F269083

General Info

Members Datasets Scaffolds Average Seq Length
176 140 170 122

Family's Representative Sequence

Representative Sequence 3300049761|Ga0501264_000794|Ga0501264_000794_2161_2601
Length 146
Sequence LITKINFTDLKKIGKLLCRLTVKQMRHNAKSIRPFLGAKDFSISRSFYKDLGFEESILTHNLSYFKTNDMGFYLQDAYVRDWIDNTMVFLEVDDVSRYWNELLALDLTTRYKDVRLVPIRELDWGREFFLHDPSGILWHFGEFRKD

Samples

Sample ID Description Type Environment
1 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
2 2881247448 Flavobacterium beibuense RSKm HC5 Isolate Rhizosphere
3 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
4 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
5 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
6 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
7 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
8 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
9 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
49 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
57 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
58 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
59 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
60 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
61 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
63 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
91 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
92 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
93 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
94 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
95 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
96 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
97 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
98 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
99 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
100 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
101 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
102 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
103 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
104 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
105 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
106 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
107 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
108 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
109 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
110 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
111 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
112 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
113 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
114 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
115 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
116 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
117 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
118 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
119 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
120 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
121 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
122 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
123 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
124 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
125 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
126 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
127 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
128 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
129 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
130 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
131 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
132 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
133 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
134 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
135 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
136 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
137 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
138 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
139 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
140 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.59
Metatranscriptomes 0
Isolates 3.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.39
Nodule 0
Rhizoplane 1.14
Rhizosphere 81.25
Stem 0
Stem Tuber 0
Unclassified 10.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10036291 3300001979 Bacteria 1533
2 JGI24737J22298_10000230 3300001990 Bacteria 18503
3 JGI24735J21928_10000004 3300002067 Bacteria 381713
4 rootH2_10211142 3300003320 Bacteria 2307
5 rootL2_10031439 3300003322 Bacteria 13803
6 rootL2_10265696 3300003322 Bacteria 1479
7 rootH1_10306926 3300003323 Bacteria 1972
8 Ga0070658_10041023 3300005327 Bacteria 3734
9 Ga0070676_10003395 3300005328 Bacteria 8289
10 Ga0070666_10051698 3300005335 Bacteria 2768
11 Ga0070680_100008376 3300005336 Bacteria 7918
12 Ga0070675_100042714 3300005354 Bacteria 3704
13 Ga0070674_100044055 3300005356 Unclassified 3039
14 Ga0070673_100010851 3300005364 Bacteria 6191
15 Ga0070667_100082694 3300005367 Unclassified 2750
16 Ga0070678_100008222 3300005456 Bacteria 6237
17 Ga0070681_10004301 3300005458 Bacteria 13524
18 Ga0068867_100048057 3300005459 Bacteria 3138
19 Ga0068867_100872456 3300005459 Bacteria 808
20 Ga0070685_10346500 3300005466 Bacteria 1014
21 Ga0070685_10642476 3300005466 Bacteria 768
22 Ga0070679_100003612 3300005530 Bacteria 14138
23 Ga0070672_100010882 3300005543 Bacteria 6326
24 Ga0070665_100006153 3300005548 Bacteria 12275
25 Ga0068855_100035520 3300005563 Bacteria 5936
26 Ga0068857_100468024 3300005577 Bacteria 1180
27 Ga0068852_101144062 3300005616 Unclassified 799
28 Ga0068852_102075327 3300005616 Unclassified 590
29 Ga0068859_100081433 3300005617 Unclassified 3280
30 Ga0068861_100988501 3300005719 Unclassified 802
31 Ga0068870_10020993 3300005840 Bacteria 3189
32 Ga0068858_101210155 3300005842 Bacteria 743
33 Ga0068860_100000060 3300005843 Bacteria 195631
34 Ga0068862_100624300 3300005844 Bacteria 1037
35 Ga0075366_10064297 3300006195 Bacteria 2182
36 Ga0097621_100033983 3300006237 Bacteria 4065
37 Ga0068871_100049730 3300006358 Bacteria 3389
38 Ga0068865_100030543 3300006881 Bacteria 3585
39 Ga0097620_100081432 3300006931 Unclassified 3280
40 Ga0105240_10042163 3300009093 Bacteria 5818
41 Ga0105240_10448505 3300009093 Unclassified 1444
42 Ga0105241_10000859 3300009174 Bacteria 23042
43 Ga0105241_10109969 3300009174 Unclassified 2204
44 Ga0105241_10859680 3300009174 Bacteria 839
45 Ga0105237_10000082 3300009545 Bacteria 127340
46 Ga0105237_10000971 3300009545 Bacteria 38512
47 Ga0105237_10001472 3300009545 Bacteria 31032
48 Ga0105238_10111721 3300009551 Bacteria 2713
49 Ga0105238_10576087 3300009551 Bacteria 1132
50 Ga0105249_10184501 3300009553 Bacteria 2032
51 Ga0105249_10823568 3300009553 Bacteria 993
52 Ga0105239_10001880 3300010375 Bacteria 27460
53 Ga0105239_10338346 3300010375 Unclassified 1698
54 Ga0105239_11995481 3300010375 Bacteria 673
55 Ga0105246_10044579 3300011119 Bacteria 3015
56 Ga0157371_10060681 3300013102 Bacteria 2681
57 Ga0157371_10456646 3300013102 Bacteria 940
58 Ga0157370_10012100 3300013104 Bacteria 8977
59 Ga0157369_10120590 3300013105 Bacteria 2783
60 Ga0157378_10055139 3300013297 Bacteria 3540
61 Ga0163162_10011617 3300013306 Bacteria 8585
62 Ga0157372_10002753 3300013307 Bacteria 19009
63 Ga0157375_10017416 3300013308 Bacteria 6483
64 Ga0157375_11093279 3300013308 Unclassified 933
65 Ga0157380_11115412 3300014326 Bacteria 828
66 Ga0182008_10000314 3300014497 Bacteria 38050
67 Ga0157379_10812027 3300014968 Unclassified 883
68 Ga0182006_1013313 3300015261 Bacteria 3572
69 Ga0163161_10022869 3300017792 Bacteria 4404
70 Ga0163161_11125339 3300017792 Bacteria 676
71 Ga0209258_117401 3300025242 Bacteria 789
72 Ga0209026_1000472 3300025250 Bacteria 30801
73 Ga0207682_10032391 3300025893 Bacteria 2101
74 Ga0207688_10025915 3300025901 Unclassified 3223
75 Ga0207680_10022599 3300025903 Bacteria 3423
76 Ga0207645_10000240 3300025907 Bacteria 45336
77 Ga0207643_10014743 3300025908 Bacteria 4250
78 Ga0207705_10322295 3300025909 Bacteria 1188
79 Ga0207695_10000117 3300025913 Bacteria 237982
80 Ga0207695_10170051 3300025913 Bacteria 2105
81 Ga0207671_10000341 3300025914 Bacteria 68530
82 Ga0207671_10005171 3300025914 Bacteria 12131
83 Ga0207660_10007437 3300025917 Bacteria 7087
84 Ga0207652_10001956 3300025921 Bacteria 17833
85 Ga0207694_10428941 3300025924 Bacteria 1102
86 Ga0207669_10501047 3300025937 Bacteria 971
87 Ga0207704_10009382 3300025938 Bacteria 4720
88 Ga0207691_10005539 3300025940 Bacteria 12195
89 Ga0207689_10033599 3300025942 Bacteria 4261
90 Ga0207667_10016927 3300025949 Bacteria 8223
91 Ga0207651_11231185 3300025960 Bacteria 672
92 Ga0207712_10631359 3300025961 Bacteria 929
93 Ga0207703_10795627 3300026035 Bacteria 903
94 Ga0207648_10198628 3300026089 Bacteria 1779
95 Ga0207648_10201146 3300026089 Unclassified 1767
96 Ga0207674_10152720 3300026116 Bacteria 2266
97 Ga0207675_100381999 3300026118 Bacteria 1385
98 Ga0207675_100952426 3300026118 Unclassified 876
99 Ga0207683_10002878 3300026121 Bacteria 15009
100 Ga0207698_10458176 3300026142 Bacteria 1233
101 Ga0207698_11477453 3300026142 Unclassified 695
102 Ga0207698_11897620 3300026142 Unclassified 610
103 Ga0209968_1099517 3300027526 Bacteria 530
104 Ga0268266_10214790 3300028379 Bacteria 1765
105 Ga0268264_10000243 3300028381 Bacteria 102854
106 Ga0307517_10012397 3300028786 Bacteria 11705
107 Ga0307515_10000012 3300028794 Bacteria 582232
108 Ga0307515_10343124 3300028794 Bacteria 1144
109 Ga0265338_10161297 3300028800 Bacteria 1731
110 Ga0307513_10336408 3300031456 Bacteria 1262
111 Ga0307408_100230205 3300031548 Bacteria 1517
112 Ga0307408_101306246 3300031548 Bacteria 680
113 Ga0307514_10041510 3300031649 Bacteria 3623
114 Ga0307413_10086617 3300031824 Bacteria 2026
115 Ga0307407_10043476 3300031903 Unclassified 2526
116 Ga0307414_10984783 3300032004 Bacteria 776
117 Ga0307510_10021403 3300033180 Bacteria 7535
118 Ga0395899_0000050 3300037312 Bacteria 224591
119 Ga0450893_0020688 3300042532 Bacteria 1132
120 Ga0451577_0420618 3300042876 Bacteria 1213
121 Ga0451577_1814200 3300042876 Bacteria 535
122 Ga0453683_0824420 3300044673 Unclassified 611
123 Ga0453684_0001262 3300044712 Bacteria 76072
124 Ga0453684_0007407 3300044712 Bacteria 20211
125 Ga0453684_0136053 3300044712 Bacteria 2942
126 Ga0453684_0174344 3300044712 Bacteria 2531
127 Ga0453684_0555934 3300044712 Bacteria 1263
128 Ga0453684_1959260 3300044712 Unclassified 591
129 Ga0451576_0013819 3300045051 Bacteria 9019
130 Ga0451576_0879694 3300045051 Bacteria 940
131 Ga0451576_1645996 3300045051 Unclassified 665
132 Ga0495638_0010944 3300046460 Bacteria 6273
133 Ga0495616_0050234 3300046513 Bacteria 2087
134 Ga0495648_0013877 3300046524 Bacteria 5931
135 Ga0495642_0139199 3300046528 Bacteria 1047
136 Ga0495586_0583038 3300046535 Bacteria 646
137 Ga0495668_0213638 3300046616 Bacteria 1056
138 Ga0495625_0068421 3300046660 Bacteria 2496
139 Ga0495649_0111874 3300046694 Bacteria 1448
140 Ga0495660_0005180 3300046810 Bacteria 7828
141 Ga0495672_0006059 3300047320 Bacteria 9445
142 Ga0495687_000014 3300047443 Bacteria 366896
143 Ga0495687_001360 3300047443 Bacteria 22645
144 Ga0496115_0272932 3300048918 Bacteria 1389
145 Ga0496122_0001017 3300048925 Bacteria 49635
146 Ga0496123_0008390 3300048926 Bacteria 9499
147 Ga0496125_0105521 3300048928 Bacteria 2059
148 Ga0496126_0060914 3300048929 Bacteria 3392
149 Ga0495678_007947 3300049459 Bacteria 5433
150 Ga0495682_0366188 3300049460 Bacteria 508
151 Ga0501202_048536 3300049652 Bacteria 935
152 Ga0501223_106583 3300049663 Bacteria 582
153 Ga0501233_126786 3300049668 Unclassified 694
154 Ga0501236_001479 3300049670 Bacteria 2664
155 Ga0501257_002612 3300049686 Bacteria 3801
156 Ga0501257_102882 3300049686 Bacteria 751
157 Ga0501259_036148 3300049688 Bacteria 954
158 Ga0501241_180584 3300049758 Unclassified 500
159 Ga0501264_000794 3300049761 Bacteria 4128
160 nmdc:mga0k408_83765_c1 3300050493 Bacteria 1870
161 Ga0500583_0006346 3300053092 Bacteria 4059
162 Ga0500651_0675218 3300053093 Unclassified 554
163 Ga0500641_0000071 3300053096 Bacteria 41571
164 Ga0500608_000479 3300053122 Bacteria 14975
165 Ga0500608_267385 3300053122 Unclassified 656
166 Ga0500642_0054986 3300053130 Bacteria 1769
167 Ga0500642_0120381 3300053130 Bacteria 1227
168 Ga0500652_061384 3300053131 Bacteria 1548
169 Ga0500604_0044590 3300053151 Bacteria 1351
170 Ga0500622_0004545 3300053156 Bacteria 8653

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300017792 Ga0163161_11125339 Ga0163161_111253392 116
2 iso_pu_bacteria 2599185184 2599478413 116
3 iso_pu_bacteria 2881247448 2881247974 116
4 iso_pu_bacteria 2928078545 2928080535 116
5 iso_pu_bacteria 2928147474 2928150726 116
6 iso_pu_bacteria 2929239360 2929244453 116
7 iso_pu_bacteria 2932082852 2932083078 116
8 3300005466 Ga0070685_10642476 Ga0070685_106424762 119
9 3300014968 Ga0157379_10812027 Ga0157379_108120272 119
10 3300001979 JGI24740J21852_10036291 JGI24740J21852_100362912 120
11 3300001990 JGI24737J22298_10000230 JGI24737J22298_100002304 120
12 3300002067 JGI24735J21928_10000004 JGI24735J21928_1000000424 120
13 3300003320 rootH2_10211142 rootH2_102111424 120
14 3300003322 rootL2_10031439 rootL2_100314393 120
15 3300003322 rootL2_10265696 rootL2_102656962 120
16 3300003323 rootH1_10306926 rootH1_103069262 120
17 3300005327 Ga0070658_10041023 Ga0070658_100410231 120
18 3300005328 Ga0070676_10003395 Ga0070676_100033953 120
19 3300005335 Ga0070666_10051698 Ga0070666_100516982 120
20 3300005336 Ga0070680_100008376 Ga0070680_1000083763 120
21 3300005354 Ga0070675_100042714 Ga0070675_1000427143 120
22 3300005356 Ga0070674_100044055 Ga0070674_1000440553 120
23 3300005364 Ga0070673_100010851 Ga0070673_1000108513 120
24 3300005367 Ga0070667_100082694 Ga0070667_1000826943 120
25 3300005456 Ga0070678_100008222 Ga0070678_1000082224 120
26 3300005458 Ga0070681_10004301 Ga0070681_100043014 120
27 3300005459 Ga0068867_100048057 Ga0068867_1000480573 120
28 3300005459 Ga0068867_100872456 Ga0068867_1008724562 120
29 3300005466 Ga0070685_10346500 Ga0070685_103465002 120
30 3300005530 Ga0070679_100003612 Ga0070679_1000036129 120
31 3300005543 Ga0070672_100010882 Ga0070672_1000108823 120
32 3300005548 Ga0070665_100006153 Ga0070665_10000615313 120
33 3300005563 Ga0068855_100035520 Ga0068855_1000355201 120
34 3300005577 Ga0068857_100468024 Ga0068857_1004680242 120
35 3300005616 Ga0068852_101144062 Ga0068852_1011440621 120
36 3300005616 Ga0068852_102075327 Ga0068852_1020753272 120
37 3300005617 Ga0068859_100081433 Ga0068859_1000814334 120
38 3300005719 Ga0068861_100988501 Ga0068861_1009885012 120
39 3300005840 Ga0068870_10020993 Ga0068870_100209932 120
40 3300005842 Ga0068858_101210155 Ga0068858_1012101552 120
41 3300005843 Ga0068860_100000060 Ga0068860_10000006055 120
42 3300005844 Ga0068862_100624300 Ga0068862_1006243002 120
43 3300006195 Ga0075366_10064297 Ga0075366_100642973 120
44 3300006237 Ga0097621_100033983 Ga0097621_1000339833 120
45 3300006358 Ga0068871_100049730 Ga0068871_1000497303 120
46 3300006881 Ga0068865_100030543 Ga0068865_1000305433 120
47 3300006931 Ga0097620_100081432 Ga0097620_1000814324 120
48 3300009093 Ga0105240_10042163 Ga0105240_100421637 120
49 3300009093 Ga0105240_10448505 Ga0105240_104485052 120
50 3300009174 Ga0105241_10000859 Ga0105241_100008595 120
51 3300009174 Ga0105241_10109969 Ga0105241_101099693 120
52 3300009174 Ga0105241_10859680 Ga0105241_108596802 120
53 3300009545 Ga0105237_10000082 Ga0105237_1000008213 120
54 3300009545 Ga0105237_10000971 Ga0105237_1000097120 120
55 3300009545 Ga0105237_10001472 Ga0105237_1000147219 120
56 3300009551 Ga0105238_10111721 Ga0105238_101117212 120
57 3300009551 Ga0105238_10576087 Ga0105238_105760872 120
58 3300009553 Ga0105249_10184501 Ga0105249_101845012 120
59 3300009553 Ga0105249_10823568 Ga0105249_108235682 120
60 3300010375 Ga0105239_10001880 Ga0105239_1000188017 120
61 3300010375 Ga0105239_10338346 Ga0105239_103383462 120
62 3300010375 Ga0105239_11995481 Ga0105239_119954812 120
63 3300011119 Ga0105246_10044579 Ga0105246_100445792 120
64 3300013102 Ga0157371_10060681 Ga0157371_100606812 120
65 3300013102 Ga0157371_10456646 Ga0157371_104566461 120
66 3300013104 Ga0157370_10012100 Ga0157370_100121008 120
67 3300013105 Ga0157369_10120590 Ga0157369_101205904 120
68 3300013297 Ga0157378_10055139 Ga0157378_100551392 120
69 3300013306 Ga0163162_10011617 Ga0163162_100116178 120
70 3300013307 Ga0157372_10002753 Ga0157372_1000275311 120
71 3300013308 Ga0157375_10017416 Ga0157375_100174165 120
72 3300013308 Ga0157375_11093279 Ga0157375_110932791 120
73 3300014326 Ga0157380_11115412 Ga0157380_111154121 120
74 3300014497 Ga0182008_10000314 Ga0182008_1000031438 120
75 3300015261 Ga0182006_1013313 Ga0182006_10133133 120
76 3300017792 Ga0163161_10022869 Ga0163161_100228694 120
77 3300025242 Ga0209258_117401 Ga0209258_1174012 120
78 3300025250 Ga0209026_1000472 Ga0209026_100047219 120
79 3300025893 Ga0207682_10032391 Ga0207682_100323913 120
80 3300025901 Ga0207688_10025915 Ga0207688_100259153 120
81 3300025903 Ga0207680_10022599 Ga0207680_100225993 120
82 3300025907 Ga0207645_10000240 Ga0207645_1000024012 120
83 3300025908 Ga0207643_10014743 Ga0207643_100147434 120
84 3300025909 Ga0207705_10322295 Ga0207705_103222953 120
85 3300025913 Ga0207695_10000117 Ga0207695_1000011790 120
86 3300025913 Ga0207695_10170051 Ga0207695_101700512 120
87 3300025914 Ga0207671_10000341 Ga0207671_1000034113 120
88 3300025914 Ga0207671_10005171 Ga0207671_100051713 120
89 3300025917 Ga0207660_10007437 Ga0207660_100074375 120
90 3300025921 Ga0207652_10001956 Ga0207652_1000195612 120
91 3300025924 Ga0207694_10428941 Ga0207694_104289412 120
92 3300025937 Ga0207669_10501047 Ga0207669_105010472 120
93 3300025938 Ga0207704_10009382 Ga0207704_100093823 120
94 3300025940 Ga0207691_10005539 Ga0207691_100055393 120
95 3300025942 Ga0207689_10033599 Ga0207689_100335993 120
96 3300025949 Ga0207667_10016927 Ga0207667_100169275 120
97 3300025960 Ga0207651_11231185 Ga0207651_112311851 120
98 3300025961 Ga0207712_10631359 Ga0207712_106313592 120
99 3300026035 Ga0207703_10795627 Ga0207703_107956272 120
100 3300026089 Ga0207648_10198628 Ga0207648_101986283 120
101 3300026089 Ga0207648_10201146 Ga0207648_102011462 120
102 3300026116 Ga0207674_10152720 Ga0207674_101527202 120
103 3300026118 Ga0207675_100381999 Ga0207675_1003819992 120
104 3300026118 Ga0207675_100952426 Ga0207675_1009524262 120
105 3300026121 Ga0207683_10002878 Ga0207683_1000287812 120
106 3300026142 Ga0207698_10458176 Ga0207698_104581762 120
107 3300026142 Ga0207698_11477453 Ga0207698_114774532 120
108 3300026142 Ga0207698_11897620 Ga0207698_118976201 120
109 3300027526 Ga0209968_1099517 Ga0209968_10995171 120
110 3300028379 Ga0268266_10214790 Ga0268266_102147902 120
111 3300028381 Ga0268264_10000243 Ga0268264_1000024344 120
112 3300028786 Ga0307517_10012397 Ga0307517_100123977 120
113 3300028794 Ga0307515_10000012 Ga0307515_10000012531 120
114 3300028794 Ga0307515_10343124 Ga0307515_103431242 120
115 3300028800 Ga0265338_10161297 Ga0265338_101612972 120
116 3300031456 Ga0307513_10336408 Ga0307513_103364082 120
117 3300031548 Ga0307408_100230205 Ga0307408_1002302052 120
118 3300031548 Ga0307408_101306246 Ga0307408_1013062461 120
119 3300031649 Ga0307514_10041510 Ga0307514_100415104 120
120 3300031824 Ga0307413_10086617 Ga0307413_100866172 120
121 3300031903 Ga0307407_10043476 Ga0307407_100434762 120
122 3300032004 Ga0307414_10984783 Ga0307414_109847831 120
123 3300033180 Ga0307510_10021403 Ga0307510_100214033 120
124 3300037312 Ga0395899_0000050 Ga0395899_0000050_32682_33140 120
125 3300042532 Ga0450893_0020688 Ga0450893_0020688_726_1091 120
126 3300042876 Ga0451577_0420618 Ga0451577_0420618_221_586 120
127 3300042876 Ga0451577_1814200 Ga0451577_1814200_119_496 120
128 3300044673 Ga0453683_0824420 Ga0453683_0824420_212_598 120
129 3300044712 Ga0453684_0001262 Ga0453684_0001262_40405_40770 120
130 3300044712 Ga0453684_0007407 Ga0453684_0007407_592_957 120
131 3300044712 Ga0453684_0136053 Ga0453684_0136053_1060_1437 120
132 3300044712 Ga0453684_0174344 Ga0453684_0174344_324_695 120
133 3300044712 Ga0453684_0555934 Ga0453684_0555934_464_850 120
134 3300044712 Ga0453684_1959260 Ga0453684_1959260_46_411 120
135 3300045051 Ga0451576_0013819 Ga0451576_0013819_7575_7940 120
136 3300045051 Ga0451576_0879694 Ga0451576_0879694_425_811 120
137 3300045051 Ga0451576_1645996 Ga0451576_1645996_93_458 120
138 3300046460 Ga0495638_0010944 Ga0495638_0010944_1874_2239 120
139 3300046513 Ga0495616_0050234 Ga0495616_0050234_1087_1452 120
140 3300046524 Ga0495648_0013877 Ga0495648_0013877_1785_2150 120
141 3300046528 Ga0495642_0139199 Ga0495642_0139199_99_482 120
142 3300046535 Ga0495586_0583038 Ga0495586_0583038_115_480 120
143 3300046616 Ga0495668_0213638 Ga0495668_0213638_211_576 120
144 3300046660 Ga0495625_0068421 Ga0495625_0068421_895_1260 120
145 3300046694 Ga0495649_0111874 Ga0495649_0111874_660_1025 120
146 3300046810 Ga0495660_0005180 Ga0495660_0005180_4893_5258 120
147 3300047320 Ga0495672_0006059 Ga0495672_0006059_4107_4472 120
148 3300047443 Ga0495687_000014 Ga0495687_000014_261520_261885 120
149 3300047443 Ga0495687_001360 Ga0495687_001360_7797_8168 120
150 3300048918 Ga0496115_0272932 Ga0496115_0272932_435_797 120
151 3300048925 Ga0496122_0001017 Ga0496122_0001017_32493_32861 120
152 3300048926 Ga0496123_0008390 Ga0496123_0008390_3486_3854 120
153 3300048928 Ga0496125_0105521 Ga0496125_0105521_1176_1544 120
154 3300048929 Ga0496126_0060914 Ga0496126_0060914_130_492 120
155 3300049459 Ga0495678_007947 Ga0495678_007947_1889_2254 120
156 3300049460 Ga0495682_0366188 Ga0495682_0366188_44_409 120
157 3300049652 Ga0501202_048536 Ga0501202_048536_92_463 120
158 3300049663 Ga0501223_106583 Ga0501223_106583_39_410 120
159 3300049668 Ga0501233_126786 Ga0501233_126786_55_426 120
160 3300049670 Ga0501236_001479 Ga0501236_001479_1990_2358 120
161 3300049686 Ga0501257_002612 Ga0501257_002612_1285_1653 120
162 3300049686 Ga0501257_102882 Ga0501257_102882_207_578 120
163 3300049688 Ga0501259_036148 Ga0501259_036148_223_594 120
164 3300049758 Ga0501241_180584 Ga0501241_180584_22_384 120
165 3300049761 Ga0501264_000794 Ga0501264_000794_2161_2601 120
166 3300050493 nmdc:mga0k408_83765_c1 nmdc:mga0k408_83765_c1_644_1015 120
167 3300053092 Ga0500583_0006346 Ga0500583_0006346_2104_2469 120
168 3300053093 Ga0500651_0675218 Ga0500651_0675218_77_442 120
169 3300053096 Ga0500641_0000071 Ga0500641_0000071_31870_32238 120
170 3300053122 Ga0500608_000479 Ga0500608_000479_13205_13570 120
171 3300053122 Ga0500608_267385 Ga0500608_267385_96_461 120
172 3300053130 Ga0500642_0054986 Ga0500642_0054986_213_578 120
173 3300053130 Ga0500642_0120381 Ga0500642_0120381_307_672 120
174 3300053131 Ga0500652_061384 Ga0500652_061384_875_1240 120
175 3300053151 Ga0500604_0044590 Ga0500604_0044590_945_1310 120
176 3300053156 Ga0500622_0004545 Ga0500622_0004545_7874_8239 120

Structural Annotation

Top 5 Hits

ID Description Score Start End
4iag-assembly1.cif.gz_A-2 crystal structure of zbma, the zorbamycin binding protein from streptomyces flavoviridis 0.8443 3 120
1xrk-assembly1.cif.gz_A crystal structure of a mutant bleomycin binding protein from streptoalloteichus hindustanus displaying increased thermostability 0.8405 3 118
5cj3-assembly1.cif.gz_B crystal structure of the zorbamycin binding protein (zbma) from streptomyces flavoviridis with zorbamycin 0.8356 2 120
1jif-assembly1.cif.gz_B crystal structure of bleomycin-binding protein from bleomycin-producing streptomyces verticillus complexed with copper(ii)-bleomycin 0.8347 2 116
1ecs-assembly1.cif.gz_B the 1.7 a crystal structure of a bleomycin resistance determinant encoded on the transposon tn5 0.827 5 118
ID Description Score Start End Superfamily
1jieA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8387 2 116 3.10.180.10
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8152 62 120 3.30.720.110
af_A0A0R0IJS9_306_438_3.30.310.80 Alpha Beta;2-Layer Sandwich;TATA-Binding Protein;Kinase associated domain 1, KA1 0.8014 18 44 3.30.310.80
1jieA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8011 2 116 3.10.180.10
2g7jA00 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Protein of unknown function DUF2002 0.7935 18 51 3.90.1150.40
ID Description Score Start End GO Terms
AF-A0A653WC21-F1-model_v4 Glyoxalase 0.9819 1 119
AF-A0A6P0UKJ9-F1-model_v4 Glyoxalase 0.98 3 120
AF-A0A4Q5T7K5-F1-model_v4 Glyoxalase 0.9784 17 119
AF-A0A3G2G2M8-F1-model_v4 GNAT family N-acetyltransferase 0.9771 1 120 GO:0016747
AF-A0A519LWS7-F1-model_v4 Glyoxalase 0.977 1 91

Feature Viewer

pLDDT pTM Quality
95.4 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map