F269083
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 176 | 140 | 170 | 122 |
Family's Representative Sequence
| Representative Sequence | 3300049761|Ga0501264_000794|Ga0501264_000794_2161_2601 |
| Length | 146 |
| Sequence | LITKINFTDLKKIGKLLCRLTVKQMRHNAKSIRPFLGAKDFSISRSFYKDLGFEESILTHNLSYFKTNDMGFYLQDAYVRDWIDNTMVFLEVDDVSRYWNELLALDLTTRYKDVRLVPIRELDWGREFFLHDPSGILWHFGEFRKD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2599185184 | Mucilaginibacter sp. NFR10 | Isolate | Rhizoplane |
| 2 | 2881247448 | Flavobacterium beibuense RSKm HC5 | Isolate | Rhizosphere |
| 3 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 4 | 2928147474 | Mucilaginibacter rubeus 2025 | Isolate | Unclassified |
| 5 | 2929239360 | Chitinophaga sp. R-73072 Hybrid assembly | Isolate | Unclassified |
| 6 | 2932082852 | Mucilaginibacter sp. 3215 | Isolate | Rhizosphere |
| 7 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 8 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 9 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 10 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 11 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 12 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 13 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 24 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 29 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 30 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 31 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 32 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 33 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 34 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 35 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 36 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 37 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 38 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 39 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 40 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 41 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 58 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 60 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 62 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 63 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 91 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 92 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 93 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 94 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 95 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 96 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 97 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 98 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 99 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 100 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 101 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 102 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 103 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 104 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 105 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 106 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 118 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 119 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 120 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 121 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 122 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 125 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 126 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 127 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 128 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 129 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 130 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 131 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 132 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 133 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 134 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 135 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 136 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 137 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 138 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 139 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 140 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.59 |
| Metatranscriptomes | 0 |
| Isolates | 3.41 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.39 |
| Nodule | 0 |
| Rhizoplane | 1.14 |
| Rhizosphere | 81.25 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.23 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10036291 | 3300001979 | Bacteria | 1533 |
| 2 | JGI24737J22298_10000230 | 3300001990 | Bacteria | 18503 |
| 3 | JGI24735J21928_10000004 | 3300002067 | Bacteria | 381713 |
| 4 | rootH2_10211142 | 3300003320 | Bacteria | 2307 |
| 5 | rootL2_10031439 | 3300003322 | Bacteria | 13803 |
| 6 | rootL2_10265696 | 3300003322 | Bacteria | 1479 |
| 7 | rootH1_10306926 | 3300003323 | Bacteria | 1972 |
| 8 | Ga0070658_10041023 | 3300005327 | Bacteria | 3734 |
| 9 | Ga0070676_10003395 | 3300005328 | Bacteria | 8289 |
| 10 | Ga0070666_10051698 | 3300005335 | Bacteria | 2768 |
| 11 | Ga0070680_100008376 | 3300005336 | Bacteria | 7918 |
| 12 | Ga0070675_100042714 | 3300005354 | Bacteria | 3704 |
| 13 | Ga0070674_100044055 | 3300005356 | Unclassified | 3039 |
| 14 | Ga0070673_100010851 | 3300005364 | Bacteria | 6191 |
| 15 | Ga0070667_100082694 | 3300005367 | Unclassified | 2750 |
| 16 | Ga0070678_100008222 | 3300005456 | Bacteria | 6237 |
| 17 | Ga0070681_10004301 | 3300005458 | Bacteria | 13524 |
| 18 | Ga0068867_100048057 | 3300005459 | Bacteria | 3138 |
| 19 | Ga0068867_100872456 | 3300005459 | Bacteria | 808 |
| 20 | Ga0070685_10346500 | 3300005466 | Bacteria | 1014 |
| 21 | Ga0070685_10642476 | 3300005466 | Bacteria | 768 |
| 22 | Ga0070679_100003612 | 3300005530 | Bacteria | 14138 |
| 23 | Ga0070672_100010882 | 3300005543 | Bacteria | 6326 |
| 24 | Ga0070665_100006153 | 3300005548 | Bacteria | 12275 |
| 25 | Ga0068855_100035520 | 3300005563 | Bacteria | 5936 |
| 26 | Ga0068857_100468024 | 3300005577 | Bacteria | 1180 |
| 27 | Ga0068852_101144062 | 3300005616 | Unclassified | 799 |
| 28 | Ga0068852_102075327 | 3300005616 | Unclassified | 590 |
| 29 | Ga0068859_100081433 | 3300005617 | Unclassified | 3280 |
| 30 | Ga0068861_100988501 | 3300005719 | Unclassified | 802 |
| 31 | Ga0068870_10020993 | 3300005840 | Bacteria | 3189 |
| 32 | Ga0068858_101210155 | 3300005842 | Bacteria | 743 |
| 33 | Ga0068860_100000060 | 3300005843 | Bacteria | 195631 |
| 34 | Ga0068862_100624300 | 3300005844 | Bacteria | 1037 |
| 35 | Ga0075366_10064297 | 3300006195 | Bacteria | 2182 |
| 36 | Ga0097621_100033983 | 3300006237 | Bacteria | 4065 |
| 37 | Ga0068871_100049730 | 3300006358 | Bacteria | 3389 |
| 38 | Ga0068865_100030543 | 3300006881 | Bacteria | 3585 |
| 39 | Ga0097620_100081432 | 3300006931 | Unclassified | 3280 |
| 40 | Ga0105240_10042163 | 3300009093 | Bacteria | 5818 |
| 41 | Ga0105240_10448505 | 3300009093 | Unclassified | 1444 |
| 42 | Ga0105241_10000859 | 3300009174 | Bacteria | 23042 |
| 43 | Ga0105241_10109969 | 3300009174 | Unclassified | 2204 |
| 44 | Ga0105241_10859680 | 3300009174 | Bacteria | 839 |
| 45 | Ga0105237_10000082 | 3300009545 | Bacteria | 127340 |
| 46 | Ga0105237_10000971 | 3300009545 | Bacteria | 38512 |
| 47 | Ga0105237_10001472 | 3300009545 | Bacteria | 31032 |
| 48 | Ga0105238_10111721 | 3300009551 | Bacteria | 2713 |
| 49 | Ga0105238_10576087 | 3300009551 | Bacteria | 1132 |
| 50 | Ga0105249_10184501 | 3300009553 | Bacteria | 2032 |
| 51 | Ga0105249_10823568 | 3300009553 | Bacteria | 993 |
| 52 | Ga0105239_10001880 | 3300010375 | Bacteria | 27460 |
| 53 | Ga0105239_10338346 | 3300010375 | Unclassified | 1698 |
| 54 | Ga0105239_11995481 | 3300010375 | Bacteria | 673 |
| 55 | Ga0105246_10044579 | 3300011119 | Bacteria | 3015 |
| 56 | Ga0157371_10060681 | 3300013102 | Bacteria | 2681 |
| 57 | Ga0157371_10456646 | 3300013102 | Bacteria | 940 |
| 58 | Ga0157370_10012100 | 3300013104 | Bacteria | 8977 |
| 59 | Ga0157369_10120590 | 3300013105 | Bacteria | 2783 |
| 60 | Ga0157378_10055139 | 3300013297 | Bacteria | 3540 |
| 61 | Ga0163162_10011617 | 3300013306 | Bacteria | 8585 |
| 62 | Ga0157372_10002753 | 3300013307 | Bacteria | 19009 |
| 63 | Ga0157375_10017416 | 3300013308 | Bacteria | 6483 |
| 64 | Ga0157375_11093279 | 3300013308 | Unclassified | 933 |
| 65 | Ga0157380_11115412 | 3300014326 | Bacteria | 828 |
| 66 | Ga0182008_10000314 | 3300014497 | Bacteria | 38050 |
| 67 | Ga0157379_10812027 | 3300014968 | Unclassified | 883 |
| 68 | Ga0182006_1013313 | 3300015261 | Bacteria | 3572 |
| 69 | Ga0163161_10022869 | 3300017792 | Bacteria | 4404 |
| 70 | Ga0163161_11125339 | 3300017792 | Bacteria | 676 |
| 71 | Ga0209258_117401 | 3300025242 | Bacteria | 789 |
| 72 | Ga0209026_1000472 | 3300025250 | Bacteria | 30801 |
| 73 | Ga0207682_10032391 | 3300025893 | Bacteria | 2101 |
| 74 | Ga0207688_10025915 | 3300025901 | Unclassified | 3223 |
| 75 | Ga0207680_10022599 | 3300025903 | Bacteria | 3423 |
| 76 | Ga0207645_10000240 | 3300025907 | Bacteria | 45336 |
| 77 | Ga0207643_10014743 | 3300025908 | Bacteria | 4250 |
| 78 | Ga0207705_10322295 | 3300025909 | Bacteria | 1188 |
| 79 | Ga0207695_10000117 | 3300025913 | Bacteria | 237982 |
| 80 | Ga0207695_10170051 | 3300025913 | Bacteria | 2105 |
| 81 | Ga0207671_10000341 | 3300025914 | Bacteria | 68530 |
| 82 | Ga0207671_10005171 | 3300025914 | Bacteria | 12131 |
| 83 | Ga0207660_10007437 | 3300025917 | Bacteria | 7087 |
| 84 | Ga0207652_10001956 | 3300025921 | Bacteria | 17833 |
| 85 | Ga0207694_10428941 | 3300025924 | Bacteria | 1102 |
| 86 | Ga0207669_10501047 | 3300025937 | Bacteria | 971 |
| 87 | Ga0207704_10009382 | 3300025938 | Bacteria | 4720 |
| 88 | Ga0207691_10005539 | 3300025940 | Bacteria | 12195 |
| 89 | Ga0207689_10033599 | 3300025942 | Bacteria | 4261 |
| 90 | Ga0207667_10016927 | 3300025949 | Bacteria | 8223 |
| 91 | Ga0207651_11231185 | 3300025960 | Bacteria | 672 |
| 92 | Ga0207712_10631359 | 3300025961 | Bacteria | 929 |
| 93 | Ga0207703_10795627 | 3300026035 | Bacteria | 903 |
| 94 | Ga0207648_10198628 | 3300026089 | Bacteria | 1779 |
| 95 | Ga0207648_10201146 | 3300026089 | Unclassified | 1767 |
| 96 | Ga0207674_10152720 | 3300026116 | Bacteria | 2266 |
| 97 | Ga0207675_100381999 | 3300026118 | Bacteria | 1385 |
| 98 | Ga0207675_100952426 | 3300026118 | Unclassified | 876 |
| 99 | Ga0207683_10002878 | 3300026121 | Bacteria | 15009 |
| 100 | Ga0207698_10458176 | 3300026142 | Bacteria | 1233 |
| 101 | Ga0207698_11477453 | 3300026142 | Unclassified | 695 |
| 102 | Ga0207698_11897620 | 3300026142 | Unclassified | 610 |
| 103 | Ga0209968_1099517 | 3300027526 | Bacteria | 530 |
| 104 | Ga0268266_10214790 | 3300028379 | Bacteria | 1765 |
| 105 | Ga0268264_10000243 | 3300028381 | Bacteria | 102854 |
| 106 | Ga0307517_10012397 | 3300028786 | Bacteria | 11705 |
| 107 | Ga0307515_10000012 | 3300028794 | Bacteria | 582232 |
| 108 | Ga0307515_10343124 | 3300028794 | Bacteria | 1144 |
| 109 | Ga0265338_10161297 | 3300028800 | Bacteria | 1731 |
| 110 | Ga0307513_10336408 | 3300031456 | Bacteria | 1262 |
| 111 | Ga0307408_100230205 | 3300031548 | Bacteria | 1517 |
| 112 | Ga0307408_101306246 | 3300031548 | Bacteria | 680 |
| 113 | Ga0307514_10041510 | 3300031649 | Bacteria | 3623 |
| 114 | Ga0307413_10086617 | 3300031824 | Bacteria | 2026 |
| 115 | Ga0307407_10043476 | 3300031903 | Unclassified | 2526 |
| 116 | Ga0307414_10984783 | 3300032004 | Bacteria | 776 |
| 117 | Ga0307510_10021403 | 3300033180 | Bacteria | 7535 |
| 118 | Ga0395899_0000050 | 3300037312 | Bacteria | 224591 |
| 119 | Ga0450893_0020688 | 3300042532 | Bacteria | 1132 |
| 120 | Ga0451577_0420618 | 3300042876 | Bacteria | 1213 |
| 121 | Ga0451577_1814200 | 3300042876 | Bacteria | 535 |
| 122 | Ga0453683_0824420 | 3300044673 | Unclassified | 611 |
| 123 | Ga0453684_0001262 | 3300044712 | Bacteria | 76072 |
| 124 | Ga0453684_0007407 | 3300044712 | Bacteria | 20211 |
| 125 | Ga0453684_0136053 | 3300044712 | Bacteria | 2942 |
| 126 | Ga0453684_0174344 | 3300044712 | Bacteria | 2531 |
| 127 | Ga0453684_0555934 | 3300044712 | Bacteria | 1263 |
| 128 | Ga0453684_1959260 | 3300044712 | Unclassified | 591 |
| 129 | Ga0451576_0013819 | 3300045051 | Bacteria | 9019 |
| 130 | Ga0451576_0879694 | 3300045051 | Bacteria | 940 |
| 131 | Ga0451576_1645996 | 3300045051 | Unclassified | 665 |
| 132 | Ga0495638_0010944 | 3300046460 | Bacteria | 6273 |
| 133 | Ga0495616_0050234 | 3300046513 | Bacteria | 2087 |
| 134 | Ga0495648_0013877 | 3300046524 | Bacteria | 5931 |
| 135 | Ga0495642_0139199 | 3300046528 | Bacteria | 1047 |
| 136 | Ga0495586_0583038 | 3300046535 | Bacteria | 646 |
| 137 | Ga0495668_0213638 | 3300046616 | Bacteria | 1056 |
| 138 | Ga0495625_0068421 | 3300046660 | Bacteria | 2496 |
| 139 | Ga0495649_0111874 | 3300046694 | Bacteria | 1448 |
| 140 | Ga0495660_0005180 | 3300046810 | Bacteria | 7828 |
| 141 | Ga0495672_0006059 | 3300047320 | Bacteria | 9445 |
| 142 | Ga0495687_000014 | 3300047443 | Bacteria | 366896 |
| 143 | Ga0495687_001360 | 3300047443 | Bacteria | 22645 |
| 144 | Ga0496115_0272932 | 3300048918 | Bacteria | 1389 |
| 145 | Ga0496122_0001017 | 3300048925 | Bacteria | 49635 |
| 146 | Ga0496123_0008390 | 3300048926 | Bacteria | 9499 |
| 147 | Ga0496125_0105521 | 3300048928 | Bacteria | 2059 |
| 148 | Ga0496126_0060914 | 3300048929 | Bacteria | 3392 |
| 149 | Ga0495678_007947 | 3300049459 | Bacteria | 5433 |
| 150 | Ga0495682_0366188 | 3300049460 | Bacteria | 508 |
| 151 | Ga0501202_048536 | 3300049652 | Bacteria | 935 |
| 152 | Ga0501223_106583 | 3300049663 | Bacteria | 582 |
| 153 | Ga0501233_126786 | 3300049668 | Unclassified | 694 |
| 154 | Ga0501236_001479 | 3300049670 | Bacteria | 2664 |
| 155 | Ga0501257_002612 | 3300049686 | Bacteria | 3801 |
| 156 | Ga0501257_102882 | 3300049686 | Bacteria | 751 |
| 157 | Ga0501259_036148 | 3300049688 | Bacteria | 954 |
| 158 | Ga0501241_180584 | 3300049758 | Unclassified | 500 |
| 159 | Ga0501264_000794 | 3300049761 | Bacteria | 4128 |
| 160 | nmdc:mga0k408_83765_c1 | 3300050493 | Bacteria | 1870 |
| 161 | Ga0500583_0006346 | 3300053092 | Bacteria | 4059 |
| 162 | Ga0500651_0675218 | 3300053093 | Unclassified | 554 |
| 163 | Ga0500641_0000071 | 3300053096 | Bacteria | 41571 |
| 164 | Ga0500608_000479 | 3300053122 | Bacteria | 14975 |
| 165 | Ga0500608_267385 | 3300053122 | Unclassified | 656 |
| 166 | Ga0500642_0054986 | 3300053130 | Bacteria | 1769 |
| 167 | Ga0500642_0120381 | 3300053130 | Bacteria | 1227 |
| 168 | Ga0500652_061384 | 3300053131 | Bacteria | 1548 |
| 169 | Ga0500604_0044590 | 3300053151 | Bacteria | 1351 |
| 170 | Ga0500622_0004545 | 3300053156 | Bacteria | 8653 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300017792 | Ga0163161_11125339 | Ga0163161_111253392 | 116 |
| 2 | iso_pu_bacteria | 2599185184 | 2599478413 | 116 |
| 3 | iso_pu_bacteria | 2881247448 | 2881247974 | 116 |
| 4 | iso_pu_bacteria | 2928078545 | 2928080535 | 116 |
| 5 | iso_pu_bacteria | 2928147474 | 2928150726 | 116 |
| 6 | iso_pu_bacteria | 2929239360 | 2929244453 | 116 |
| 7 | iso_pu_bacteria | 2932082852 | 2932083078 | 116 |
| 8 | 3300005466 | Ga0070685_10642476 | Ga0070685_106424762 | 119 |
| 9 | 3300014968 | Ga0157379_10812027 | Ga0157379_108120272 | 119 |
| 10 | 3300001979 | JGI24740J21852_10036291 | JGI24740J21852_100362912 | 120 |
| 11 | 3300001990 | JGI24737J22298_10000230 | JGI24737J22298_100002304 | 120 |
| 12 | 3300002067 | JGI24735J21928_10000004 | JGI24735J21928_1000000424 | 120 |
| 13 | 3300003320 | rootH2_10211142 | rootH2_102111424 | 120 |
| 14 | 3300003322 | rootL2_10031439 | rootL2_100314393 | 120 |
| 15 | 3300003322 | rootL2_10265696 | rootL2_102656962 | 120 |
| 16 | 3300003323 | rootH1_10306926 | rootH1_103069262 | 120 |
| 17 | 3300005327 | Ga0070658_10041023 | Ga0070658_100410231 | 120 |
| 18 | 3300005328 | Ga0070676_10003395 | Ga0070676_100033953 | 120 |
| 19 | 3300005335 | Ga0070666_10051698 | Ga0070666_100516982 | 120 |
| 20 | 3300005336 | Ga0070680_100008376 | Ga0070680_1000083763 | 120 |
| 21 | 3300005354 | Ga0070675_100042714 | Ga0070675_1000427143 | 120 |
| 22 | 3300005356 | Ga0070674_100044055 | Ga0070674_1000440553 | 120 |
| 23 | 3300005364 | Ga0070673_100010851 | Ga0070673_1000108513 | 120 |
| 24 | 3300005367 | Ga0070667_100082694 | Ga0070667_1000826943 | 120 |
| 25 | 3300005456 | Ga0070678_100008222 | Ga0070678_1000082224 | 120 |
| 26 | 3300005458 | Ga0070681_10004301 | Ga0070681_100043014 | 120 |
| 27 | 3300005459 | Ga0068867_100048057 | Ga0068867_1000480573 | 120 |
| 28 | 3300005459 | Ga0068867_100872456 | Ga0068867_1008724562 | 120 |
| 29 | 3300005466 | Ga0070685_10346500 | Ga0070685_103465002 | 120 |
| 30 | 3300005530 | Ga0070679_100003612 | Ga0070679_1000036129 | 120 |
| 31 | 3300005543 | Ga0070672_100010882 | Ga0070672_1000108823 | 120 |
| 32 | 3300005548 | Ga0070665_100006153 | Ga0070665_10000615313 | 120 |
| 33 | 3300005563 | Ga0068855_100035520 | Ga0068855_1000355201 | 120 |
| 34 | 3300005577 | Ga0068857_100468024 | Ga0068857_1004680242 | 120 |
| 35 | 3300005616 | Ga0068852_101144062 | Ga0068852_1011440621 | 120 |
| 36 | 3300005616 | Ga0068852_102075327 | Ga0068852_1020753272 | 120 |
| 37 | 3300005617 | Ga0068859_100081433 | Ga0068859_1000814334 | 120 |
| 38 | 3300005719 | Ga0068861_100988501 | Ga0068861_1009885012 | 120 |
| 39 | 3300005840 | Ga0068870_10020993 | Ga0068870_100209932 | 120 |
| 40 | 3300005842 | Ga0068858_101210155 | Ga0068858_1012101552 | 120 |
| 41 | 3300005843 | Ga0068860_100000060 | Ga0068860_10000006055 | 120 |
| 42 | 3300005844 | Ga0068862_100624300 | Ga0068862_1006243002 | 120 |
| 43 | 3300006195 | Ga0075366_10064297 | Ga0075366_100642973 | 120 |
| 44 | 3300006237 | Ga0097621_100033983 | Ga0097621_1000339833 | 120 |
| 45 | 3300006358 | Ga0068871_100049730 | Ga0068871_1000497303 | 120 |
| 46 | 3300006881 | Ga0068865_100030543 | Ga0068865_1000305433 | 120 |
| 47 | 3300006931 | Ga0097620_100081432 | Ga0097620_1000814324 | 120 |
| 48 | 3300009093 | Ga0105240_10042163 | Ga0105240_100421637 | 120 |
| 49 | 3300009093 | Ga0105240_10448505 | Ga0105240_104485052 | 120 |
| 50 | 3300009174 | Ga0105241_10000859 | Ga0105241_100008595 | 120 |
| 51 | 3300009174 | Ga0105241_10109969 | Ga0105241_101099693 | 120 |
| 52 | 3300009174 | Ga0105241_10859680 | Ga0105241_108596802 | 120 |
| 53 | 3300009545 | Ga0105237_10000082 | Ga0105237_1000008213 | 120 |
| 54 | 3300009545 | Ga0105237_10000971 | Ga0105237_1000097120 | 120 |
| 55 | 3300009545 | Ga0105237_10001472 | Ga0105237_1000147219 | 120 |
| 56 | 3300009551 | Ga0105238_10111721 | Ga0105238_101117212 | 120 |
| 57 | 3300009551 | Ga0105238_10576087 | Ga0105238_105760872 | 120 |
| 58 | 3300009553 | Ga0105249_10184501 | Ga0105249_101845012 | 120 |
| 59 | 3300009553 | Ga0105249_10823568 | Ga0105249_108235682 | 120 |
| 60 | 3300010375 | Ga0105239_10001880 | Ga0105239_1000188017 | 120 |
| 61 | 3300010375 | Ga0105239_10338346 | Ga0105239_103383462 | 120 |
| 62 | 3300010375 | Ga0105239_11995481 | Ga0105239_119954812 | 120 |
| 63 | 3300011119 | Ga0105246_10044579 | Ga0105246_100445792 | 120 |
| 64 | 3300013102 | Ga0157371_10060681 | Ga0157371_100606812 | 120 |
| 65 | 3300013102 | Ga0157371_10456646 | Ga0157371_104566461 | 120 |
| 66 | 3300013104 | Ga0157370_10012100 | Ga0157370_100121008 | 120 |
| 67 | 3300013105 | Ga0157369_10120590 | Ga0157369_101205904 | 120 |
| 68 | 3300013297 | Ga0157378_10055139 | Ga0157378_100551392 | 120 |
| 69 | 3300013306 | Ga0163162_10011617 | Ga0163162_100116178 | 120 |
| 70 | 3300013307 | Ga0157372_10002753 | Ga0157372_1000275311 | 120 |
| 71 | 3300013308 | Ga0157375_10017416 | Ga0157375_100174165 | 120 |
| 72 | 3300013308 | Ga0157375_11093279 | Ga0157375_110932791 | 120 |
| 73 | 3300014326 | Ga0157380_11115412 | Ga0157380_111154121 | 120 |
| 74 | 3300014497 | Ga0182008_10000314 | Ga0182008_1000031438 | 120 |
| 75 | 3300015261 | Ga0182006_1013313 | Ga0182006_10133133 | 120 |
| 76 | 3300017792 | Ga0163161_10022869 | Ga0163161_100228694 | 120 |
| 77 | 3300025242 | Ga0209258_117401 | Ga0209258_1174012 | 120 |
| 78 | 3300025250 | Ga0209026_1000472 | Ga0209026_100047219 | 120 |
| 79 | 3300025893 | Ga0207682_10032391 | Ga0207682_100323913 | 120 |
| 80 | 3300025901 | Ga0207688_10025915 | Ga0207688_100259153 | 120 |
| 81 | 3300025903 | Ga0207680_10022599 | Ga0207680_100225993 | 120 |
| 82 | 3300025907 | Ga0207645_10000240 | Ga0207645_1000024012 | 120 |
| 83 | 3300025908 | Ga0207643_10014743 | Ga0207643_100147434 | 120 |
| 84 | 3300025909 | Ga0207705_10322295 | Ga0207705_103222953 | 120 |
| 85 | 3300025913 | Ga0207695_10000117 | Ga0207695_1000011790 | 120 |
| 86 | 3300025913 | Ga0207695_10170051 | Ga0207695_101700512 | 120 |
| 87 | 3300025914 | Ga0207671_10000341 | Ga0207671_1000034113 | 120 |
| 88 | 3300025914 | Ga0207671_10005171 | Ga0207671_100051713 | 120 |
| 89 | 3300025917 | Ga0207660_10007437 | Ga0207660_100074375 | 120 |
| 90 | 3300025921 | Ga0207652_10001956 | Ga0207652_1000195612 | 120 |
| 91 | 3300025924 | Ga0207694_10428941 | Ga0207694_104289412 | 120 |
| 92 | 3300025937 | Ga0207669_10501047 | Ga0207669_105010472 | 120 |
| 93 | 3300025938 | Ga0207704_10009382 | Ga0207704_100093823 | 120 |
| 94 | 3300025940 | Ga0207691_10005539 | Ga0207691_100055393 | 120 |
| 95 | 3300025942 | Ga0207689_10033599 | Ga0207689_100335993 | 120 |
| 96 | 3300025949 | Ga0207667_10016927 | Ga0207667_100169275 | 120 |
| 97 | 3300025960 | Ga0207651_11231185 | Ga0207651_112311851 | 120 |
| 98 | 3300025961 | Ga0207712_10631359 | Ga0207712_106313592 | 120 |
| 99 | 3300026035 | Ga0207703_10795627 | Ga0207703_107956272 | 120 |
| 100 | 3300026089 | Ga0207648_10198628 | Ga0207648_101986283 | 120 |
| 101 | 3300026089 | Ga0207648_10201146 | Ga0207648_102011462 | 120 |
| 102 | 3300026116 | Ga0207674_10152720 | Ga0207674_101527202 | 120 |
| 103 | 3300026118 | Ga0207675_100381999 | Ga0207675_1003819992 | 120 |
| 104 | 3300026118 | Ga0207675_100952426 | Ga0207675_1009524262 | 120 |
| 105 | 3300026121 | Ga0207683_10002878 | Ga0207683_1000287812 | 120 |
| 106 | 3300026142 | Ga0207698_10458176 | Ga0207698_104581762 | 120 |
| 107 | 3300026142 | Ga0207698_11477453 | Ga0207698_114774532 | 120 |
| 108 | 3300026142 | Ga0207698_11897620 | Ga0207698_118976201 | 120 |
| 109 | 3300027526 | Ga0209968_1099517 | Ga0209968_10995171 | 120 |
| 110 | 3300028379 | Ga0268266_10214790 | Ga0268266_102147902 | 120 |
| 111 | 3300028381 | Ga0268264_10000243 | Ga0268264_1000024344 | 120 |
| 112 | 3300028786 | Ga0307517_10012397 | Ga0307517_100123977 | 120 |
| 113 | 3300028794 | Ga0307515_10000012 | Ga0307515_10000012531 | 120 |
| 114 | 3300028794 | Ga0307515_10343124 | Ga0307515_103431242 | 120 |
| 115 | 3300028800 | Ga0265338_10161297 | Ga0265338_101612972 | 120 |
| 116 | 3300031456 | Ga0307513_10336408 | Ga0307513_103364082 | 120 |
| 117 | 3300031548 | Ga0307408_100230205 | Ga0307408_1002302052 | 120 |
| 118 | 3300031548 | Ga0307408_101306246 | Ga0307408_1013062461 | 120 |
| 119 | 3300031649 | Ga0307514_10041510 | Ga0307514_100415104 | 120 |
| 120 | 3300031824 | Ga0307413_10086617 | Ga0307413_100866172 | 120 |
| 121 | 3300031903 | Ga0307407_10043476 | Ga0307407_100434762 | 120 |
| 122 | 3300032004 | Ga0307414_10984783 | Ga0307414_109847831 | 120 |
| 123 | 3300033180 | Ga0307510_10021403 | Ga0307510_100214033 | 120 |
| 124 | 3300037312 | Ga0395899_0000050 | Ga0395899_0000050_32682_33140 | 120 |
| 125 | 3300042532 | Ga0450893_0020688 | Ga0450893_0020688_726_1091 | 120 |
| 126 | 3300042876 | Ga0451577_0420618 | Ga0451577_0420618_221_586 | 120 |
| 127 | 3300042876 | Ga0451577_1814200 | Ga0451577_1814200_119_496 | 120 |
| 128 | 3300044673 | Ga0453683_0824420 | Ga0453683_0824420_212_598 | 120 |
| 129 | 3300044712 | Ga0453684_0001262 | Ga0453684_0001262_40405_40770 | 120 |
| 130 | 3300044712 | Ga0453684_0007407 | Ga0453684_0007407_592_957 | 120 |
| 131 | 3300044712 | Ga0453684_0136053 | Ga0453684_0136053_1060_1437 | 120 |
| 132 | 3300044712 | Ga0453684_0174344 | Ga0453684_0174344_324_695 | 120 |
| 133 | 3300044712 | Ga0453684_0555934 | Ga0453684_0555934_464_850 | 120 |
| 134 | 3300044712 | Ga0453684_1959260 | Ga0453684_1959260_46_411 | 120 |
| 135 | 3300045051 | Ga0451576_0013819 | Ga0451576_0013819_7575_7940 | 120 |
| 136 | 3300045051 | Ga0451576_0879694 | Ga0451576_0879694_425_811 | 120 |
| 137 | 3300045051 | Ga0451576_1645996 | Ga0451576_1645996_93_458 | 120 |
| 138 | 3300046460 | Ga0495638_0010944 | Ga0495638_0010944_1874_2239 | 120 |
| 139 | 3300046513 | Ga0495616_0050234 | Ga0495616_0050234_1087_1452 | 120 |
| 140 | 3300046524 | Ga0495648_0013877 | Ga0495648_0013877_1785_2150 | 120 |
| 141 | 3300046528 | Ga0495642_0139199 | Ga0495642_0139199_99_482 | 120 |
| 142 | 3300046535 | Ga0495586_0583038 | Ga0495586_0583038_115_480 | 120 |
| 143 | 3300046616 | Ga0495668_0213638 | Ga0495668_0213638_211_576 | 120 |
| 144 | 3300046660 | Ga0495625_0068421 | Ga0495625_0068421_895_1260 | 120 |
| 145 | 3300046694 | Ga0495649_0111874 | Ga0495649_0111874_660_1025 | 120 |
| 146 | 3300046810 | Ga0495660_0005180 | Ga0495660_0005180_4893_5258 | 120 |
| 147 | 3300047320 | Ga0495672_0006059 | Ga0495672_0006059_4107_4472 | 120 |
| 148 | 3300047443 | Ga0495687_000014 | Ga0495687_000014_261520_261885 | 120 |
| 149 | 3300047443 | Ga0495687_001360 | Ga0495687_001360_7797_8168 | 120 |
| 150 | 3300048918 | Ga0496115_0272932 | Ga0496115_0272932_435_797 | 120 |
| 151 | 3300048925 | Ga0496122_0001017 | Ga0496122_0001017_32493_32861 | 120 |
| 152 | 3300048926 | Ga0496123_0008390 | Ga0496123_0008390_3486_3854 | 120 |
| 153 | 3300048928 | Ga0496125_0105521 | Ga0496125_0105521_1176_1544 | 120 |
| 154 | 3300048929 | Ga0496126_0060914 | Ga0496126_0060914_130_492 | 120 |
| 155 | 3300049459 | Ga0495678_007947 | Ga0495678_007947_1889_2254 | 120 |
| 156 | 3300049460 | Ga0495682_0366188 | Ga0495682_0366188_44_409 | 120 |
| 157 | 3300049652 | Ga0501202_048536 | Ga0501202_048536_92_463 | 120 |
| 158 | 3300049663 | Ga0501223_106583 | Ga0501223_106583_39_410 | 120 |
| 159 | 3300049668 | Ga0501233_126786 | Ga0501233_126786_55_426 | 120 |
| 160 | 3300049670 | Ga0501236_001479 | Ga0501236_001479_1990_2358 | 120 |
| 161 | 3300049686 | Ga0501257_002612 | Ga0501257_002612_1285_1653 | 120 |
| 162 | 3300049686 | Ga0501257_102882 | Ga0501257_102882_207_578 | 120 |
| 163 | 3300049688 | Ga0501259_036148 | Ga0501259_036148_223_594 | 120 |
| 164 | 3300049758 | Ga0501241_180584 | Ga0501241_180584_22_384 | 120 |
| 165 | 3300049761 | Ga0501264_000794 | Ga0501264_000794_2161_2601 | 120 |
| 166 | 3300050493 | nmdc:mga0k408_83765_c1 | nmdc:mga0k408_83765_c1_644_1015 | 120 |
| 167 | 3300053092 | Ga0500583_0006346 | Ga0500583_0006346_2104_2469 | 120 |
| 168 | 3300053093 | Ga0500651_0675218 | Ga0500651_0675218_77_442 | 120 |
| 169 | 3300053096 | Ga0500641_0000071 | Ga0500641_0000071_31870_32238 | 120 |
| 170 | 3300053122 | Ga0500608_000479 | Ga0500608_000479_13205_13570 | 120 |
| 171 | 3300053122 | Ga0500608_267385 | Ga0500608_267385_96_461 | 120 |
| 172 | 3300053130 | Ga0500642_0054986 | Ga0500642_0054986_213_578 | 120 |
| 173 | 3300053130 | Ga0500642_0120381 | Ga0500642_0120381_307_672 | 120 |
| 174 | 3300053131 | Ga0500652_061384 | Ga0500652_061384_875_1240 | 120 |
| 175 | 3300053151 | Ga0500604_0044590 | Ga0500604_0044590_945_1310 | 120 |
| 176 | 3300053156 | Ga0500622_0004545 | Ga0500622_0004545_7874_8239 | 120 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4iag-assembly1.cif.gz_A-2 | crystal structure of zbma, the zorbamycin binding protein from streptomyces flavoviridis | 0.8443 | 3 | 120 |
| 1xrk-assembly1.cif.gz_A | crystal structure of a mutant bleomycin binding protein from streptoalloteichus hindustanus displaying increased thermostability | 0.8405 | 3 | 118 |
| 5cj3-assembly1.cif.gz_B | crystal structure of the zorbamycin binding protein (zbma) from streptomyces flavoviridis with zorbamycin | 0.8356 | 2 | 120 |
| 1jif-assembly1.cif.gz_B | crystal structure of bleomycin-binding protein from bleomycin-producing streptomyces verticillus complexed with copper(ii)-bleomycin | 0.8347 | 2 | 116 |
| 1ecs-assembly1.cif.gz_B | the 1.7 a crystal structure of a bleomycin resistance determinant encoded on the transposon tn5 | 0.827 | 5 | 118 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1jieA00 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.8387 | 2 | 116 | 3.10.180.10 |
| 3itwA02 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.8152 | 62 | 120 | 3.30.720.110 |
| af_A0A0R0IJS9_306_438_3.30.310.80 | Alpha Beta;2-Layer Sandwich;TATA-Binding Protein;Kinase associated domain 1, KA1 | 0.8014 | 18 | 44 | 3.30.310.80 |
| 1jieA00 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.8011 | 2 | 116 | 3.10.180.10 |
| 2g7jA00 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Protein of unknown function DUF2002 | 0.7935 | 18 | 51 | 3.90.1150.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A653WC21-F1-model_v4 | Glyoxalase | 0.9819 | 1 | 119 |
|
| AF-A0A6P0UKJ9-F1-model_v4 | Glyoxalase | 0.98 | 3 | 120 |
|
| AF-A0A4Q5T7K5-F1-model_v4 | Glyoxalase | 0.9784 | 17 | 119 |
|
| AF-A0A3G2G2M8-F1-model_v4 | GNAT family N-acetyltransferase | 0.9771 | 1 | 120 |
GO:0016747
|
| AF-A0A519LWS7-F1-model_v4 | Glyoxalase | 0.977 | 1 | 91 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar