F274162
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 179 | 127 | 358 | 238 |
Family's Representative Sequence
| Representative Sequence | 3300037471|Ga0395905_0315669|Ga0395905_0315669_193_957 |
| Length | 254 |
| Sequence | MLVLRSLLFTLYLYGSMVVMGTVFAPVLMLSRPTVMRFAKGWARSVLWALRVICGVRVEMRGLQHRPAGAALIAAKHQGMLDVIAPFIYLDDPCFVLKKELIGLPFFGWYASRMRMIPVDRGAQTKALKQMVADMRDRLQEQRQIVIFPEGTRVALDAKGDYKPGVAALYRDLGDTPCTPVATNSGLYWPAHGFIRKPGVAVFEFLEPIPAGVKRGPFMQELETRIETASKALVAEGRRLAAPAVSVDQASTNA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 2 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 3 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 4 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 5 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 17 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 18 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 19 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 20 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 21 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 22 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 23 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 24 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 25 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 26 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 27 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 28 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 29 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 30 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 31 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 32 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 33 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 34 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 35 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 36 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 37 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 38 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 39 | 3300015684 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 | Metagenome | Unclassified |
| 40 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 41 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 42 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 43 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 44 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 45 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 46 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 66 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 67 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 68 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 69 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 70 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 71 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 72 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 73 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 74 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 75 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 76 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 77 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 78 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 79 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 80 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 81 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 82 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 83 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 84 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 85 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 86 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 87 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 88 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 89 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 90 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 91 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 92 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 93 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 94 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 95 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 96 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 97 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 98 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 99 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 100 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 101 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 102 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 103 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 104 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 105 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 106 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 107 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 108 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 109 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 110 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 111 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 112 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 113 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 114 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 115 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 116 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 117 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 118 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 119 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 120 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 121 | 2643221574 | Brevundimonas sp. Root608 | Isolate | Unclassified |
| 122 | 2643221663 | Brevundimonas sp. Root1279 | Isolate | Unclassified |
| 123 | 2643221699 | Brevundimonas sp. Root1423 | Isolate | Unclassified |
| 124 | 2739367756 | Asticcacaulis sp. CF398 | Isolate | Unclassified |
| 125 | 2928972540 | Brevundimonas sp. 1080 | Isolate | Rhizosphere |
| 126 | 2941485952 | Brevundimonas faecalis 2814 | Isolate | Rhizosphere |
| 127 | 2977240413 | Brevundimonas vesicularis SORGH_AS 431 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.53 |
| Metatranscriptomes | 0 |
| Isolates | 4.47 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.15 |
| Nodule | 0.56 |
| Rhizoplane | 4.47 |
| Rhizosphere | 70.39 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.91 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0395905_0315669 | 3300037471 | Bacteria | 1452 |
| 2 | rootL2_10033621 | 3300003322 | Bacteria | 2662 |
| 3 | rootL2_10264607 | 3300003322 | Bacteria | 4405 |
| 4 | rootH1_10052101 | 3300003323 | Bacteria | 2129 |
| 5 | rootH1_10054677 | 3300003323 | Bacteria | 6907 |
| 6 | Ga0055536_1000455 | 3300003781 | Bacteria | 28769 |
| 7 | Ga0055531_10023206 | 3300003794 | Bacteria | 2335 |
| 8 | Ga0070670_100019351 | 3300005331 | Bacteria | 5841 |
| 9 | Ga0070670_100129484 | 3300005331 | Bacteria | 2178 |
| 10 | Ga0070666_10164312 | 3300005335 | Bacteria | 1552 |
| 11 | Ga0070682_100027486 | 3300005337 | Bacteria | 3414 |
| 12 | Ga0070660_100052743 | 3300005339 | Bacteria | 3136 |
| 13 | Ga0070668_100014850 | 3300005347 | Bacteria | 5821 |
| 14 | Ga0070668_100049084 | 3300005347 | Bacteria | 3247 |
| 15 | Ga0070669_100289917 | 3300005353 | Bacteria | 1314 |
| 16 | Ga0070659_100000143 | 3300005366 | Bacteria | 55183 |
| 17 | Ga0070659_100061113 | 3300005366 | Bacteria | 2977 |
| 18 | Ga0070667_100034378 | 3300005367 | Bacteria | 4240 |
| 19 | Ga0070667_100382891 | 3300005367 | Bacteria | 1278 |
| 20 | Ga0070678_100113423 | 3300005456 | Bacteria | 2125 |
| 21 | Ga0070662_100056072 | 3300005457 | Bacteria | 2860 |
| 22 | Ga0068853_100040708 | 3300005539 | Bacteria | 3966 |
| 23 | Ga0068853_100079438 | 3300005539 | Bacteria | 2869 |
| 24 | Ga0068854_100066153 | 3300005578 | Bacteria | 2630 |
| 25 | Ga0068856_100152029 | 3300005614 | Bacteria | 2324 |
| 26 | Ga0068859_100006364 | 3300005617 | Bacteria | 11977 |
| 27 | Ga0068864_100009389 | 3300005618 | Bacteria | 8069 |
| 28 | Ga0068864_100305013 | 3300005618 | Bacteria | 1492 |
| 29 | Ga0068864_100454984 | 3300005618 | Bacteria | 1225 |
| 30 | Ga0068861_100168543 | 3300005719 | Bacteria | 1813 |
| 31 | Ga0068863_100018754 | 3300005841 | Bacteria | 6620 |
| 32 | Ga0068863_100224704 | 3300005841 | Bacteria | 1810 |
| 33 | Ga0068863_100289825 | 3300005841 | Bacteria | 1587 |
| 34 | Ga0068863_100498223 | 3300005841 | Bacteria | 1199 |
| 35 | Ga0068860_100005340 | 3300005843 | Bacteria | 13040 |
| 36 | Ga0068862_100003825 | 3300005844 | Bacteria | 12817 |
| 37 | Ga0068862_100231506 | 3300005844 | Bacteria | 1676 |
| 38 | Ga0075369_10122951 | 3300006186 | Bacteria | 1176 |
| 39 | Ga0068871_100312815 | 3300006358 | Bacteria | 1381 |
| 40 | Ga0097620_100006364 | 3300006931 | Bacteria | 11977 |
| 41 | Ga0079104_1018562 | 3300006946 | Bacteria | 1968 |
| 42 | Ga0105240_10006793 | 3300009093 | Bacteria | 16737 |
| 43 | Ga0105240_10134118 | 3300009093 | Bacteria | 2966 |
| 44 | Ga0105248_10036116 | 3300009177 | Bacteria | 5527 |
| 45 | Ga0105248_10076068 | 3300009177 | Bacteria | 3773 |
| 46 | Ga0105238_10117104 | 3300009551 | Bacteria | 2644 |
| 47 | Ga0105239_10518023 | 3300010375 | Bacteria | 1357 |
| 48 | Ga0157373_10000482 | 3300013100 | Bacteria | 31638 |
| 49 | Ga0157373_10000483 | 3300013100 | Bacteria | 31535 |
| 50 | Ga0157370_10049766 | 3300013104 | Bacteria | 4009 |
| 51 | Ga0157370_10149758 | 3300013104 | Bacteria | 2172 |
| 52 | Ga0157369_10119979 | 3300013105 | Bacteria | 2790 |
| 53 | Ga0157374_10263056 | 3300013296 | Bacteria | 1699 |
| 54 | Ga0157375_10113356 | 3300013308 | Bacteria | 2812 |
| 55 | Ga0157379_10469978 | 3300014968 | Bacteria | 1163 |
| 56 | Ga0183365_10001 | 3300015684 | Bacteria | 2090444 |
| 57 | Ga0163161_10388689 | 3300017792 | Bacteria | 1116 |
| 58 | Ga0213872_10029881 | 3300021361 | Bacteria | 2499 |
| 59 | Ga0213876_10000074 | 3300021384 | Bacteria | 120394 |
| 60 | Ga0213876_10025596 | 3300021384 | Bacteria | 3112 |
| 61 | Ga0213875_10116357 | 3300021388 | Bacteria | 1249 |
| 62 | Ga0213875_10134076 | 3300021388 | Unclassified | 1158 |
| 63 | Ga0209676_1001151 | 3300025292 | Bacteria | 28912 |
| 64 | Ga0209257_1000090 | 3300025304 | Bacteria | 274746 |
| 65 | Ga0207680_10149099 | 3300025903 | Bacteria | 1558 |
| 66 | Ga0207705_10249805 | 3300025909 | Unclassified | 1353 |
| 67 | Ga0207695_10008830 | 3300025913 | Bacteria | 12549 |
| 68 | Ga0207695_10175874 | 3300025913 | Bacteria | 2063 |
| 69 | Ga0207657_10062083 | 3300025919 | Bacteria | 3201 |
| 70 | Ga0207650_10011859 | 3300025925 | Bacteria | 6005 |
| 71 | Ga0207650_10159211 | 3300025925 | Bacteria | 1788 |
| 72 | Ga0207644_10022329 | 3300025931 | Bacteria | 4323 |
| 73 | Ga0207644_10045897 | 3300025931 | Bacteria | 3110 |
| 74 | Ga0207644_10101700 | 3300025931 | Bacteria | 2160 |
| 75 | Ga0207690_10000617 | 3300025932 | Bacteria | 23012 |
| 76 | Ga0207690_10030803 | 3300025932 | Bacteria | 3426 |
| 77 | Ga0207711_10197046 | 3300025941 | Bacteria | 1837 |
| 78 | Ga0207711_10240730 | 3300025941 | Bacteria | 1659 |
| 79 | Ga0207679_10001519 | 3300025945 | Bacteria | 14513 |
| 80 | Ga0207668_10003285 | 3300025972 | Bacteria | 9478 |
| 81 | Ga0207668_10149849 | 3300025972 | Bacteria | 1804 |
| 82 | Ga0207658_10159580 | 3300025986 | Bacteria | 1847 |
| 83 | Ga0207658_10233953 | 3300025986 | Bacteria | 1552 |
| 84 | Ga0207639_10130038 | 3300026041 | Bacteria | 2083 |
| 85 | Ga0207702_10222286 | 3300026078 | Bacteria | 1760 |
| 86 | Ga0207641_10013816 | 3300026088 | Bacteria | 6622 |
| 87 | Ga0207641_10483916 | 3300026088 | Bacteria | 1200 |
| 88 | Ga0207683_10033426 | 3300026121 | Bacteria | 4467 |
| 89 | Ga0209974_10107435 | 3300027876 | Bacteria | 980 |
| 90 | Ga0268266_10068669 | 3300028379 | Bacteria | 3069 |
| 91 | Ga0268266_10098576 | 3300028379 | Bacteria | 2572 |
| 92 | Ga0268265_10142169 | 3300028380 | Bacteria | 2010 |
| 93 | Ga0268265_10191162 | 3300028380 | Bacteria | 1768 |
| 94 | Ga0268264_10076186 | 3300028381 | Bacteria | 2853 |
| 95 | Ga0307517_10001670 | 3300028786 | Bacteria | 36710 |
| 96 | Ga0307517_10126465 | 3300028786 | Bacteria | 1862 |
| 97 | Ga0307515_10116313 | 3300028794 | Bacteria | 3071 |
| 98 | Ga0307515_10296815 | 3300028794 | Bacteria | 1305 |
| 99 | Ga0265338_10009437 | 3300028800 | Bacteria | 11631 |
| 100 | Ga0265338_10211279 | 3300028800 | Bacteria | 1456 |
| 101 | Ga0307513_10004456 | 3300031456 | Bacteria | 18698 |
| 102 | Ga0307513_10036930 | 3300031456 | Bacteria | 5442 |
| 103 | Ga0307516_10000002 | 3300031730 | Bacteria | 467851 |
| 104 | Ga0307413_10673016 | 3300031824 | Bacteria | 856 |
| 105 | Ga0307406_10004212 | 3300031901 | Bacteria | 7829 |
| 106 | Ga0307412_10245475 | 3300031911 | Bacteria | 1387 |
| 107 | Ga0307414_10021925 | 3300032004 | Bacteria | 4020 |
| 108 | Ga0307414_10041908 | 3300032004 | Bacteria | 3105 |
| 109 | Ga0307414_10097089 | 3300032004 | Bacteria | 2206 |
| 110 | Ga0307414_10159571 | 3300032004 | Bacteria | 1789 |
| 111 | Ga0307510_10033533 | 3300033180 | Bacteria | 5765 |
| 112 | Ga0373960_0015031 | 3300035121 | Unclassified | 1970 |
| 113 | Ga0373931_0413220 | 3300035691 | Unclassified | 856 |
| 114 | Ga0395899_0000018 | 3300037312 | Bacteria | 423194 |
| 115 | Ga0395905_0041841 | 3300037471 | Bacteria | 4300 |
| 116 | Ga0436364_0657225 | 3300037853 | Unclassified | 1960 |
| 117 | Ga0436364_1368267 | 3300037853 | Bacteria | 2045 |
| 118 | Ga0395901_0159253 | 3300038443 | Bacteria | 2371 |
| 119 | Ga0436365_1397425 | 3300039437 | Bacteria | 3366 |
| 120 | Ga0436365_1583918 | 3300039437 | Bacteria | 9004 |
| 121 | Ga0436361_0721539 | 3300039447 | Bacteria | 2629 |
| 122 | Ga0436361_1113559 | 3300039447 | Bacteria | 6973 |
| 123 | Ga0436361_1198148 | 3300039447 | Bacteria | 1390 |
| 124 | Ga0439431_0008013 | 3300041997 | Bacteria | 2367 |
| 125 | Ga0466969_0000722 | 3300044656 | Bacteria | 17863 |
| 126 | Ga0466966_0197137 | 3300044684 | Bacteria | 1219 |
| 127 | Ga0466961_0001425 | 3300044693 | Bacteria | 14831 |
| 128 | Ga0466971_0001369 | 3300044719 | Bacteria | 10222 |
| 129 | Ga0466970_0006553 | 3300044765 | Bacteria | 5818 |
| 130 | Ga0466959_0000040 | 3300045049 | Bacteria | 101109 |
| 131 | Ga0466959_0022370 | 3300045049 | Bacteria | 4674 |
| 132 | Ga0466959_0041027 | 3300045049 | Bacteria | 3418 |
| 133 | Ga0466958_0000417 | 3300045836 | Bacteria | 17527 |
| 134 | Ga0495616_0096124 | 3300046513 | Bacteria | 1395 |
| 135 | Ga0495625_0091287 | 3300046660 | Bacteria | 2105 |
| 136 | Ga0495669_0085681 | 3300046684 | Bacteria | 1450 |
| 137 | Ga0495636_0053897 | 3300047318 | Bacteria | 1689 |
| 138 | Ga0495674_0372885 | 3300047319 | Bacteria | 1156 |
| 139 | Ga0495677_0061368 | 3300047445 | Bacteria | 1394 |
| 140 | Ga0496101_0092465 | 3300048904 | Bacteria | 2252 |
| 141 | Ga0496102_0103489 | 3300048905 | Bacteria | 2648 |
| 142 | Ga0496104_0143077 | 3300048907 | Bacteria | 2297 |
| 143 | Ga0496109_0008454 | 3300048912 | Bacteria | 8751 |
| 144 | Ga0496111_0114316 | 3300048914 | Bacteria | 1990 |
| 145 | Ga0496112_0189159 | 3300048915 | Bacteria | 2021 |
| 146 | Ga0496115_0001272 | 3300048918 | Bacteria | 18065 |
| 147 | Ga0496115_0246879 | 3300048918 | Bacteria | 1470 |
| 148 | Ga0496118_0191873 | 3300048921 | Bacteria | 1221 |
| 149 | Ga0496121_0483460 | 3300048924 | Unclassified | 790 |
| 150 | Ga0496122_0012019 | 3300048925 | Bacteria | 8680 |
| 151 | Ga0496123_0001829 | 3300048926 | Bacteria | 27946 |
| 152 | Ga0496123_0166671 | 3300048926 | Unclassified | 1167 |
| 153 | Ga0496125_0000294 | 3300048928 | Bacteria | 98233 |
| 154 | Ga0501033_0021369 | 3300049570 | Bacteria | 4882 |
| 155 | Ga0501034_0028575 | 3300049571 | Bacteria | 5676 |
| 156 | Ga0501034_0086724 | 3300049571 | Bacteria | 3131 |
| 157 | Ga0501034_0086990 | 3300049571 | Bacteria | 3125 |
| 158 | Ga0501034_0171605 | 3300049571 | Bacteria | 2136 |
| 159 | Ga0501037_0131645 | 3300049573 | Bacteria | 1793 |
| 160 | Ga0501038_0114814 | 3300049574 | Bacteria | 2227 |
| 161 | Ga0501047_0009054 | 3300049581 | Bacteria | 9400 |
| 162 | Ga0501035_0010890 | 3300049822 | Bacteria | 8420 |
| 163 | Ga0501044_0015644 | 3300049823 | Bacteria | 8171 |
| 164 | Ga0500643_001592 | 3300053087 | Bacteria | 12831 |
| 165 | Ga0500644_0001276 | 3300053088 | Bacteria | 6864 |
| 166 | Ga0500641_0001402 | 3300053096 | Bacteria | 8591 |
| 167 | Ga0500595_052342 | 3300053119 | Bacteria | 1261 |
| 168 | Ga0500608_003427 | 3300053122 | Bacteria | 5944 |
| 169 | Ga0500608_163912 | 3300053122 | Bacteria | 960 |
| 170 | Ga0466962_0000450 | 3300061719 | Bacteria | 17837 |
| 171 | Ga0466962_0129694 | 3300061719 | Bacteria | 1218 |
| 172 | 2643883406 | 2643221574 | Bacteria | 2789653 |
| 173 | 2644351697 | 2643221663 | Bacteria | 3425771 |
| 174 | 2644548522 | 2643221699 | Bacteria | 5731501 |
| 175 | 2644548771 | 2643221699 | Bacteria | 5731501 |
| 176 | 2739793543 | 2739367756 | Bacteria | 4553612 |
| 177 | 2928974226 | 2928972540 | Bacteria | 3058286 |
| 178 | 2941487724 | 2941485952 | Bacteria | 3591484 |
| 179 | 2977240811 | 2977240413 | Bacteria | 3191065 |
| 180 | Ga0395905_0315669 | |||
| 181 | rootL2_10033621 | |||
| 182 | rootL2_10264607 | |||
| 183 | rootH1_10052101 | |||
| 184 | rootH1_10054677 | |||
| 185 | Ga0055536_1000455 | |||
| 186 | Ga0055531_10023206 | |||
| 187 | Ga0070670_100019351 | |||
| 188 | Ga0070670_100129484 | |||
| 189 | Ga0070666_10164312 | |||
| 190 | Ga0070682_100027486 | |||
| 191 | Ga0070660_100052743 | |||
| 192 | Ga0070668_100014850 | |||
| 193 | Ga0070668_100049084 | |||
| 194 | Ga0070669_100289917 | |||
| 195 | Ga0070659_100000143 | |||
| 196 | Ga0070659_100061113 | |||
| 197 | Ga0070667_100034378 | |||
| 198 | Ga0070667_100382891 | |||
| 199 | Ga0070678_100113423 | |||
| 200 | Ga0070662_100056072 | |||
| 201 | Ga0068853_100040708 | |||
| 202 | Ga0068853_100079438 | |||
| 203 | Ga0068854_100066153 | |||
| 204 | Ga0068856_100152029 | |||
| 205 | Ga0068859_100006364 | |||
| 206 | Ga0068864_100009389 | |||
| 207 | Ga0068864_100305013 | |||
| 208 | Ga0068864_100454984 | |||
| 209 | Ga0068861_100168543 | |||
| 210 | Ga0068863_100018754 | |||
| 211 | Ga0068863_100224704 | |||
| 212 | Ga0068863_100289825 | |||
| 213 | Ga0068863_100498223 | |||
| 214 | Ga0068860_100005340 | |||
| 215 | Ga0068862_100003825 | |||
| 216 | Ga0068862_100231506 | |||
| 217 | Ga0075369_10122951 | |||
| 218 | Ga0068871_100312815 | |||
| 219 | Ga0097620_100006364 | |||
| 220 | Ga0079104_1018562 | |||
| 221 | Ga0105240_10006793 | |||
| 222 | Ga0105240_10134118 | |||
| 223 | Ga0105248_10036116 | |||
| 224 | Ga0105248_10076068 | |||
| 225 | Ga0105238_10117104 | |||
| 226 | Ga0105239_10518023 | |||
| 227 | Ga0157373_10000482 | |||
| 228 | Ga0157373_10000483 | |||
| 229 | Ga0157370_10049766 | |||
| 230 | Ga0157370_10149758 | |||
| 231 | Ga0157369_10119979 | |||
| 232 | Ga0157374_10263056 | |||
| 233 | Ga0157375_10113356 | |||
| 234 | Ga0157379_10469978 | |||
| 235 | Ga0183365_10001 | |||
| 236 | Ga0163161_10388689 | |||
| 237 | Ga0213872_10029881 | |||
| 238 | Ga0213876_10000074 | |||
| 239 | Ga0213876_10025596 | |||
| 240 | Ga0213875_10116357 | |||
| 241 | Ga0213875_10134076 | |||
| 242 | Ga0209676_1001151 | |||
| 243 | Ga0209257_1000090 | |||
| 244 | Ga0207680_10149099 | |||
| 245 | Ga0207705_10249805 | |||
| 246 | Ga0207695_10008830 | |||
| 247 | Ga0207695_10175874 | |||
| 248 | Ga0207657_10062083 | |||
| 249 | Ga0207650_10011859 | |||
| 250 | Ga0207650_10159211 | |||
| 251 | Ga0207644_10022329 | |||
| 252 | Ga0207644_10045897 | |||
| 253 | Ga0207644_10101700 | |||
| 254 | Ga0207690_10000617 | |||
| 255 | Ga0207690_10030803 | |||
| 256 | Ga0207711_10197046 | |||
| 257 | Ga0207711_10240730 | |||
| 258 | Ga0207679_10001519 | |||
| 259 | Ga0207668_10003285 | |||
| 260 | Ga0207668_10149849 | |||
| 261 | Ga0207658_10159580 | |||
| 262 | Ga0207658_10233953 | |||
| 263 | Ga0207639_10130038 | |||
| 264 | Ga0207702_10222286 | |||
| 265 | Ga0207641_10013816 | |||
| 266 | Ga0207641_10483916 | |||
| 267 | Ga0207683_10033426 | |||
| 268 | Ga0209974_10107435 | |||
| 269 | Ga0268266_10068669 | |||
| 270 | Ga0268266_10098576 | |||
| 271 | Ga0268265_10142169 | |||
| 272 | Ga0268265_10191162 | |||
| 273 | Ga0268264_10076186 | |||
| 274 | Ga0307517_10001670 | |||
| 275 | Ga0307517_10126465 | |||
| 276 | Ga0307515_10116313 | |||
| 277 | Ga0307515_10296815 | |||
| 278 | Ga0265338_10009437 | |||
| 279 | Ga0265338_10211279 | |||
| 280 | Ga0307513_10004456 | |||
| 281 | Ga0307513_10036930 | |||
| 282 | Ga0307516_10000002 | |||
| 283 | Ga0307413_10673016 | |||
| 284 | Ga0307406_10004212 | |||
| 285 | Ga0307412_10245475 | |||
| 286 | Ga0307414_10021925 | |||
| 287 | Ga0307414_10041908 | |||
| 288 | Ga0307414_10097089 | |||
| 289 | Ga0307414_10159571 | |||
| 290 | Ga0307510_10033533 | |||
| 291 | Ga0373960_0015031 | |||
| 292 | Ga0373931_0413220 | |||
| 293 | Ga0395899_0000018 | |||
| 294 | Ga0395905_0041841 | |||
| 295 | Ga0436364_0657225 | |||
| 296 | Ga0436364_1368267 | |||
| 297 | Ga0395901_0159253 | |||
| 298 | Ga0436365_1397425 | |||
| 299 | Ga0436365_1583918 | |||
| 300 | Ga0436361_0721539 | |||
| 301 | Ga0436361_1113559 | |||
| 302 | Ga0436361_1198148 | |||
| 303 | Ga0439431_0008013 | |||
| 304 | Ga0466969_0000722 | |||
| 305 | Ga0466966_0197137 | |||
| 306 | Ga0466961_0001425 | |||
| 307 | Ga0466971_0001369 | |||
| 308 | Ga0466970_0006553 | |||
| 309 | Ga0466959_0000040 | |||
| 310 | Ga0466959_0022370 | |||
| 311 | Ga0466959_0041027 | |||
| 312 | Ga0466958_0000417 | |||
| 313 | Ga0495616_0096124 | |||
| 314 | Ga0495625_0091287 | |||
| 315 | Ga0495669_0085681 | |||
| 316 | Ga0495636_0053897 | |||
| 317 | Ga0495674_0372885 | |||
| 318 | Ga0495677_0061368 | |||
| 319 | Ga0496101_0092465 | |||
| 320 | Ga0496102_0103489 | |||
| 321 | Ga0496104_0143077 | |||
| 322 | Ga0496109_0008454 | |||
| 323 | Ga0496111_0114316 | |||
| 324 | Ga0496112_0189159 | |||
| 325 | Ga0496115_0001272 | |||
| 326 | Ga0496115_0246879 | |||
| 327 | Ga0496118_0191873 | |||
| 328 | Ga0496121_0483460 | |||
| 329 | Ga0496122_0012019 | |||
| 330 | Ga0496123_0001829 | |||
| 331 | Ga0496123_0166671 | |||
| 332 | Ga0496125_0000294 | |||
| 333 | Ga0501033_0021369 | |||
| 334 | Ga0501034_0028575 | |||
| 335 | Ga0501034_0086724 | |||
| 336 | Ga0501034_0086990 | |||
| 337 | Ga0501034_0171605 | |||
| 338 | Ga0501037_0131645 | |||
| 339 | Ga0501038_0114814 | |||
| 340 | Ga0501047_0009054 | |||
| 341 | Ga0501035_0010890 | |||
| 342 | Ga0501044_0015644 | |||
| 343 | Ga0500643_001592 | |||
| 344 | Ga0500644_0001276 | |||
| 345 | Ga0500641_0001402 | |||
| 346 | Ga0500595_052342 | |||
| 347 | Ga0500608_003427 | |||
| 348 | Ga0500608_163912 | |||
| 349 | Ga0466962_0000450 | |||
| 350 | Ga0466962_0129694 | |||
| 351 | 2643883406 | |||
| 352 | 2644351697 | |||
| 353 | 2644548522 | |||
| 354 | 2644548771 | |||
| 355 | 2739793543 | |||
| 356 | 2928974226 | |||
| 357 | 2941487724 | |||
| 358 | 2977240811 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5kym-assembly1.cif.gz_A | crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima | 0.825 | 1 | 233 |
| 5kym-assembly1.cif.gz_A | crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima | 0.8124 | 1 | 233 |
| 5kym-assembly2.cif.gz_B | crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima | 0.7744 | 2 | 226 |
| 5kym-assembly2.cif.gz_B | crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima | 0.7509 | 2 | 226 |
| 1k30-assembly1.cif.gz_A | crystal structure analysis of squash (cucurbita moschata) glycerol-3-phosphate (1)-acyltransferase | 0.6332 | 38 | 233 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q8GXU8_180_307_3.40.50.2000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.9068 | 56 | 178 | 3.40.50.2000 |
| af_Q9VYJ4_80_210_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9066 | 58 | 178 | 3.40.50.620 |
| af_Q9US20_86_212_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.8808 | 70 | 176 | 3.40.50.620 |
| af_I6YDI9_312_439_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.8786 | 61 | 178 | 3.40.50.620 |
| af_Q93841_73_201_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.8746 | 56 | 178 | 3.40.50.620 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-V4Q576-F1-model_v4 | 1-acyl-sn-glycerol-3-phosphate acyltransferase | 0.9976 | 2 | 235 |
GO:0003841
GO:0006654 GO:0016020 |
| AF-A0A328B606-F1-model_v4 | 1-acyl-sn-glycerol-3-phosphate acyltransferase | 0.991 | 3 | 233 |
GO:0003841
GO:0006654 GO:0016020 |
| AF-A0A537VKD3-F1-model_v4 | 1-acyl-sn-glycerol-3-phosphate acyltransferase | 0.9902 | 1 | 235 |
GO:0003841
GO:0006654 GO:0016020 |
| AF-A0A519L7D5-F1-model_v4 | 1-acyl-sn-glycerol-3-phosphate acyltransferase | 0.9899 | 3 | 178 |
GO:0003841
GO:0006654 GO:0016020 |
| AF-A0A3C0TXI9-F1-model_v4 | 1-acyl-sn-glycerol-3-phosphate acyltransferase | 0.9897 | 1 | 235 |
GO:0003841
GO:0006654 GO:0016020 |