F274292

General Info

Members Datasets Scaffolds Average Seq Length
179 108 358 346

Family's Representative Sequence

Representative Sequence 3300045051|Ga0451576_0181616|Ga0451576_0181616_762_1895
Length 377
Sequence VAIVLGTETVSSQLFVQTPREEHAGFHQQEHYPMSKVAPIDQRKADHIKINLEQDVRSALTTGLENYHFIHEALPQLDLNRVDTSLSLFGRPLNAPILISSMTGGTAEAESINLRLAEVAYVMRVAMGVGSQRAAIEDPEQVRTFQVRRVAPDILLFANLGAVQLNYGYGVDQCRKAVEMIQADALILHLNPLQEAVQDGGDTNFAGLAGKIEQVCKALEIPVIAKEVGWGISERTAKLLEDCGVSAIDVAGAGGTSWSQVEMHRAPDEFTRQLAASFVGWGIPTANSILNVKKAAPDMTIFASGGIKDGLDIAKCIALGATLGGMAGQFLKAATVSTENAIEMVNLTRRQIEVTMFAAGVGTLDGLKIGKLARQER

Samples

Sample ID Description Type Environment
1 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
6 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
12 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
13 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
20 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
21 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
22 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
23 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
24 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
25 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
26 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
27 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
28 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
29 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
30 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
35 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
36 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
37 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
38 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
39 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
40 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
48 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
49 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
50 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
51 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
52 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
53 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
54 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
55 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
56 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
57 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
58 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
59 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
60 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
61 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
62 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
63 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
64 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
65 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
66 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
67 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
68 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
69 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
70 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
71 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
72 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
73 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
74 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
75 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
76 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
77 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
78 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
79 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
80 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
81 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
82 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
83 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
84 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
85 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
86 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
87 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
88 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
89 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
90 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
91 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
92 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
93 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
94 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
95 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
96 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
97 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
98 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
99 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
100 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
101 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
102 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
103 2524023129 Paenibacillus pinihumi DSM 23905 Isolate Rhizosphere
104 2563366752 Paenibacillus pini JCM 16418 Isolate Rhizosphere
105 2888578766 Paenibacillus lycopersici 12200R-189 Isolate Rhizosphere
106 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
107 2907202186 Paenibacillus sp. HJL G12 Isolate Unclassified
108 8057977335 Paenibacillus oenotherae DT7-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.65
Metatranscriptomes 0
Isolates 3.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.35
Nodule 0
Rhizoplane 0.56
Rhizosphere 93.3
Stem 0
Stem Tuber 0
Unclassified 11.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451576_0181616 3300045051 Bacteria 2197
2 JGI25406J46586_10001551 3300003203 Bacteria 10858
3 rootH2_10212781 3300003320 Unclassified 1283
4 rootH1_10132535 3300003323 Bacteria 2850
5 Ga0055541_1000668 3300003841 Bacteria 8907
6 JGI25405J52794_10002290 3300003911 Bacteria 3282
7 Ga0065704_10000232 3300005289 Bacteria 69534
8 Ga0065707_10083475 3300005295 Bacteria 9048
9 Ga0065707_10092102 3300005295 Bacteria 3826
10 Ga0070689_100137996 3300005340 Bacteria 1959
11 Ga0070689_100182773 3300005340 Unclassified 1704
12 Ga0070673_100249878 3300005364 Bacteria 1545
13 Ga0070705_100040189 3300005440 Unclassified 2658
14 Ga0070694_100063602 3300005444 Unclassified 2524
15 Ga0070685_10010386 3300005466 Bacteria 4837
16 Ga0070707_100025549 3300005468 Bacteria 5604
17 Ga0070707_100261452 3300005468 Bacteria 1684
18 Ga0070698_100009600 3300005471 Bacteria 10352
19 Ga0070698_100245638 3300005471 Bacteria 1723
20 Ga0070699_100204135 3300005518 Bacteria 1758
21 Ga0070684_100191507 3300005535 Bacteria 1861
22 Ga0070697_100036247 3300005536 Unclassified 3983
23 Ga0070704_100032170 3300005549 Unclassified 3535
24 Ga0068863_100325300 3300005841 Bacteria 1494
25 Ga0068862_100038039 3300005844 Bacteria 4080
26 Ga0081455_10000799 3300005937 Bacteria 40529
27 Ga0081538_10046589 3300005981 Bacteria 2672
28 Ga0081538_10068208 3300005981 Bacteria 1979
29 Ga0081539_10003114 3300005985 Bacteria 21205
30 Ga0075428_100009833 3300006844 Bacteria 10630
31 Ga0075428_100076955 3300006844 Bacteria 3643
32 Ga0075428_100375192 3300006844 Bacteria 1525
33 Ga0075430_100058745 3300006846 Bacteria 3233
34 Ga0075430_100112336 3300006846 Bacteria 2271
35 Ga0075430_100118085 3300006846 Bacteria 2211
36 Ga0075431_100028284 3300006847 Bacteria 5757
37 Ga0075431_100049351 3300006847 Unclassified 4339
38 Ga0075431_100056837 3300006847 Bacteria 4035
39 Ga0075429_100002135 3300006880 Bacteria 16502
40 Ga0075429_100115470 3300006880 Unclassified 2346
41 Ga0075436_100029065 3300006914 Unclassified 3802
42 Ga0075435_100017363 3300007076 Bacteria 5446
43 Ga0105240_10118601 3300009093 Bacteria 3189
44 Ga0111539_10079673 3300009094 Bacteria 3853
45 Ga0114129_10020931 3300009147 Bacteria 9290
46 Ga0114129_10040467 3300009147 Bacteria 6570
47 Ga0114129_10167071 3300009147 Bacteria 3002
48 Ga0114129_10297379 3300009147 Unclassified 2153
49 Ga0114129_10406284 3300009147 Bacteria 1794
50 Ga0114129_10485543 3300009147 Bacteria 1616
51 Ga0114129_10579614 3300009147 Unclassified 1456
52 Ga0105243_10130497 3300009148 Bacteria 2131
53 Ga0105249_10101314 3300009553 Bacteria 2708
54 Ga0105246_10050646 3300011119 Bacteria 2849
55 Ga0209566_100112 3300025225 Bacteria 111585
56 Ga0209258_108939 3300025242 Bacteria 1374
57 Ga0209025_1016460 3300025294 Bacteria 4360
58 Ga0207684_10086088 3300025910 Bacteria 2676
59 Ga0207684_10101562 3300025910 Bacteria 2459
60 Ga0207662_10220049 3300025918 Bacteria 1236
61 Ga0207646_10072443 3300025922 Unclassified 3077
62 Ga0207646_10131598 3300025922 Bacteria 2252
63 Ga0207686_10121048 3300025934 Bacteria 1782
64 Ga0207709_10073969 3300025935 Bacteria 2173
65 Ga0207670_10198547 3300025936 Bacteria 1522
66 Ga0268265_10068443 3300028380 Bacteria 2753
67 Ga0265326_10029248 3300028558 Bacteria 1570
68 Ga0265318_10003430 3300028577 Bacteria 7963
69 Ga0265338_10061694 3300028800 Bacteria 3284
70 Ga0265320_10038800 3300031240 Bacteria 2386
71 Ga0265331_10025733 3300031250 Bacteria 2967
72 Ga0265327_10006246 3300031251 Bacteria 9599
73 Ga0316576_10028773 3300031727 Bacteria 3921
74 Ga0316578_10035540 3300031728 Bacteria 2865
75 Ga0316578_10236721 3300031728 Bacteria 1096
76 Ga0316577_10003951 3300031733 Bacteria 7579
77 Ga0316577_10010324 3300031733 Bacteria 5040
78 Ga0316577_10022063 3300031733 Bacteria 3534
79 Ga0316577_10074177 3300031733 Unclassified 1900
80 Ga0307410_10001917 3300031852 Bacteria 9743
81 Ga0307416_100001754 3300032002 Bacteria 12013
82 Ga0307414_10010244 3300032004 Bacteria 5429
83 Ga0307411_10195250 3300032005 Bacteria 1549
84 Ga0316585_10040035 3300032137 Bacteria 1492
85 Ga0373933_0102643 3300035724 Unclassified 1776
86 Ga0316582_0001810 3300036647 Bacteria 9656
87 Ga0316582_0004169 3300036647 Bacteria 7246
88 Ga0316584_0010174 3300036712 Bacteria 6567
89 Ga0316581_0014927 3300037588 Bacteria 2215
90 Ga0400489_68177 3300039093 Bacteria 11334
91 Ga0439449_0047788 3300042007 Bacteria 1584
92 Ga0439462_0046293 3300042015 Bacteria 1165
93 Ga0451577_0014726 3300042876 Bacteria 7286
94 Ga0451577_0024979 3300042876 Bacteria 5426
95 Ga0451577_0035319 3300042876 Bacteria 4503
96 Ga0451577_0115075 3300042876 Bacteria 2407
97 Ga0451577_0179033 3300042876 Unclassified 1911
98 Ga0453683_0000242 3300044673 Bacteria 72875
99 Ga0453683_0001438 3300044673 Bacteria 20642
100 Ga0453683_0015346 3300044673 Bacteria 4962
101 Ga0453683_0017136 3300044673 Bacteria 4668
102 Ga0453683_0039504 3300044673 Bacteria 2966
103 Ga0466965_0113101 3300044683 Bacteria 1396
104 Ga0453684_0000007 3300044712 Bacteria 1301482
105 Ga0453684_0000044 3300044712 Bacteria 585643
106 Ga0453684_0001300 3300044712 Bacteria 74241
107 Ga0453684_0001473 3300044712 Bacteria 66422
108 Ga0453684_0003389 3300044712 Bacteria 36049
109 Ga0453684_0009719 3300044712 Bacteria 16726
110 Ga0453684_0019674 3300044712 Bacteria 10253
111 Ga0453684_0020327 3300044712 Bacteria 10024
112 Ga0453684_0042905 3300044712 Bacteria 6088
113 Ga0453684_0056666 3300044712 Bacteria 5080
114 Ga0453684_0067192 3300044712 Bacteria 4561
115 Ga0453684_0082422 3300044712 Bacteria 4007
116 Ga0453684_0085100 3300044712 Unclassified 3930
117 Ga0453684_0093556 3300044712 Bacteria 3702
118 Ga0453684_0118115 3300044712 Bacteria 3208
119 Ga0453684_0141889 3300044712 Bacteria 2867
120 Ga0453684_0185167 3300044712 Bacteria 2441
121 Ga0453684_0226105 3300044712 Bacteria 2164
122 Ga0453684_0773267 3300044712 Bacteria 1038
123 Ga0466960_0060544 3300044901 Bacteria 1856
124 Ga0466960_0097667 3300044901 Bacteria 1507
125 Ga0451576_0000368 3300045051 Bacteria 107454
126 Ga0451576_0010727 3300045051 Bacteria 10492
127 Ga0451576_0020708 3300045051 Bacteria 7158
128 Ga0451576_0103893 3300045051 Bacteria 2955
129 Ga0451576_0273964 3300045051 Archaea 1764
130 Ga0451576_0470111 3300045051 Bacteria 1320
131 Ga0451576_0522801 3300045051 Bacteria 1247
132 Ga0495629_0000032 3300046459 Bacteria 123692
133 Ga0495582_0003286 3300046473 Bacteria 9086
134 Ga0495639_0005000 3300046475 Bacteria 5689
135 Ga0495594_0005709 3300046499 Bacteria 6396
136 Ga0495634_0026315 3300046642 Bacteria 4061
137 Ga0495635_0005517 3300046663 Bacteria 8798
138 Ga0495658_0000032 3300046683 Bacteria 70764
139 Ga0495613_0004359 3300046689 Bacteria 10589
140 Ga0495581_0013148 3300047315 Bacteria 4799
141 Ga0495680_0001036 3300047322 Bacteria 30811
142 Ga0495614_0000815 3300048089 Bacteria 13171
143 Ga0496110_0168082 3300048913 Bacteria 1989
144 Ga0501071_0067958 3300049587 Bacteria 2593
145 Ga0501074_0072343 3300049590 Bacteria 2477
146 Ga0501075_0011499 3300049591 Bacteria 6265
147 Ga0501077_0013411 3300049593 Bacteria 5140
148 Ga0501079_0013081 3300049741 Bacteria 6330
149 Ga0501079_0105961 3300049741 Bacteria 2182
150 Ga0501081_0021667 3300049743 Bacteria 4290
151 nmdc:mga05p37_231671_c1 3300050507 Bacteria 2225
152 nmdc:mga05p37_27673_c1 3300050507 Bacteria 6906
153 nmdc:mga05p37_395144_c1 3300050507 Bacteria 1616
154 nmdc:mga05p37_9127_c1 3300050507 Bacteria 11722
155 nmdc:mga09592_175755_c1 3300050508 Bacteria 1852
156 nmdc:mga09592_7388_c1 3300050508 Bacteria 8932
157 nmdc:mga09592_75297_c1 3300050508 Bacteria 2869
158 nmdc:mga0qj67_20139_c1 3300050509 Bacteria 5106
159 nmdc:mga0qj67_25070_c1 3300050509 Bacteria 4603
160 nmdc:mga0qj67_91123_c1 3300050509 Bacteria 2450
161 nmdc:mga06r32_174219_c1 3300050510 Bacteria 2136
162 nmdc:mga06r32_41524_c1 3300050510 Unclassified 4371
163 nmdc:mga06r32_53131_c1 3300050510 Bacteria 3881
164 nmdc:mga0rr50_61781_c1 3300050513 Unclassified 2824
165 nmdc:mga0a205_348277_c1 3300050515 Bacteria 1349
166 Ga0495619_0005958 3300053085 Bacteria 7722
167 Ga0500616_0000306 3300053153 Bacteria 70571
168 Ga0500645_000041 3300053730 Bacteria 110646
169 Ga0501084_0070676 3300054114 Bacteria 2922
170 Ga0501082_0107397 3300060353 Bacteria 2415
171 Ga0501082_0149853 3300060353 Unclassified 2026
172 Ga0501082_0167450 3300060353 Bacteria 1910
173 Ga0530510_0067557 3300061734 Unclassified 2593
174 2524186898 2524023129 Bacteria 6762600
175 2563930114 2563366752 Bacteria 4961801
176 2888580704 2888578766 Bacteria 6743310
177 2889050639 2889049205 Bacteria 7524325
178 2907207206 2907202186 Bacteria 6632024
179 8057978475 8057977335 Bacteria 5694872
180 Ga0451576_0181616
181 JGI25406J46586_10001551
182 rootH2_10212781
183 rootH1_10132535
184 Ga0055541_1000668
185 JGI25405J52794_10002290
186 Ga0065704_10000232
187 Ga0065707_10083475
188 Ga0065707_10092102
189 Ga0070689_100137996
190 Ga0070689_100182773
191 Ga0070673_100249878
192 Ga0070705_100040189
193 Ga0070694_100063602
194 Ga0070685_10010386
195 Ga0070707_100025549
196 Ga0070707_100261452
197 Ga0070698_100009600
198 Ga0070698_100245638
199 Ga0070699_100204135
200 Ga0070684_100191507
201 Ga0070697_100036247
202 Ga0070704_100032170
203 Ga0068863_100325300
204 Ga0068862_100038039
205 Ga0081455_10000799
206 Ga0081538_10046589
207 Ga0081538_10068208
208 Ga0081539_10003114
209 Ga0075428_100009833
210 Ga0075428_100076955
211 Ga0075428_100375192
212 Ga0075430_100058745
213 Ga0075430_100112336
214 Ga0075430_100118085
215 Ga0075431_100028284
216 Ga0075431_100049351
217 Ga0075431_100056837
218 Ga0075429_100002135
219 Ga0075429_100115470
220 Ga0075436_100029065
221 Ga0075435_100017363
222 Ga0105240_10118601
223 Ga0111539_10079673
224 Ga0114129_10020931
225 Ga0114129_10040467
226 Ga0114129_10167071
227 Ga0114129_10297379
228 Ga0114129_10406284
229 Ga0114129_10485543
230 Ga0114129_10579614
231 Ga0105243_10130497
232 Ga0105249_10101314
233 Ga0105246_10050646
234 Ga0209566_100112
235 Ga0209258_108939
236 Ga0209025_1016460
237 Ga0207684_10086088
238 Ga0207684_10101562
239 Ga0207662_10220049
240 Ga0207646_10072443
241 Ga0207646_10131598
242 Ga0207686_10121048
243 Ga0207709_10073969
244 Ga0207670_10198547
245 Ga0268265_10068443
246 Ga0265326_10029248
247 Ga0265318_10003430
248 Ga0265338_10061694
249 Ga0265320_10038800
250 Ga0265331_10025733
251 Ga0265327_10006246
252 Ga0316576_10028773
253 Ga0316578_10035540
254 Ga0316578_10236721
255 Ga0316577_10003951
256 Ga0316577_10010324
257 Ga0316577_10022063
258 Ga0316577_10074177
259 Ga0307410_10001917
260 Ga0307416_100001754
261 Ga0307414_10010244
262 Ga0307411_10195250
263 Ga0316585_10040035
264 Ga0373933_0102643
265 Ga0316582_0001810
266 Ga0316582_0004169
267 Ga0316584_0010174
268 Ga0316581_0014927
269 Ga0400489_68177
270 Ga0439449_0047788
271 Ga0439462_0046293
272 Ga0451577_0014726
273 Ga0451577_0024979
274 Ga0451577_0035319
275 Ga0451577_0115075
276 Ga0451577_0179033
277 Ga0453683_0000242
278 Ga0453683_0001438
279 Ga0453683_0015346
280 Ga0453683_0017136
281 Ga0453683_0039504
282 Ga0466965_0113101
283 Ga0453684_0000007
284 Ga0453684_0000044
285 Ga0453684_0001300
286 Ga0453684_0001473
287 Ga0453684_0003389
288 Ga0453684_0009719
289 Ga0453684_0019674
290 Ga0453684_0020327
291 Ga0453684_0042905
292 Ga0453684_0056666
293 Ga0453684_0067192
294 Ga0453684_0082422
295 Ga0453684_0085100
296 Ga0453684_0093556
297 Ga0453684_0118115
298 Ga0453684_0141889
299 Ga0453684_0185167
300 Ga0453684_0226105
301 Ga0453684_0773267
302 Ga0466960_0060544
303 Ga0466960_0097667
304 Ga0451576_0000368
305 Ga0451576_0010727
306 Ga0451576_0020708
307 Ga0451576_0103893
308 Ga0451576_0273964
309 Ga0451576_0470111
310 Ga0451576_0522801
311 Ga0495629_0000032
312 Ga0495582_0003286
313 Ga0495639_0005000
314 Ga0495594_0005709
315 Ga0495634_0026315
316 Ga0495635_0005517
317 Ga0495658_0000032
318 Ga0495613_0004359
319 Ga0495581_0013148
320 Ga0495680_0001036
321 Ga0495614_0000815
322 Ga0496110_0168082
323 Ga0501071_0067958
324 Ga0501074_0072343
325 Ga0501075_0011499
326 Ga0501077_0013411
327 Ga0501079_0013081
328 Ga0501079_0105961
329 Ga0501081_0021667
330 nmdc:mga05p37_231671_c1
331 nmdc:mga05p37_27673_c1
332 nmdc:mga05p37_395144_c1
333 nmdc:mga05p37_9127_c1
334 nmdc:mga09592_175755_c1
335 nmdc:mga09592_7388_c1
336 nmdc:mga09592_75297_c1
337 nmdc:mga0qj67_20139_c1
338 nmdc:mga0qj67_25070_c1
339 nmdc:mga0qj67_91123_c1
340 nmdc:mga06r32_174219_c1
341 nmdc:mga06r32_41524_c1
342 nmdc:mga06r32_53131_c1
343 nmdc:mga0rr50_61781_c1
344 nmdc:mga0a205_348277_c1
345 Ga0495619_0005958
346 Ga0500616_0000306
347 Ga0500645_000041
348 Ga0501084_0070676
349 Ga0501082_0107397
350 Ga0501082_0149853
351 Ga0501082_0167450
352 Ga0530510_0067557
353 2524186898
354 2563930114
355 2888580704
356 2889050639
357 2907207206
358 8057978475

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01070

FMN_dh

FMN-dependent dehydrogenase

187

374

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3b06-assembly1.cif.gz_A crystal structure of sulfolobus shibatae isopentenyl diphosphate isomerase in complex with reduced fmn and dmapp. 0.9768 6 342
2zru-assembly1.cif.gz_D crystal structure of sulfolobus shibatae isopentenyl diphosphate isomerase in complex with fmn 0.9651 13 342
1vcf-assembly1.cif.gz_B crystal structure of ipp isomerase at i422 0.9636 27 342
1vcf-assembly1.cif.gz_A crystal structure of ipp isomerase at i422 0.9626 27 342
3b06-assembly1.cif.gz_A crystal structure of sulfolobus shibatae isopentenyl diphosphate isomerase in complex with reduced fmn and dmapp. 0.96 6 342
ID Description Score Start End Superfamily
af_Q58272_5_359_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9696 7 342 3.20.20.70
2zruD00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9651 13 342 3.20.20.70
1vcfB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9608 27 342 3.20.20.70
af_A4IC51_12_357_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9607 5 342 3.20.20.70
af_Q4D572_11_172_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9605 7 163 3.20.20.70
ID Description Score Start End GO Terms
AF-X1SE45-F1-model_v4 FMN-dependent dehydrogenase domain-containing protein 0.9947 79 180 GO:0004452
GO:0008299
GO:0010181
AF-A0A3M1GWQ6-F1-model_v4 Isopentenyl-diphosphate delta-isomerase (IPP isomerase) (EC 5.3.3.2) (Isopentenyl diphosphate:dimethylallyl diphosphate isomerase) (Isopentenyl pyrophosphate isomerase) (Type 2 isopentenyl diphosphate isomerase) (IDI-2) 0.9939 6 342 GO:0000287
GO:0004452
GO:0005737
GO:0008299
GO:0010181
GO:0016491
GO:0070402
AF-A0A7C3NLI5-F1-model_v4 Isopentenyl-diphosphate delta-isomerase (IPP isomerase) (EC 5.3.3.2) (Isopentenyl diphosphate:dimethylallyl diphosphate isomerase) (Isopentenyl pyrophosphate isomerase) (Type 2 isopentenyl diphosphate isomerase) (IDI-2) 0.9927 6 342 GO:0000287
GO:0004452
GO:0005737
GO:0008299
GO:0010181
GO:0016491
GO:0070402
AF-A0A2M8PN09-F1-model_v4 Type 2 isopentenyl-diphosphate Delta-isomerase 0.9925 32 341 GO:0004452
GO:0005737
GO:0008299
GO:0010181
GO:0016491
GO:0046872
AF-A0A3B9J9E2-F1-model_v4 Type 2 isopentenyl-diphosphate Delta-isomerase 0.9924 78 342 GO:0004452
GO:0005737
GO:0008299
GO:0010181
GO:0016491
GO:0046872

Map