F269149

General Info

Members Datasets Scaffolds Average Seq Length
176 129 176 197

Family's Representative Sequence

Representative Sequence 3300053153|Ga0500616_0071088|Ga0500616_0071088_34_618
Length 194
Sequence MSKRELVGAATGVGLRLARGQQLRIIDIEGGQTGDLVAFSQDGSERISNGRSFDYNGKIYLSTGDVLWSDRSSPMLTIVEDDVGRHDFLYASCSLEMYRIQYGVTDHANCHSNLVAALRELGIAPDSLPIAFNFFMNVEVGPDGRLKILEPKCRAGSSMVLRADMDLAVALSACPASTCNGGAPPRPLAFEIAG

Samples

Sample ID Description Type Environment
1 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
2 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
5 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
25 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
32 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
33 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
34 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
48 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
49 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
50 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
51 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
52 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
53 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
54 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
55 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
56 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
57 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
59 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
90 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
94 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
95 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
96 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
97 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
98 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
99 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
100 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
101 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
102 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
103 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
104 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
105 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
106 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
107 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
108 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
109 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
110 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
111 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
112 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
113 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
114 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
115 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
116 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
117 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
118 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
119 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
120 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
121 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
122 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
123 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
124 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
125 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
126 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
127 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
128 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
129 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.23
Nodule 0
Rhizoplane 3.98
Rhizosphere 81.25
Stem 0
Stem Tuber 0
Unclassified 4.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10000613 3300003187 Bacteria 31227
2 JGI25160J50197_1020164 3300003354 Bacteria 2021
3 JGI25404J52841_10005158 3300003659 Unclassified 2693
4 Ga0055530_10000582 3300003791 Bacteria 31632
5 Ga0055531_10000116 3300003794 Bacteria 88368
6 Ga0070676_10027292 3300005328 Bacteria 3237
7 Ga0068869_100001572 3300005334 Bacteria 13583
8 Ga0068869_100218458 3300005334 Bacteria 1510
9 Ga0068869_100878583 3300005334 Bacteria 775
10 Ga0070666_10103547 3300005335 Unclassified 1964
11 Ga0070682_100096853 3300005337 Bacteria 1941
12 Ga0070661_100255414 3300005344 Bacteria 1354
13 Ga0070692_10164724 3300005345 Bacteria 1273
14 Ga0070669_100236064 3300005353 Bacteria 1451
15 Ga0070674_100068455 3300005356 Bacteria 2501
16 Ga0070667_100003762 3300005367 Bacteria 12890
17 Ga0070700_100573364 3300005441 Unclassified 880
18 Ga0070678_100093278 3300005456 Bacteria 2315
19 Ga0070672_100010341 3300005543 Bacteria 6471
20 Ga0070665_100011498 3300005548 Bacteria 8951
21 Ga0068857_100052401 3300005577 Bacteria 3621
22 Ga0068857_100409826 3300005577 Bacteria 1262
23 Ga0068854_100215062 3300005578 Bacteria 1518
24 Ga0068854_100265124 3300005578 Bacteria 1377
25 Ga0068856_100510957 3300005614 Unclassified 1222
26 Ga0070702_100310358 3300005615 Bacteria 1095
27 Ga0068859_100001187 3300005617 Bacteria 26598
28 Ga0068866_10019737 3300005718 Unclassified 3075
29 Ga0068861_100180658 3300005719 Bacteria 1756
30 Ga0068861_100282146 3300005719 Unclassified 1431
31 Ga0068863_100001286 3300005841 Bacteria 25048
32 Ga0068858_100000563 3300005842 Bacteria 38712
33 Ga0068860_100056706 3300005843 Unclassified 3723
34 Ga0068860_100092133 3300005843 Bacteria 2887
35 Ga0068860_100423217 3300005843 Unclassified 1320
36 Ga0068862_100001554 3300005844 Bacteria 20983
37 Ga0068862_100026186 3300005844 Bacteria 4903
38 Ga0068862_100032426 3300005844 Bacteria 4414
39 Ga0081455_10000831 3300005937 Bacteria 39753
40 Ga0081540_1000121 3300005983 Bacteria 82449
41 Ga0081540_1000294 3300005983 Bacteria 52415
42 Ga0081540_1018764 3300005983 Bacteria 4229
43 Ga0081539_10000114 3300005985 Bacteria 188734
44 Ga0081539_10002009 3300005985 Bacteria 30805
45 Ga0081539_10257881 3300005985 Unclassified 771
46 Ga0070716_100109523 3300006173 Unclassified 1709
47 Ga0070712_100181253 3300006175 Bacteria 1641
48 Ga0097621_100294821 3300006237 Unclassified 1431
49 Ga0097621_100340923 3300006237 Unclassified 1331
50 Ga0068871_100005963 3300006358 Bacteria 8579
51 Ga0068871_100843446 3300006358 Unclassified 847
52 Ga0075428_100021527 3300006844 Bacteria 7136
53 Ga0075428_100105523 3300006844 Bacteria 3073
54 Ga0075428_101269716 3300006844 Unclassified 775
55 Ga0075431_100070602 3300006847 Bacteria 3604
56 Ga0075431_100175019 3300006847 Bacteria 2204
57 Ga0075434_100015456 3300006871 Bacteria 7320
58 Ga0097620_100001187 3300006931 Bacteria 26598
59 Ga0111539_10035935 3300009094 Bacteria 5996
60 Ga0111539_10695185 3300009094 Unclassified 1184
61 Ga0105247_10000921 3300009101 Bacteria 22108
62 Ga0114129_10425745 3300009147 Bacteria 1745
63 Ga0105248_10029438 3300009177 Bacteria 6126
64 Ga0105237_10381435 3300009545 Unclassified 1414
65 Ga0105249_10055420 3300009553 Bacteria 3627
66 Ga0105249_10169932 3300009553 Unclassified 2113
67 Ga0105249_10997697 3300009553 Bacteria 906
68 Ga0105246_10234427 3300011119 Bacteria 1447
69 Ga0163162_10757193 3300013306 Unclassified 1090
70 Ga0163163_10205044 3300014325 Bacteria 2020
71 Ga0157380_10015483 3300014326 Bacteria 5607
72 Ga0157380_10415264 3300014326 Unclassified 1281
73 Ga0157380_10478631 3300014326 Unclassified 1203
74 Ga0157377_10004716 3300014745 Bacteria 6313
75 Ga0157379_10309313 3300014968 Bacteria 1441
76 Ga0157379_10492362 3300014968 Bacteria 1136
77 Ga0157376_10071212 3300014969 Bacteria 2954
78 Ga0157376_10071411 3300014969 Bacteria 2950
79 Ga0209130_1000297 3300025284 Bacteria 60549
80 Ga0209025_1000486 3300025294 Bacteria 76804
81 Ga0209758_1009925 3300025297 Bacteria 5805
82 Ga0209050_1000196 3300025298 Bacteria 135678
83 Ga0207426_1000196 3300025302 Bacteria 146687
84 Ga0209257_1000228 3300025304 Bacteria 133390
85 Ga0207710_10002190 3300025900 Bacteria 9184
86 Ga0207688_10065393 3300025901 Bacteria 2055
87 Ga0207680_10107174 3300025903 Unclassified 1806
88 Ga0207645_10068175 3300025907 Bacteria 2274
89 Ga0207643_10160291 3300025908 Bacteria 1353
90 Ga0207671_10374573 3300025914 Bacteria 1131
91 Ga0207671_10518683 3300025914 Unclassified 950
92 Ga0207693_10179552 3300025915 Bacteria 1665
93 Ga0207681_10019295 3300025923 Bacteria 4307
94 Ga0207681_10116378 3300025923 Bacteria 1953
95 Ga0207650_10217440 3300025925 Unclassified 1537
96 Ga0207644_10007333 3300025931 Bacteria 7180
97 Ga0207706_10011921 3300025933 Bacteria 7915
98 Ga0207669_10044579 3300025937 Bacteria 2607
99 Ga0207665_10045862 3300025939 Unclassified 2927
100 Ga0207691_10018172 3300025940 Bacteria 6661
101 Ga0207711_10066231 3300025941 Unclassified 3124
102 Ga0207689_10004557 3300025942 Bacteria 12545
103 Ga0207689_10181688 3300025942 Unclassified 1734
104 Ga0207661_11150721 3300025944 Unclassified 714
105 Ga0207667_10267356 3300025949 Unclassified 1748
106 Ga0207712_10078783 3300025961 Bacteria 2392
107 Ga0207712_10111056 3300025961 Unclassified 2056
108 Ga0207712_10382562 3300025961 Unclassified 1178
109 Ga0207658_10096608 3300025986 Unclassified 2304
110 Ga0207703_10002131 3300026035 Bacteria 17413
111 Ga0207639_10007284 3300026041 Bacteria 7535
112 Ga0207702_10156334 3300026078 Unclassified 2079
113 Ga0207641_10385861 3300026088 Unclassified 1342
114 Ga0207676_10660085 3300026095 Bacteria 1010
115 Ga0207676_10910266 3300026095 Unclassified 863
116 Ga0207674_10262358 3300026116 Bacteria 1675
117 Ga0207675_100043813 3300026118 Bacteria 4179
118 Ga0207675_100133249 3300026118 Bacteria 2356
119 Ga0207683_10046284 3300026121 Bacteria 3807
120 Ga0207698_10589440 3300026142 Bacteria 1095
121 Ga0207428_10041483 3300027907 Bacteria 3725
122 Ga0207428_10235230 3300027907 Bacteria 1370
123 Ga0268266_10042416 3300028379 Bacteria 3886
124 Ga0268266_10214559 3300028379 Bacteria 1766
125 Ga0268266_10296042 3300028379 Unclassified 1508
126 Ga0268265_10009834 3300028380 Bacteria 6455
127 Ga0268265_10035175 3300028380 Bacteria 3657
128 Ga0268265_10411642 3300028380 Unclassified 1253
129 Ga0268265_10677915 3300028380 Unclassified 994
130 Ga0268264_10000100 3300028381 Bacteria 227852
131 Ga0268264_10138608 3300028381 Unclassified 2166
132 Ga0268264_10700736 3300028381 Unclassified 1006
133 Ga0265331_10009804 3300031250 Bacteria 5342
134 Ga0307513_10031529 3300031456 Bacteria 6000
135 Ga0307513_10302804 3300031456 Bacteria 1364
136 Ga0307509_10150662 3300031507 Unclassified 2242
137 Ga0307508_10008588 3300031616 Bacteria 9430
138 Ga0307516_10432649 3300031730 Unclassified 973
139 Ga0307406_10231953 3300031901 Bacteria 1379
140 Ga0307411_10234057 3300032005 Bacteria 1434
141 Ga0307415_100469150 3300032126 Bacteria 1093
142 Ga0307510_10100210 3300033180 Bacteria 2691
143 Ga0373949_0000935 3300035090 Bacteria 9111
144 Ga0373936_0060893 3300035113 Bacteria 1540
145 Ga0451798_0884957 3300041458 Bacteria 1209
146 Ga0466959_0004436 3300045049 Bacteria 9398
147 Ga0495610_0010531 3300046512 Bacteria 5736
148 Ga0495610_0112679 3300046512 Bacteria 1203
149 Ga0495616_0025279 3300046513 Bacteria 3175
150 Ga0495663_0030689 3300046525 Bacteria 1594
151 Ga0495668_0000001 3300046616 Bacteria 1013420
152 Ga0495649_0001237 3300046694 Bacteria 19656
153 Ga0496104_0105324 3300048907 Bacteria 2703
154 Ga0496104_0742529 3300048907 Bacteria 889
155 Ga0496106_0592507 3300048909 Unclassified 888
156 Ga0496107_0175023 3300048910 Bacteria 1593
157 Ga0496108_0058903 3300048911 Bacteria 3230
158 Ga0496112_0179658 3300048915 Unclassified 2080
159 Ga0496121_0000613 3300048924 Bacteria 66392
160 Ga0496125_0084609 3300048928 Unclassified 2408
161 Ga0501034_0294954 3300049571 Bacteria 1559
162 nmdc:mga09592_206286_c1 3300050508 Bacteria 1702
163 nmdc:mga06r32_410175_c1 3300050510 Bacteria 1336
164 nmdc:mga06r32_644_c1 3300050510 Bacteria 30414
165 nmdc:mga08y16_68387_c1 3300050511 Bacteria 3703
166 nmdc:mga08y16_98200_c1 3300050511 Bacteria 3050
167 nmdc:mga0n895_43611_c1 3300050512 Unclassified 4371
168 nmdc:mga0rr50_309782_c1 3300050513 Bacteria 1322
169 Ga0500610_0000212 3300053079 Bacteria 17831
170 Ga0500583_0010876 3300053092 Bacteria 3400
171 Ga0500583_0018580 3300053092 Bacteria 2830
172 Ga0500651_0003492 3300053093 Bacteria 8593
173 Ga0500642_0182345 3300053130 Unclassified 981
174 Ga0500642_0256748 3300053130 Unclassified 801
175 Ga0500616_0071088 3300053153 Unclassified 1774
176 Ga0500637_0202845 3300053178 Unclassified 1128

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005328 Ga0070676_10027292 Ga0070676_100272922 192
2 3300005345 Ga0070692_10164724 Ga0070692_101647242 192
3 3300005577 Ga0068857_100052401 Ga0068857_1000524015 192
4 3300005615 Ga0070702_100310358 Ga0070702_1003103582 192
5 3300005844 Ga0068862_100001554 Ga0068862_1000015545 192
6 3300006844 Ga0075428_100021527 Ga0075428_1000215272 192
7 3300006847 Ga0075431_100175019 Ga0075431_1001750192 192
8 3300009094 Ga0111539_10035935 Ga0111539_100359356 192
9 3300011119 Ga0105246_10234427 Ga0105246_102344271 192
10 3300014326 Ga0157380_10415264 Ga0157380_104152641 192
11 3300025907 Ga0207645_10068175 Ga0207645_100681752 192
12 3300025908 Ga0207643_10160291 Ga0207643_101602912 192
13 3300025923 Ga0207681_10116378 Ga0207681_101163783 192
14 3300025933 Ga0207706_10011921 Ga0207706_100119212 192
15 3300026095 Ga0207676_10660085 Ga0207676_106600852 192
16 3300026116 Ga0207674_10262358 Ga0207674_102623583 192
17 3300027907 Ga0207428_10041483 Ga0207428_100414835 192
18 3300028380 Ga0268265_10009834 Ga0268265_100098344 192
19 3300028381 Ga0268264_10700736 Ga0268264_107007362 192
20 3300050511 nmdc:mga08y16_98200_c1 nmdc:mga08y16_98200_c1_2200_2784 192
21 3300006844 Ga0075428_100105523 Ga0075428_1001055234 193
22 3300006847 Ga0075431_100070602 Ga0075431_1000706023 193
23 3300028380 Ga0268265_10411642 Ga0268265_104116422 193
24 3300031616 Ga0307508_10008588 Ga0307508_100085888 193
25 3300046513 Ga0495616_0025279 Ga0495616_0025279_404_985 193
26 3300050508 nmdc:mga09592_206286_c1 nmdc:mga09592_206286_c1_667_1257 193
27 3300050510 nmdc:mga06r32_410175_c1 nmdc:mga06r32_410175_c1_452_1048 193
28 3300050510 nmdc:mga06r32_644_c1 nmdc:mga06r32_644_c1_4044_4634 193
29 3300053130 Ga0500642_0256748 Ga0500642_0256748_38_622 193
30 3300053153 Ga0500616_0071088 Ga0500616_0071088_34_618 193
31 3300003659 JGI25404J52841_10005158 JGI25404J52841_100051582 194
32 3300005334 Ga0068869_100001572 Ga0068869_10000157210 194
33 3300005334 Ga0068869_100218458 Ga0068869_1002184582 194
34 3300005334 Ga0068869_100878583 Ga0068869_1008785831 194
35 3300005353 Ga0070669_100236064 Ga0070669_1002360642 194
36 3300005356 Ga0070674_100068455 Ga0070674_1000684552 194
37 3300005441 Ga0070700_100573364 Ga0070700_1005733641 194
38 3300005456 Ga0070678_100093278 Ga0070678_1000932782 194
39 3300005543 Ga0070672_100010341 Ga0070672_1000103415 194
40 3300005548 Ga0070665_100011498 Ga0070665_1000114983 194
41 3300005578 Ga0068854_100265124 Ga0068854_1002651242 194
42 3300005614 Ga0068856_100510957 Ga0068856_1005109572 194
43 3300005718 Ga0068866_10019737 Ga0068866_100197372 194
44 3300005719 Ga0068861_100282146 Ga0068861_1002821462 194
45 3300005843 Ga0068860_100056706 Ga0068860_1000567064 194
46 3300005843 Ga0068860_100092133 Ga0068860_1000921333 194
47 3300005937 Ga0081455_10000831 Ga0081455_100008317 194
48 3300005983 Ga0081540_1000121 Ga0081540_100012163 194
49 3300005983 Ga0081540_1000294 Ga0081540_100029432 194
50 3300005985 Ga0081539_10000114 Ga0081539_1000011489 194
51 3300005985 Ga0081539_10257881 Ga0081539_102578812 194
52 3300006173 Ga0070716_100109523 Ga0070716_1001095231 194
53 3300006175 Ga0070712_100181253 Ga0070712_1001812532 194
54 3300006237 Ga0097621_100294821 Ga0097621_1002948212 194
55 3300006358 Ga0068871_100005963 Ga0068871_1000059634 194
56 3300006871 Ga0075434_100015456 Ga0075434_1000154569 194
57 3300009147 Ga0114129_10425745 Ga0114129_104257453 194
58 3300009545 Ga0105237_10381435 Ga0105237_103814353 194
59 3300009553 Ga0105249_10055420 Ga0105249_100554202 194
60 3300009553 Ga0105249_10997697 Ga0105249_109976972 194
61 3300014326 Ga0157380_10478631 Ga0157380_104786312 194
62 3300014745 Ga0157377_10004716 Ga0157377_100047167 194
63 3300014968 Ga0157379_10309313 Ga0157379_103093132 194
64 3300014969 Ga0157376_10071212 Ga0157376_100712122 194
65 3300014969 Ga0157376_10071411 Ga0157376_100714112 194
66 3300025901 Ga0207688_10065393 Ga0207688_100653933 194
67 3300025914 Ga0207671_10374573 Ga0207671_103745732 194
68 3300025914 Ga0207671_10518683 Ga0207671_105186832 194
69 3300025915 Ga0207693_10179552 Ga0207693_101795522 194
70 3300025923 Ga0207681_10019295 Ga0207681_100192954 194
71 3300025925 Ga0207650_10217440 Ga0207650_102174402 194
72 3300025937 Ga0207669_10044579 Ga0207669_100445794 194
73 3300025939 Ga0207665_10045862 Ga0207665_100458624 194
74 3300025940 Ga0207691_10018172 Ga0207691_100181725 194
75 3300025942 Ga0207689_10004557 Ga0207689_100045577 194
76 3300025942 Ga0207689_10181688 Ga0207689_101816882 194
77 3300025944 Ga0207661_11150721 Ga0207661_111507211 194
78 3300025949 Ga0207667_10267356 Ga0207667_102673563 194
79 3300025961 Ga0207712_10078783 Ga0207712_100787834 194
80 3300026078 Ga0207702_10156334 Ga0207702_101563344 194
81 3300026095 Ga0207676_10910266 Ga0207676_109102662 194
82 3300026118 Ga0207675_100133249 Ga0207675_1001332492 194
83 3300026121 Ga0207683_10046284 Ga0207683_100462842 194
84 3300027907 Ga0207428_10235230 Ga0207428_102352302 194
85 3300028379 Ga0268266_10042416 Ga0268266_100424164 194
86 3300028379 Ga0268266_10296042 Ga0268266_102960423 194
87 3300028380 Ga0268265_10677915 Ga0268265_106779152 194
88 3300028381 Ga0268264_10000100 Ga0268264_1000010027 194
89 3300031250 Ga0265331_10009804 Ga0265331_100098042 194
90 3300031456 Ga0307513_10031529 Ga0307513_100315292 194
91 3300031456 Ga0307513_10302804 Ga0307513_103028042 194
92 3300031507 Ga0307509_10150662 Ga0307509_101506623 194
93 3300031901 Ga0307406_10231953 Ga0307406_102319531 194
94 3300032126 Ga0307415_100469150 Ga0307415_1004691501 194
95 3300035090 Ga0373949_0000935 Ga0373949_0000935_7754_8341 194
96 3300035113 Ga0373936_0060893 Ga0373936_0060893_752_1339 194
97 3300045049 Ga0466959_0004436 Ga0466959_0004436_5081_5668 194
98 3300046694 Ga0495649_0001237 Ga0495649_0001237_799_1386 194
99 3300048907 Ga0496104_0105324 Ga0496104_0105324_947_1549 194
100 3300048907 Ga0496104_0742529 Ga0496104_0742529_256_840 194
101 3300048910 Ga0496107_0175023 Ga0496107_0175023_978_1580 194
102 3300049571 Ga0501034_0294954 Ga0501034_0294954_810_1397 194
103 3300050511 nmdc:mga08y16_68387_c1 nmdc:mga08y16_68387_c1_185_787 194
104 3300053130 Ga0500642_0182345 Ga0500642_0182345_167_766 194
105 3300003187 JGI25151J46595_10000613 JGI25151J46595_100006138 195
106 3300003354 JGI25160J50197_1020164 JGI25160J50197_10201642 195
107 3300003791 Ga0055530_10000582 Ga0055530_1000058216 195
108 3300003794 Ga0055531_10000116 Ga0055531_1000011679 195
109 3300005335 Ga0070666_10103547 Ga0070666_101035471 195
110 3300005337 Ga0070682_100096853 Ga0070682_1000968532 195
111 3300005344 Ga0070661_100255414 Ga0070661_1002554141 195
112 3300005367 Ga0070667_100003762 Ga0070667_10000376214 195
113 3300005577 Ga0068857_100409826 Ga0068857_1004098262 195
114 3300005578 Ga0068854_100215062 Ga0068854_1002150622 195
115 3300005617 Ga0068859_100001187 Ga0068859_1000011874 195
116 3300005719 Ga0068861_100180658 Ga0068861_1001806582 195
117 3300005841 Ga0068863_100001286 Ga0068863_10000128612 195
118 3300005842 Ga0068858_100000563 Ga0068858_10000056316 195
119 3300005843 Ga0068860_100423217 Ga0068860_1004232172 195
120 3300005844 Ga0068862_100026186 Ga0068862_1000261863 195
121 3300005844 Ga0068862_100032426 Ga0068862_1000324261 195
122 3300005983 Ga0081540_1018764 Ga0081540_10187645 195
123 3300005985 Ga0081539_10002009 Ga0081539_100020092 195
124 3300006237 Ga0097621_100340923 Ga0097621_1003409232 195
125 3300006358 Ga0068871_100843446 Ga0068871_1008434462 195
126 3300006844 Ga0075428_101269716 Ga0075428_1012697162 195
127 3300006931 Ga0097620_100001187 Ga0097620_10000118729 195
128 3300009094 Ga0111539_10695185 Ga0111539_106951853 195
129 3300009101 Ga0105247_10000921 Ga0105247_1000092111 195
130 3300009177 Ga0105248_10029438 Ga0105248_100294383 195
131 3300009553 Ga0105249_10169932 Ga0105249_101699323 195
132 3300013306 Ga0163162_10757193 Ga0163162_107571932 195
133 3300014325 Ga0163163_10205044 Ga0163163_102050443 195
134 3300014326 Ga0157380_10015483 Ga0157380_100154832 195
135 3300014968 Ga0157379_10492362 Ga0157379_104923622 195
136 3300025284 Ga0209130_1000297 Ga0209130_100029726 195
137 3300025294 Ga0209025_1000486 Ga0209025_10004868 195
138 3300025297 Ga0209758_1009925 Ga0209758_10099254 195
139 3300025298 Ga0209050_1000196 Ga0209050_1000196127 195
140 3300025302 Ga0207426_1000196 Ga0207426_100019628 195
141 3300025304 Ga0209257_1000228 Ga0209257_1000228127 195
142 3300025900 Ga0207710_10002190 Ga0207710_100021902 195
143 3300025903 Ga0207680_10107174 Ga0207680_101071741 195
144 3300025931 Ga0207644_10007333 Ga0207644_100073336 195
145 3300025941 Ga0207711_10066231 Ga0207711_100662312 195
146 3300025961 Ga0207712_10111056 Ga0207712_101110562 195
147 3300025961 Ga0207712_10382562 Ga0207712_103825623 195
148 3300025986 Ga0207658_10096608 Ga0207658_100966083 195
149 3300026035 Ga0207703_10002131 Ga0207703_100021316 195
150 3300026041 Ga0207639_10007284 Ga0207639_100072845 195
151 3300026088 Ga0207641_10385861 Ga0207641_103858612 195
152 3300026118 Ga0207675_100043813 Ga0207675_1000438133 195
153 3300026142 Ga0207698_10589440 Ga0207698_105894402 195
154 3300028379 Ga0268266_10214559 Ga0268266_102145591 195
155 3300028380 Ga0268265_10035175 Ga0268265_100351752 195
156 3300028381 Ga0268264_10138608 Ga0268264_101386082 195
157 3300031730 Ga0307516_10432649 Ga0307516_104326491 195
158 3300032005 Ga0307411_10234057 Ga0307411_102340572 195
159 3300033180 Ga0307510_10100210 Ga0307510_101002103 195
160 3300041458 Ga0451798_0884957 Ga0451798_0884957_83_808 195
161 3300046512 Ga0495610_0010531 Ga0495610_0010531_3169_3756 195
162 3300046512 Ga0495610_0112679 Ga0495610_0112679_356_943 195
163 3300046525 Ga0495663_0030689 Ga0495663_0030689_581_1183 195
164 3300046616 Ga0495668_0000001 Ga0495668_0000001_646195_646785 195
165 3300048909 Ga0496106_0592507 Ga0496106_0592507_25_627 195
166 3300048911 Ga0496108_0058903 Ga0496108_0058903_925_1527 195
167 3300048915 Ga0496112_0179658 Ga0496112_0179658_130_732 195
168 3300048924 Ga0496121_0000613 Ga0496121_0000613_62580_63182 195
169 3300048928 Ga0496125_0084609 Ga0496125_0084609_1030_1632 195
170 3300050512 nmdc:mga0n895_43611_c1 nmdc:mga0n895_43611_c1_3109_3699 195
171 3300050513 nmdc:mga0rr50_309782_c1 nmdc:mga0rr50_309782_c1_718_1308 195
172 3300053079 Ga0500610_0000212 Ga0500610_0000212_17002_17598 195
173 3300053092 Ga0500583_0010876 Ga0500583_0010876_358_948 195
174 3300053092 Ga0500583_0018580 Ga0500583_0018580_1884_2474 195
175 3300053093 Ga0500651_0003492 Ga0500651_0003492_4828_5418 195
176 3300053178 Ga0500637_0202845 Ga0500637_0202845_313_903 195

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09347

DUF1989

Domain of unknown function (DUF1989)

5

168

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3oru-assembly1.cif.gz_A crystal structure of a duf1989 family protein (tm1040_0329) from silicibacter sp. tm1040 at 1.11 a resolution 0.8912 2 194
3oru-assembly1.cif.gz_A crystal structure of a duf1989 family protein (tm1040_0329) from silicibacter sp. tm1040 at 1.11 a resolution 0.878 2 194
3di4-assembly1.cif.gz_B crystal structure of a duf1989 family protein (spo0365) from silicibacter pomeroyi dss-3 at 1.60 a resolution 0.8685 1 194
3di4-assembly1.cif.gz_B crystal structure of a duf1989 family protein (spo0365) from silicibacter pomeroyi dss-3 at 1.60 a resolution 0.8602 1 194
2ixl-assembly2.cif.gz_D rmlc s. suis with dtdp-rhamnose 0.5648 2 195
ID Description Score Start End Superfamily
af_E7F3I6_19_100_2.60.120.1030 Mainly Beta;Sandwich;Jelly Rolls;Clp1, DNA binding domain 0.6488 9 173 2.60.120.1030
af_A4ID25_1_85_2.60.120.1030 Mainly Beta;Sandwich;Jelly Rolls;Clp1, DNA binding domain 0.5887 2 195 2.60.120.1030
3ejkA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.5814 2 195 2.60.120.10
af_A4ID25_1_85_2.60.120.1030 Mainly Beta;Sandwich;Jelly Rolls;Clp1, DNA binding domain 0.5594 2 195 2.60.120.1030
2ixlA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.5584 2 195 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A4P6FP53-F1-model_v4 Urea carboxylase-associated family protein 0.9538 2 194
AF-A0A2P7QGD6-F1-model_v4 Urea carboxylase-associated protein 0.9537 1 195
AF-A0A2P7QGD6-F1-model_v4 Urea carboxylase-associated protein 0.9441 1 195
AF-A0A7T8MQE2-F1-model_v4 deleted 0.937 1 193
AF-A0A4P6FP53-F1-model_v4 Urea carboxylase-associated family protein 0.9347 2 194

Feature Viewer

pLDDT pTM Quality
90.9 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map