F270490

General Info

Members Datasets Scaffolds Average Seq Length
177 117 177 131

Family's Representative Sequence

Representative Sequence 3300032002|Ga0307416_100951441|Ga0307416_1009514412
Length 151
Sequence MSNDTSIESSVTMWNPFALRRISVAVLGRMGERRAAWFYRLRGYRVAGQNIRLPAGEIDLVARRGRTVVVAEVKTRQNKWAGQGHEAVNATKRARLVRLADQYVAGLRERDLEIRYDILSLFWNGRRFVISHYADAFRPVADARQPWRWSV

Samples

Sample ID Description Type Environment
1 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
59 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
62 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
63 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
64 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
98 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
99 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
100 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
101 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
102 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
103 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
104 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
105 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
106 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
107 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
108 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
109 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
110 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
111 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
112 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
113 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
114 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
115 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
116 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
117 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 94.35
Stem 0
Stem Tuber 0
Unclassified 5.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065707_10101061 3300005295 Bacteria 2887
2 Ga0070658_10309001 3300005327 Bacteria 1349
3 Ga0070658_10859284 3300005327 Bacteria 788
4 Ga0070676_10228694 3300005328 Bacteria 1232
5 Ga0070683_100000067 3300005329 Bacteria 73813
6 Ga0070690_100280742 3300005330 Bacteria 1188
7 Ga0070670_100001696 3300005331 Bacteria 17922
8 Ga0070670_100176432 3300005331 Bacteria 1854
9 Ga0068869_100005369 3300005334 Bacteria 8054
10 Ga0068869_100145160 3300005334 Bacteria 1836
11 Ga0070682_100000006 3300005337 Bacteria 369078
12 Ga0070682_101523184 3300005337 Bacteria 576
13 Ga0068868_100000607 3300005338 Bacteria 24092
14 Ga0068868_100052120 3300005338 Bacteria 3221
15 Ga0070689_100008222 3300005340 Bacteria 7337
16 Ga0070689_101153310 3300005340 Bacteria 694
17 Ga0070689_101437022 3300005340 Unclassified 624
18 Ga0070687_100005388 3300005343 Bacteria 5173
19 Ga0070661_100076724 3300005344 Bacteria 2463
20 Ga0070692_10042171 3300005345 Bacteria 2342
21 Ga0070675_100000016 3300005354 Bacteria 199687
22 Ga0070671_100275218 3300005355 Bacteria 1431
23 Ga0070674_100325219 3300005356 Bacteria 1234
24 Ga0070674_100367959 3300005356 Bacteria 1166
25 Ga0070673_100444740 3300005364 Unclassified 1165
26 Ga0070678_100514258 3300005456 Bacteria 1058
27 Ga0070685_10208354 3300005466 Bacteria 1274
28 Ga0070706_100008951 3300005467 Bacteria 9321
29 Ga0070707_100295019 3300005468 Unclassified 1575
30 Ga0070707_100901816 3300005468 Unclassified 848
31 Ga0070707_100982468 3300005468 Unclassified 809
32 Ga0070707_101126798 3300005468 Unclassified 751
33 Ga0070698_100236840 3300005471 Unclassified 1758
34 Ga0070679_101233487 3300005530 Unclassified 693
35 Ga0070684_100000186 3300005535 Bacteria 42974
36 Ga0070684_100606826 3300005535 Bacteria 1018
37 Ga0068853_100031318 3300005539 Bacteria 4499
38 Ga0068853_100119237 3300005539 Bacteria 2352
39 Ga0070672_100022071 3300005543 Bacteria 4668
40 Ga0070696_100361835 3300005546 Bacteria 1126
41 Ga0068855_100025347 3300005563 Bacteria 7096
42 Ga0068855_100722034 3300005563 Bacteria 1065
43 Ga0068857_100360365 3300005577 Bacteria 1348
44 Ga0068854_100026310 3300005578 Bacteria 3998
45 Ga0068854_100472780 3300005578 Unclassified 1051
46 Ga0068856_100054937 3300005614 Bacteria 3930
47 Ga0068852_100000317 3300005616 Bacteria 32757
48 Ga0068852_100131917 3300005616 Bacteria 2302
49 Ga0068859_101215031 3300005617 Bacteria 830
50 Ga0068864_100000037 3300005618 Bacteria 188796
51 Ga0068870_10106899 3300005840 Unclassified 1591
52 Ga0068858_100000110 3300005842 Bacteria 86502
53 Ga0070717_10205706 3300006028 Bacteria 1726
54 Ga0097621_101029865 3300006237 Unclassified 771
55 Ga0068871_100642601 3300006358 Unclassified 968
56 Ga0068871_101203515 3300006358 Bacteria 711
57 Ga0075428_100015714 3300006844 Bacteria 8388
58 Ga0075429_100942540 3300006880 Unclassified 755
59 Ga0097620_101214825 3300006931 Bacteria 830
60 Ga0097620_101499808 3300006931 Unclassified 744
61 Ga0105244_10012422 3300009036 Bacteria 5031
62 Ga0105240_10024623 3300009093 Bacteria 7929
63 Ga0105240_10111936 3300009093 Bacteria 3301
64 Ga0111539_10000006 3300009094 Bacteria 463720
65 Ga0105245_10000013 3300009098 Bacteria 266248
66 Ga0105245_10001437 3300009098 Bacteria 21598
67 Ga0114129_10891524 3300009147 Unclassified 1128
68 Ga0105243_10255170 3300009148 Bacteria 1568
69 Ga0105242_10014420 3300009176 Bacteria 6123
70 Ga0105238_10000001 3300009551 Bacteria 2036163
71 Ga0105238_10147169 3300009551 Bacteria 2331
72 Ga0105239_13631761 3300010375 Bacteria 501
73 Ga0157374_10000010 3300013296 Bacteria 505635
74 Ga0157378_10000129 3300013297 Bacteria 73260
75 Ga0157378_10000846 3300013297 Bacteria 28335
76 Ga0157378_10025268 3300013297 Bacteria 5231
77 Ga0157378_10667070 3300013297 Bacteria 1057
78 Ga0157378_11519717 3300013297 Bacteria 714
79 Ga0157378_11930593 3300013297 Unclassified 640
80 Ga0163162_13095992 3300013306 Bacteria 534
81 Ga0157372_10295988 3300013307 Unclassified 1882
82 Ga0157372_11816864 3300013307 Bacteria 701
83 Ga0157375_10000004 3300013308 Bacteria 474935
84 Ga0157375_10000013 3300013308 Bacteria 323500
85 Ga0157375_10000939 3300013308 Bacteria 25256
86 Ga0157375_10841578 3300013308 Bacteria 1064
87 Ga0163163_10468823 3300014325 Unclassified 1320
88 Ga0163163_12382782 3300014325 Unclassified 588
89 Ga0157380_10032351 3300014326 Bacteria 4022
90 Ga0157377_10000015 3300014745 Bacteria 190735
91 Ga0157377_10000084 3300014745 Bacteria 72556
92 Ga0157379_10734325 3300014968 Unclassified 929
93 Ga0157376_10000019 3300014969 Bacteria 255553
94 Ga0213873_10000003 3300021358 Bacteria 973849
95 Ga0213873_10000349 3300021358 Bacteria 7714
96 Ga0213876_10000003 3300021384 Bacteria 973849
97 Ga0213876_10000014 3300021384 Bacteria 310412
98 Ga0213876_10002886 3300021384 Bacteria 9980
99 Ga0213876_10007667 3300021384 Bacteria 5860
100 Ga0207647_10014492 3300025904 Bacteria 5434
101 Ga0207645_10278844 3300025907 Bacteria 1110
102 Ga0207643_10010934 3300025908 Bacteria 4895
103 Ga0207643_10021846 3300025908 Bacteria 3520
104 Ga0207705_10000004 3300025909 Bacteria 705756
105 Ga0207705_10467232 3300025909 Unclassified 979
106 Ga0207684_10215284 3300025910 Bacteria 1657
107 Ga0207695_10019191 3300025913 Bacteria 7876
108 Ga0207662_10020134 3300025918 Bacteria 3806
109 Ga0207649_10370656 3300025920 Unclassified 1065
110 Ga0207652_10810199 3300025921 Unclassified 831
111 Ga0207646_10145814 3300025922 Unclassified 2133
112 Ga0207646_10754140 3300025922 Bacteria 868
113 Ga0207694_10000001 3300025924 Bacteria 4078485
114 Ga0207694_10097026 3300025924 Bacteria 2332
115 Ga0207650_10000284 3300025925 Bacteria 52149
116 Ga0207650_10412736 3300025925 Bacteria 1119
117 Ga0207659_10000011 3300025926 Bacteria 275661
118 Ga0207659_11171241 3300025926 Bacteria 661
119 Ga0207687_10000014 3300025927 Bacteria 297704
120 Ga0207687_10003533 3300025927 Bacteria 10517
121 Ga0207686_10050372 3300025934 Bacteria 2589
122 Ga0207686_10474003 3300025934 Unclassified 967
123 Ga0207709_11103277 3300025935 Bacteria 651
124 Ga0207670_10001650 3300025936 Bacteria 11643
125 Ga0207670_10301668 3300025936 Bacteria 1254
126 Ga0207670_10335657 3300025936 Unclassified 1193
127 Ga0207670_10965935 3300025936 Bacteria 716
128 Ga0207669_10187062 3300025937 Bacteria 1490
129 Ga0207669_10338393 3300025937 Unclassified 1158
130 Ga0207691_10051738 3300025940 Bacteria 3754
131 Ga0207691_11663647 3300025940 Bacteria 517
132 Ga0207689_10007788 3300025942 Bacteria 9371
133 Ga0207689_10008562 3300025942 Bacteria 8917
134 Ga0207661_10000004 3300025944 Bacteria 606391
135 Ga0207667_10314843 3300025949 Bacteria 1598
136 Ga0207651_10454489 3300025960 Bacteria 1099
137 Ga0207640_10002108 3300025981 Bacteria 10695
138 Ga0207640_10233424 3300025981 Unclassified 1417
139 Ga0207677_10000015 3300026023 Bacteria 173792
140 Ga0207677_10000310 3300026023 Bacteria 35796
141 Ga0207703_10000008 3300026035 Bacteria 373718
142 Ga0207703_10190114 3300026035 Unclassified 1818
143 Ga0207639_10051132 3300026041 Bacteria 3142
144 Ga0207702_10004299 3300026078 Bacteria 12693
145 Ga0207648_11518949 3300026089 Bacteria 630
146 Ga0207648_11734124 3300026089 Bacteria 586
147 Ga0207676_10000028 3300026095 Bacteria 237195
148 Ga0207674_10021207 3300026116 Bacteria 7004
149 Ga0207674_10455470 3300026116 Bacteria 1236
150 Ga0207683_10393291 3300026121 Bacteria 1275
151 Ga0207698_10000192 3300026142 Bacteria 38082
152 Ga0207698_10034356 3300026142 Bacteria 3695
153 Ga0207428_10000007 3300027907 Bacteria 463715
154 Ga0307511_10040677 3300030521 Bacteria 3942
155 Ga0307416_100951441 3300032002 Bacteria 961
156 Ga0307411_11969180 3300032005 Unclassified 545
157 Ga0373932_0001103 3300035112 Bacteria 7787
158 Ga0395905_1335073 3300037471 Unclassified 621
159 Ga0395901_1265770 3300038443 Unclassified 701
160 Ga0436365_0013393 3300039437 Bacteria 46110
161 Ga0436365_0501978 3300039437 Bacteria 11795
162 Ga0436365_0537254 3300039437 Bacteria 270734
163 Ga0436365_1778154 3300039437 Bacteria 2785
164 Ga0436362_0807288 3300039453 Bacteria 8560
165 Ga0436362_1234996 3300039453 Bacteria 292548
166 Ga0451839_0391695 3300041496 Bacteria 808
167 Ga0453683_0027551 3300044673 Bacteria 3603
168 Ga0495620_0001995 3300046515 Bacteria 11928
169 Ga0495679_006785 3300047446 Bacteria 4874
170 Ga0501073_0053990 3300049589 Unclassified 2813
171 Ga0501080_0076922 3300049742 Bacteria 3103
172 nmdc:mga05p37_45231_c1 3300050507 Bacteria 5416
173 nmdc:mga09592_876092_c1 3300050508 Unclassified 756
174 nmdc:mga06r32_15080_c1 3300050510 Bacteria 7018
175 nmdc:mga08y16_11_c1 3300050511 Bacteria 463712
176 nmdc:mga0rr50_561494_c1 3300050513 Bacteria 972
177 Ga0501084_0106571 3300054114 Bacteria 2355

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005327 Ga0070658_10859284 Ga0070658_108592841 109
2 3300005539 Ga0068853_100119237 Ga0068853_1001192373 109
3 3300005563 Ga0068855_100025347 Ga0068855_1000253478 109
4 3300005563 Ga0068855_100722034 Ga0068855_1007220342 109
5 3300005578 Ga0068854_100026310 Ga0068854_1000263104 109
6 3300005614 Ga0068856_100054937 Ga0068856_1000549373 109
7 3300005616 Ga0068852_100000317 Ga0068852_10000031721 109
8 3300005616 Ga0068852_100131917 Ga0068852_1001319172 109
9 3300009093 Ga0105240_10024623 Ga0105240_100246237 109
10 3300009551 Ga0105238_10147169 Ga0105238_101471693 109
11 3300010375 Ga0105239_13631761 Ga0105239_136317611 109
12 3300025904 Ga0207647_10014492 Ga0207647_100144926 109
13 3300025909 Ga0207705_10000004 Ga0207705_10000004594 109
14 3300025913 Ga0207695_10019191 Ga0207695_100191914 109
15 3300025924 Ga0207694_10097026 Ga0207694_100970262 109
16 3300025949 Ga0207667_10314843 Ga0207667_103148434 109
17 3300025981 Ga0207640_10002108 Ga0207640_100021084 109
18 3300026078 Ga0207702_10004299 Ga0207702_1000429915 109
19 3300026116 Ga0207674_10455470 Ga0207674_104554701 109
20 3300026142 Ga0207698_10000192 Ga0207698_1000019232 109
21 3300026142 Ga0207698_10034356 Ga0207698_100343563 109
22 3300039437 Ga0436365_0013393 Ga0436365_0013393_32800_33132 109
23 3300039453 Ga0436362_0807288 Ga0436362_0807288_5924_6256 109
24 3300006880 Ga0075429_100942540 Ga0075429_1009425402 121
25 3300009094 Ga0111539_10000006 Ga0111539_10000006261 121
26 3300027907 Ga0207428_10000007 Ga0207428_10000007260 121
27 3300050508 nmdc:mga09592_876092_c1 nmdc:mga09592_876092_c1_130_495 121
28 3300050511 nmdc:mga08y16_11_c1 nmdc:mga08y16_11_c1_146058_146423 121
29 3300005338 Ga0068868_100052120 Ga0068868_1000521202 124
30 3300026023 Ga0207677_10000310 Ga0207677_1000031032 124
31 3300005577 Ga0068857_100360365 Ga0068857_1003603652 125
32 3300026116 Ga0207674_10021207 Ga0207674_100212074 125
33 3300005337 Ga0070682_100000006 Ga0070682_100000006146 128
34 3300005355 Ga0070671_100275218 Ga0070671_1002752182 128
35 3300006028 Ga0070717_10205706 Ga0070717_102057061 128
36 3300006237 Ga0097621_101029865 Ga0097621_1010298652 128
37 3300006358 Ga0068871_100642601 Ga0068871_1006426012 128
38 3300013296 Ga0157374_10000010 Ga0157374_1000001026 128
39 3300013297 Ga0157378_10025268 Ga0157378_100252682 128
40 3300013306 Ga0163162_13095992 Ga0163162_130959921 128
41 3300014745 Ga0157377_10000015 Ga0157377_1000001533 128
42 3300014969 Ga0157376_10000019 Ga0157376_10000019175 128
43 3300039437 Ga0436365_1778154 Ga0436365_1778154_1348_1737 128
44 3300005340 Ga0070689_101153310 Ga0070689_1011533101 129
45 3300014325 Ga0163163_12382782 Ga0163163_123827822 129
46 3300025934 Ga0207686_10474003 Ga0207686_104740031 129
47 3300025936 Ga0207670_10965935 Ga0207670_109659352 129
48 3300049589 Ga0501073_0053990 Ga0501073_0053990_23_415 129
49 3300049742 Ga0501080_0076922 Ga0501080_0076922_1826_2218 129
50 3300005327 Ga0070658_10309001 Ga0070658_103090013 130
51 3300005329 Ga0070683_100000067 Ga0070683_10000006751 130
52 3300005331 Ga0070670_100001696 Ga0070670_10000169617 130
53 3300005331 Ga0070670_100176432 Ga0070670_1001764323 130
54 3300005334 Ga0068869_100005369 Ga0068869_1000053695 130
55 3300005337 Ga0070682_101523184 Ga0070682_1015231841 130
56 3300005345 Ga0070692_10042171 Ga0070692_100421712 130
57 3300005354 Ga0070675_100000016 Ga0070675_1000000168 130
58 3300005468 Ga0070707_101126798 Ga0070707_1011267982 130
59 3300005530 Ga0070679_101233487 Ga0070679_1012334871 130
60 3300005535 Ga0070684_100000186 Ga0070684_1000001868 130
61 3300005535 Ga0070684_100606826 Ga0070684_1006068262 130
62 3300005539 Ga0068853_100031318 Ga0068853_1000313182 130
63 3300005578 Ga0068854_100472780 Ga0068854_1004727803 130
64 3300006358 Ga0068871_101203515 Ga0068871_1012035152 130
65 3300006931 Ga0097620_101499808 Ga0097620_1014998082 130
66 3300009036 Ga0105244_10012422 Ga0105244_100124224 130
67 3300009098 Ga0105245_10000013 Ga0105245_1000001366 130
68 3300009148 Ga0105243_10255170 Ga0105243_102551702 130
69 3300009551 Ga0105238_10000001 Ga0105238_1000000133 130
70 3300013297 Ga0157378_10000129 Ga0157378_1000012960 130
71 3300013297 Ga0157378_10000846 Ga0157378_1000084618 130
72 3300013297 Ga0157378_11519717 Ga0157378_115197171 130
73 3300013307 Ga0157372_11816864 Ga0157372_118168641 130
74 3300013308 Ga0157375_10000004 Ga0157375_10000004198 130
75 3300013308 Ga0157375_10000939 Ga0157375_1000093913 130
76 3300013308 Ga0157375_10841578 Ga0157375_108415782 130
77 3300014325 Ga0163163_10468823 Ga0163163_104688232 130
78 3300021358 Ga0213873_10000349 Ga0213873_100003492 130
79 3300021384 Ga0213876_10000014 Ga0213876_1000001493 130
80 3300021384 Ga0213876_10007667 Ga0213876_100076676 130
81 3300025909 Ga0207705_10467232 Ga0207705_104672321 130
82 3300025921 Ga0207652_10810199 Ga0207652_108101992 130
83 3300025924 Ga0207694_10000001 Ga0207694_100000011079 130
84 3300025925 Ga0207650_10000284 Ga0207650_1000028420 130
85 3300025925 Ga0207650_10412736 Ga0207650_104127361 130
86 3300025926 Ga0207659_10000011 Ga0207659_100000118 130
87 3300025927 Ga0207687_10000014 Ga0207687_1000001467 130
88 3300025935 Ga0207709_11103277 Ga0207709_111032771 130
89 3300025936 Ga0207670_10301668 Ga0207670_103016682 130
90 3300025942 Ga0207689_10007788 Ga0207689_100077886 130
91 3300025944 Ga0207661_10000004 Ga0207661_10000004116 130
92 3300025981 Ga0207640_10233424 Ga0207640_102334242 130
93 3300026041 Ga0207639_10051132 Ga0207639_100511322 130
94 3300030521 Ga0307511_10040677 Ga0307511_100406774 130
95 3300035112 Ga0373932_0001103 Ga0373932_0001103_600_998 130
96 3300041496 Ga0451839_0391695 Ga0451839_0391695_281_676 130
97 3300047446 Ga0495679_006785 Ga0495679_006785_1998_2393 130
98 3300005328 Ga0070676_10228694 Ga0070676_102286942 131
99 3300005330 Ga0070690_100280742 Ga0070690_1002807422 131
100 3300005356 Ga0070674_100367959 Ga0070674_1003679592 131
101 3300005456 Ga0070678_100514258 Ga0070678_1005142582 131
102 3300005618 Ga0068864_100000037 Ga0068864_100000037118 131
103 3300013297 Ga0157378_10667070 Ga0157378_106670702 131
104 3300025907 Ga0207645_10278844 Ga0207645_102788442 131
105 3300025937 Ga0207669_10187062 Ga0207669_101870623 131
106 3300026095 Ga0207676_10000028 Ga0207676_1000002811 131
107 3300026121 Ga0207683_10393291 Ga0207683_103932912 131
108 3300005543 Ga0070672_100022071 Ga0070672_1000220713 132
109 3300005546 Ga0070696_100361835 Ga0070696_1003618352 132
110 3300005840 Ga0068870_10106899 Ga0068870_101068992 132
111 3300013308 Ga0157375_10000013 Ga0157375_1000001398 132
112 3300014326 Ga0157380_10032351 Ga0157380_100323512 132
113 3300025908 Ga0207643_10021846 Ga0207643_100218463 132
114 3300025940 Ga0207691_10051738 Ga0207691_100517382 132
115 3300037471 Ga0395905_1335073 Ga0395905_1335073_209_607 132
116 3300038443 Ga0395901_1265770 Ga0395901_1265770_91_489 132
117 3300050510 nmdc:mga06r32_15080_c1 nmdc:mga06r32_15080_c1_2193_2591 132
118 3300050513 nmdc:mga0rr50_561494_c1 nmdc:mga0rr50_561494_c1_327_725 132
119 3300054114 Ga0501084_0106571 Ga0501084_0106571_114_518 132
120 3300005334 Ga0068869_100145160 Ga0068869_1001451602 133
121 3300005340 Ga0070689_100008222 Ga0070689_1000082224 133
122 3300005364 Ga0070673_100444740 Ga0070673_1004447402 133
123 3300005842 Ga0068858_100000110 Ga0068858_1000001103 133
124 3300009098 Ga0105245_10001437 Ga0105245_1000143714 133
125 3300009147 Ga0114129_10891524 Ga0114129_108915242 133
126 3300014968 Ga0157379_10734325 Ga0157379_107343252 133
127 3300025927 Ga0207687_10003533 Ga0207687_100035336 133
128 3300025936 Ga0207670_10001650 Ga0207670_100016507 133
129 3300025960 Ga0207651_10454489 Ga0207651_104544892 133
130 3300026035 Ga0207703_10000008 Ga0207703_1000000890 133
131 3300005338 Ga0068868_100000607 Ga0068868_1000006076 134
132 3300005340 Ga0070689_101437022 Ga0070689_1014370221 134
133 3300005344 Ga0070661_100076724 Ga0070661_1000767242 134
134 3300005467 Ga0070706_100008951 Ga0070706_1000089518 134
135 3300005468 Ga0070707_100295019 Ga0070707_1002950191 134
136 3300005468 Ga0070707_100901816 Ga0070707_1009018162 134
137 3300005468 Ga0070707_100982468 Ga0070707_1009824682 134
138 3300005471 Ga0070698_100236840 Ga0070698_1002368402 134
139 3300009176 Ga0105242_10014420 Ga0105242_100144206 134
140 3300013297 Ga0157378_11930593 Ga0157378_119305931 134
141 3300014745 Ga0157377_10000084 Ga0157377_1000008428 134
142 3300021358 Ga0213873_10000003 Ga0213873_10000003469 134
143 3300021384 Ga0213876_10000003 Ga0213876_10000003399 134
144 3300021384 Ga0213876_10002886 Ga0213876_100028866 134
145 3300025910 Ga0207684_10215284 Ga0207684_102152842 134
146 3300025920 Ga0207649_10370656 Ga0207649_103706562 134
147 3300025922 Ga0207646_10145814 Ga0207646_101458142 134
148 3300025922 Ga0207646_10754140 Ga0207646_107541402 134
149 3300025926 Ga0207659_11171241 Ga0207659_111712411 134
150 3300025934 Ga0207686_10050372 Ga0207686_100503722 134
151 3300025936 Ga0207670_10335657 Ga0207670_103356572 134
152 3300025942 Ga0207689_10008562 Ga0207689_1000856211 134
153 3300026023 Ga0207677_10000015 Ga0207677_1000001591 134
154 3300026035 Ga0207703_10190114 Ga0207703_101901142 134
155 3300026089 Ga0207648_11518949 Ga0207648_115189491 134
156 3300026089 Ga0207648_11734124 Ga0207648_117341241 134
157 3300039437 Ga0436365_0501978 Ga0436365_0501978_9661_10071 134
158 3300039437 Ga0436365_0537254 Ga0436365_0537254_16093_16497 134
159 3300039453 Ga0436362_1234996 Ga0436362_1234996_136021_136425 134
160 3300044673 Ga0453683_0027551 Ga0453683_0027551_1299_1706 134
161 3300050507 nmdc:mga05p37_45231_c1 nmdc:mga05p37_45231_c1_4124_4531 134
162 3300005343 Ga0070687_100005388 Ga0070687_1000053882 135
163 3300005356 Ga0070674_100325219 Ga0070674_1003252192 135
164 3300005466 Ga0070685_10208354 Ga0070685_102083542 135
165 3300005617 Ga0068859_101215031 Ga0068859_1012150312 135
166 3300006844 Ga0075428_100015714 Ga0075428_1000157142 135
167 3300006931 Ga0097620_101214825 Ga0097620_1012148252 135
168 3300009093 Ga0105240_10111936 Ga0105240_101119364 135
169 3300013307 Ga0157372_10295988 Ga0157372_102959881 135
170 3300025908 Ga0207643_10010934 Ga0207643_100109342 135
171 3300025918 Ga0207662_10020134 Ga0207662_100201342 135
172 3300025937 Ga0207669_10338393 Ga0207669_103383932 135
173 3300025940 Ga0207691_11663647 Ga0207691_116636472 135
174 3300032002 Ga0307416_100951441 Ga0307416_1009514412 135
175 3300032005 Ga0307411_11969180 Ga0307411_119691801 135
176 3300046515 Ga0495620_0001995 Ga0495620_0001995_10184_10609 135
177 3300005295 Ga0065707_10101061 Ga0065707_101010612 136

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02021

UPF0102

Uncharacterised protein family UPF0102

31

121

0.91

PF08378

NERD

Nuclease-related domain

27

115

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fov-assembly1.cif.gz_A crystal structure of protein rpa0323 of unknown function from rhodopseudomonas palustris 0.8392 17 122
3fov-assembly1.cif.gz_A crystal structure of protein rpa0323 of unknown function from rhodopseudomonas palustris 0.801 17 122
2wcz-assembly1.cif.gz_B 1.6a resolution structure of archaeoglobus fulgidus hjc, a holliday junction resolvase from an archaeal hyperthermophile 0.7287 19 118
2wcz-assembly1.cif.gz_A 1.6a resolution structure of archaeoglobus fulgidus hjc, a holliday junction resolvase from an archaeal hyperthermophile 0.7254 18 118
2wcw-assembly1.cif.gz_B 1.6a resolution structure of archaeoglobus fulgidus hjc, a holliday junction resolvase from an archaeal hyperthermophile 0.6736 14 119
ID Description Score Start End Superfamily
af_P9WFM9_15_126_3.40.1350.10 Alpha Beta;3-Layer(aba) Sandwich;Trna Endonuclease; Chain: A, domain 1; 0.9179 16 118 3.40.1350.10
af_P45465_23_131_3.40.1350.10 Alpha Beta;3-Layer(aba) Sandwich;Trna Endonuclease; Chain: A, domain 1; 0.8858 18 122 3.40.1350.10
af_P45465_23_131_3.40.1350.10 Alpha Beta;3-Layer(aba) Sandwich;Trna Endonuclease; Chain: A, domain 1; 0.8478 18 122 3.40.1350.10
3fovA00 Alpha Beta;3-Layer(aba) Sandwich;Trna Endonuclease; Chain: A, domain 1; 0.8472 17 122 3.40.1350.10
af_P9WFM9_15_126_3.40.1350.10 Alpha Beta;3-Layer(aba) Sandwich;Trna Endonuclease; Chain: A, domain 1; 0.8405 16 118 3.40.1350.10
ID Description Score Start End GO Terms
AF-A0A7V0JRY5-F1-model_v4 UPF0102 protein ENF70_04530 0.945 10 122 GO:0003676
AF-A0A2G2QI92-F1-model_v4 UPF0102 protein COB23_02025 0.9443 8 122 GO:0003676
AF-A0A3M1NQ92-F1-model_v4 UPF0102 protein D6748_11285 0.9424 11 122 GO:0003676
AF-A0A151YZ94-F1-model_v4 UPF0102 protein AYX07_07925 0.9423 11 121 GO:0003676
AF-A0A2N2DK61-F1-model_v4 UPF0102 protein CVU89_03855 0.9412 8 121 GO:0003676

Feature Viewer

pLDDT pTM Quality
88.42 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map