Bacteria 3591
16 Ga0070675_100164027 3300005354 Bacteria 1913
17 Ga0070674_100022599 3300005356 Bacteria 4059
18 Ga0070659_100009384 3300005366 Bacteria 7186
19 Ga0070667_100174466 3300005367 Bacteria 1899
20 Ga0070708_100003610 3300005445 Bacteria 12141
21 Ga0070663_100071887 3300005455 Bacteria 2518
22 Ga0070706_100001248 3300005467 Bacteria 27231
23 Ga0070706_100054817 3300005467 Bacteria 3680
24 Ga0070707_100006738 3300005468 Bacteria 10645
25 Ga0070698_100004303 3300005471 Bacteria 15664
26 Ga0070698_100264973 3300005471 Bacteria 1650
27 Ga0070699_100045636 3300005518 Bacteria 3793
28 Ga0068853_100100268 3300005539 Bacteria 2560
29 Ga0070696_100013007 3300005546 Bacteria 5584
30 Ga0070665_100204844 3300005548 Unclassified 1973
31 Ga0068855_100043568 3300005563 Bacteria 5315
32 Ga0068855_100254769 3300005563 Bacteria 1957
33 Ga0068857_100037943 3300005577 Bacteria 4268
34 Ga0068856_100029490 3300005614 Bacteria 5359
35 Ga0068856_100349392 3300005614 Bacteria 1497
36 Ga0068852_100005219 3300005616 Bacteria 9263
37 Ga0068852_100007676 3300005616 Bacteria 7890
38 Ga0068852_100124986 3300005616 Bacteria 2360
39 Ga0068862_100129418 3300005844 Bacteria 2232
40 Ga0081538_10002139 3300005981 Bacteria 19677
41 Ga0070717_10004154 3300006028 Bacteria 10436
42 Ga0075428_100180430 3300006844 Bacteria 2286
43 Ga0068865_100121989 3300006881 Bacteria 1940
44 Ga0111539_10000600 3300009094 Bacteria 46579
45 Ga0105241_10028332 3300009174 Bacteria 4174
46 Ga0105238_10078272 3300009551 Bacteria 3297
47 Ga0105239_10027356 3300010375 Bacteria 6278
48 Ga0105239_10095224 3300010375 Bacteria 3289
49 Ga0157371_10013041 3300013102 Bacteria 6328
50 Ga0157370_10009366 3300013104 Bacteria 10474
51 Ga0157370_10013336 3300013104 Bacteria 8465
52 Ga0157369_10019547 3300013105 Bacteria 7579
53 Ga0157369_10180756 3300013105 Bacteria 2219
54 Ga0157372_10208452 3300013307 Bacteria 2265
55 Ga0157380_10004591 3300014326 Bacteria 9590
56 Ga0213872_10094727 3300021361 Bacteria 1334
57 Ga0213876_10017686 3300021384 Bacteria 3761
58 Ga0213871_10007224 3300021441 Unclassified 2391
59 Ga0207427_102135 3300025231 Bacteria 5716
60 Ga0207425_1000104 3300025245 Bacteria 79793
61 Ga0209129_1000181 3300025258 Bacteria 89982
62 Ga0209233_1001631 3300025261 Bacteria 8730
63 Ga0209673_1016610 3300025273 Bacteria 2743
64 Ga0209025_1000181 3300025294 Bacteria 156894
65 Ga0209758_1000156 3300025297 Bacteria 156894
66 Ga0207645_10028450 3300025907 Bacteria 3607
67 Ga0207705_10003617 3300025909 Bacteria 11774
68 Ga0207684_10000434 3300025910 Bacteria 55507
69 Ga0207684_10072784 3300025910 Bacteria 2919
70 Ga0207707_10313696 3300025912 Bacteria 1355
71 Ga0207657_10003579 3300025919 Bacteria 16574
72 Ga0207657_10006840 3300025919 Bacteria 11765
73 Ga0207646_10008095 3300025922 Bacteria 10594
74 Ga0207694_10027023 3300025924 Bacteria 4369
75 Ga0207669_10002893 3300025937 Bacteria 7365
76 Ga0207667_10008878 3300025949 Bacteria 11896
77 Ga0207667_10023438 3300025949 Bacteria 6797
78 Ga0207678_10056960 3300026067 Bacteria 3364
79 Ga0207702_10008133 3300026078 Bacteria 8875
80 Ga0207702_10034572 3300026078 Bacteria 4226
81 Ga0207674_10114636 3300026116 Bacteria 2667
82 Ga0207675_100079553 3300026118 Bacteria 3072
83 Ga0207675_100255105 3300026118 Unclassified 1698
84 Ga0207698_10009753 3300026142 Bacteria 6133
85 Ga0207428_10001207 3300027907 Bacteria 27710
86 Ga0265330_10007858 3300031235 Bacteria 5171
87 Ga0265330_10023851 3300031235 Bacteria 2776
88 Ga0265328_10019046 3300031239 Bacteria 2641
89 Ga0265325_10037129 3300031241 Bacteria 2576
90 Ga0265340_10000264 3300031247 Bacteria 27200
91 Ga0265339_10010627 3300031249 Bacteria 5708
92 Ga0265339_10022915 3300031249 Bacteria 3612
93 Ga0265316_10009686 3300031344 Bacteria 8845
94 Ga0265313_10006384 3300031595 Bacteria 8365
95 Ga0265314_10015010 3300031711 Bacteria 6167
96 Ga0265342_10007507 3300031712 Bacteria 7977
97 Ga0265342_10060829 3300031712 Bacteria 2226
98 Ga0307516_10053978 3300031730 Bacteria 3928
99 Ga0307407_10020794 3300031903 Bacteria 3370
100 Ga0307412_10022169 3300031911 Bacteria 3890
101 Ga0307412_10039363 3300031911 Unclassified 3051
102 Ga0307416_100073267 3300032002 Bacteria 2855
103 Ga0307414_10055137 3300032004 Bacteria 2782
104 Ga0307414_10093293 3300032004 Unclassified 2243
105 Ga0373931_0009893 3300035691 Bacteria 4568
106 Ga0373925_0147774 3300037068 Bacteria 1843
107 Ga0395898_0083765 3300037466 Bacteria 3073
108 Ga0436365_0562176 3300039437 Bacteria 3698
109 Ga0436365_0596749 3300039437 Bacteria 23938
110 Ga0436360_0840270 3300039438 Bacteria 4653
111 Ga0436360_1035629 3300039438 Bacteria 1795
112 Ga0436361_0067957 3300039447 Unclassified 2113
113 Ga0436361_0396022 3300039447 Bacteria 2206
114 Ga0436361_0569675 3300039447 Bacteria 5998
115 Ga0436363_1157952 3300039450 Unclassified 4144
116 Ga0451576_0141212 3300045051 Bacteria 2511
117 Ga0495672_0105082 3300047320 Bacteria 1525
118 Ga0495686_0066305 3300047472 Bacteria 2231
119 Ga0495686_0117963 3300047472 Bacteria 1585
120 Ga0496101_0257460 3300048904 Unclassified 1360
121 Ga0496111_0041994 3300048914 Bacteria 3283
122 Ga0496116_0011088 3300048919 Bacteria 7496
123 Ga0496117_0005505 3300048920 Bacteria 13264
124 Ga0496119_0028529 3300048922 Bacteria 3806
125 Ga0496121_0106973 3300048924 Bacteria 2143
126 Ga0496121_0161225 3300048924 Unclassified 1639
127 Ga0496122_0010267 3300048925 Bacteria 9692
128 Ga0496122_0107655 3300048925 Bacteria 1841
129 Ga0496124_0031884 3300048927 Bacteria 4661
130 Ga0496124_0039317 3300048927 Bacteria 4101
131 Ga0496124_0130987 3300048927 Bacteria 1992
132 Ga0496125_0000290 3300048928 Bacteria 99343
133 Ga0496125_0000376 3300048928 Bacteria 83515
134 Ga0496125_0001401 3300048928 Bacteria 35263
135 Ga0496125_0104821 3300048928 Bacteria 2069
136 Ga0496125_0114256 3300048928 Unclassified 1945
137 Ga0501031_0011362 3300049568 Bacteria 5798
138 Ga0501032_0057177 3300049569 Bacteria 2621
139 Ga0501034_0035062 3300049571 Bacteria 5088
140 Ga0501034_0068313 3300049571 Bacteria 3564
141 Ga0501034_0102536 3300049571 Bacteria 2855
142 Ga0501034_0245926 3300049571 Bacteria 1734
143 Ga0501036_0025484 3300049572 Bacteria 4989
144 Ga0501036_0145528 3300049572 Bacteria 1999
145 Ga0501037_0040584 3300049573 Bacteria 3425
146 Ga0501038_0052399 3300049574 Bacteria 3518
147 Ga0501043_0291571 3300049579 Bacteria 1249
148 Ga0501046_0071297 3300049580 Bacteria 2700
149 Ga0501046_0124797 3300049580 Bacteria 1957
150 Ga0501047_0010891 3300049581 Bacteria 8598
151 Ga0501047_0049556 3300049581 Bacteria 4055
152 Ga0501047_0226954 3300049581 Bacteria 1722
153 Ga0501070_0014927 3300049586 Bacteria 6534
154 Ga0501070_0057526 3300049586 Bacteria 3223
155 Ga0501073_0199438 3300049589 Bacteria 1384
156 Ga0501073_0309674 3300049589 Bacteria 1089
157 Ga0501035_0005035 3300049822 Bacteria 12519
158 Ga0501035_0039446 3300049822 Bacteria 4273
159 Ga0501044_0018787 3300049823 Bacteria 7405
160 Ga0501044_0040143 3300049823 Bacteria 4879
161 Ga0501044_0095867 3300049823 Bacteria 2989
162 Ga0501044_0177605 3300049823 Bacteria 2098
163 nmdc:mga08y16_16_c1 3300050511 Bacteria 386948
164 Ga0500555_008752 3300053103 Bacteria 2889
165 Ga0500595_017751 3300053119 Bacteria 2619
166 Ga0500604_0000260 3300053151 Bacteria 14903
167 Ga0500634_0000002 3300053161 Bacteria 252372
168 Ga0501084_0127434 3300054114 Unclassified 2142
169 Ga0501084_0279174 3300054114 Bacteria 1410
170 Ga0501082_0023929 3300060353 Bacteria 5267
171 2585336379 2582581316 Bacteria 7774528
172 2644167218 2643221629 Bacteria 5850260
173 2644349734 2643221662 Bacteria 5851492
174 2758638051 2758568016 Bacteria 5645291
175 2854685090 2854681122 Bacteria 4548679
176 2891375426 2891373044 Bacteria 5202277
177 8055433133 8055431914 Bacteria 4551896
178 Ga0501033_0055800
179 JGI25150J39212_1000026
180 JGI25159J45721_1000003
181 JGI25151J46595_10000053
182 JGI25151J46595_10005983
183 JGI25153J46596_10002629
184 rootH2_10102181
185 rootH1_10035930
186 rootH1_10162429
187 Ga0070658_10002384
188 Ga0070658_10068797
189 Ga0070660_100004356
190 Ga0070661_100002956
191 Ga0070661_100036130
192 Ga0070675_100164027
193 Ga0070674_100022599
194 Ga0070659_100009384
195 Ga0070667_100174466
196 Ga0070708_100003610
197 Ga0070663_100071887
198 Ga0070706_100001248
199 Ga0070706_100054817
200 Ga0070707_100006738
201 Ga0070698_100004303
202 Ga0070698_100264973
203 Ga0070699_100045636
204 Ga0068853_100100268
205 Ga0070696_100013007
206 Ga0070665_100204844
207 Ga0068855_100043568
208 Ga0068855_100254769
209 Ga0068857_100037943
210 Ga0068856_100029490
211 Ga0068856_100349392
212 Ga0068852_100005219
213 Ga0068852_100007676
214 Ga0068852_100124986
215 Ga0068862_100129418
216 Ga0081538_10002139
217 Ga0070717_10004154
218 Ga0075428_100180430
219 Ga0068865_100121989
220 Ga0111539_10000600
221 Ga0105241_10028332
222 Ga0105238_10078272
223 Ga0105239_10027356
224 Ga0105239_10095224
225 Ga0157371_10013041
226 Ga0157370_10009366
227 Ga0157370_10013336
228 Ga0157369_10019547
229 Ga0157369_10180756
230 Ga0157372_10208452
231 Ga0157380_10004591
232 Ga0213872_10094727
233 Ga0213876_10017686
234 Ga0213871_10007224
235 Ga0207427_102135
236 Ga0207425_1000104
237 Ga0209129_1000181
238 Ga0209233_1001631
239 Ga0209673_1016610
240 Ga0209025_1000181
241 Ga0209758_1000156
242 Ga0207645_10028450
243 Ga0207705_10003617
244 Ga0207684_10000434
245 Ga0207684_10072784
246 Ga0207707_10313696
247 Ga0207657_10003579
248 Ga0207657_10006840
249 Ga0207646_10008095
250 Ga0207694_10027023
251 Ga0207669_10002893
252 Ga0207667_10008878
253 Ga0207667_10023438
254 Ga0207678_10056960
255 Ga0207702_10008133
256 Ga0207702_10034572
257 Ga0207674_10114636
258 Ga0207675_100079553
259 Ga0207675_100255105
260 Ga0207698_10009753
261 Ga0207428_10001207
262 Ga0265330_10007858
263 Ga0265330_10023851
264 Ga0265328_10019046
265 Ga0265325_10037129
266 Ga0265340_10000264
267 Ga0265339_10010627
268 Ga0265339_10022915
269 Ga0265316_10009686
270 Ga0265313_10006384
271 Ga0265314_10015010
272 Ga0265342_10007507
273 Ga0265342_10060829
274 Ga0307516_10053978
275 Ga0307407_10020794
276 Ga0307412_10022169
277 Ga0307412_10039363
278 Ga0307416_100073267
279 Ga0307414_10055137
280 Ga0307414_10093293
281 Ga0373931_0009893
282 Ga0373925_0147774
283 Ga0395898_0083765
284 Ga0436365_0562176
285 Ga0436365_0596749
286 Ga0436360_0840270
287 Ga0436360_1035629
288 Ga0436361_0067957
289 Ga0436361_0396022
290 Ga0436361_0569675
291 Ga0436363_1157952
292 Ga0451576_0141212
293 Ga0495672_0105082
294 Ga0495686_0066305
295 Ga0495686_0117963
296 Ga0496101_0257460
297 Ga0496111_0041994
298 Ga0496116_0011088
299 Ga0496117_0005505
300 Ga0496119_0028529
301 Ga0496121_0106973
302 Ga0496121_0161225
303 Ga0496122_0010267
304 Ga0496122_0107655
305 Ga0496124_0031884
306 Ga0496124_0039317
307 Ga0496124_0130987
308 Ga0496125_0000290
309 Ga0496125_0000376
310 Ga0496125_0001401
311 Ga0496125_0104821
312 Ga0496125_0114256
313 Ga0501031_0011362
314 Ga0501032_0057177
315 Ga0501034_0035062
316 Ga0501034_0068313
317 Ga0501034_0102536
318 Ga0501034_0245926
319 Ga0501036_0025484
320 Ga0501036_0145528
321 Ga0501037_0040584
322 Ga0501038_0052399
323 Ga0501043_0291571
324 Ga0501046_0071297
325 Ga0501046_0124797
326 Ga0501047_0010891
327 Ga0501047_0049556
328 Ga0501047_0226954
329 Ga0501070_0014927
330 Ga0501070_0057526
331 Ga0501073_0199438
332 Ga0501073_0309674
333 Ga0501035_0005035
334 Ga0501035_0039446
335 Ga0501044_0018787
336 Ga0501044_0040143
337 Ga0501044_0095867
338 Ga0501044_0177605
339 nmdc:mga08y16_16_c1
340 Ga0500555_008752
341 Ga0500595_017751
342 Ga0500604_0000260
343 Ga0500634_0000002
344 Ga0501084_0127434
345 Ga0501084_0279174
346 Ga0501082_0023929
347 2585336379
348 2644167218
349 2644349734
350 2758638051
351 2854685090
352 2891375426
353 8055433133

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13412

HTH_24

Winged helix-turn-helix DNA-binding

69

115

0.95

PF00480

ROK

ROK family

141

315

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
5zup-assembly1.cif.gz_A crystal structure of bz junction in diverse sequence 0.9495 50 82
5yhx-assembly1.cif.gz_B structure of lactococcus lactis zitr, wild type 0.9448 34 97
4awx-assembly1.cif.gz_B moonlighting functions of feoc in the regulation of ferrous iron transport in feo 0.943 36 98
5yhx-assembly2.cif.gz_H structure of lactococcus lactis zitr, wild type 0.937 34 97
2vxz-assembly1.cif.gz_A crystal structure of hypothetical protein pyrsv_gp04 from pyrobaculum spherical virus 0.9268 30 97
ID Description Score Start End Superfamily
4awxB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.943 36 98 1.10.10.10
af_Q2FY97_1_107_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9366 35 82 1.10.10.10
af_O53151_36_154_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9304 34 101 1.10.10.10
2cfxG01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9228 35 76 1.10.10.10
4kmfA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9185 31 97 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A848VZM4-F1-model_v4 ROK family transcriptional regulator 0.968 35 404 GO:0003700
GO:0009384
GO:0019262
AF-A0A832J4Q2-F1-model_v4 ROK family protein 0.9595 112 414 GO:0009384
GO:0019262
AF-A0A832J4Q2-F1-model_v4 ROK family protein 0.9564 112 414 GO:0009384
GO:0019262
AF-A0A848VZM4-F1-model_v4 ROK family transcriptional regulator 0.9502 35 404 GO:0003700
GO:0009384
GO:0019262
AF-A0A1I7A0V4-F1-model_v4 deleted 0.9319 35 403

Map