F274580

General Info

Members Datasets Scaffolds Average Seq Length
179 127 356 333

Family's Representative Sequence

Representative Sequence 3300050493|nmdc:mga0k408_88545_c1|nmdc:mga0k408_88545_c1_638_1750
Length 370
Sequence MSLGTKQGFLGWERLKDTSPLLKKMATLKTFSNTKLNAMRTSLILLIAACVAGNVVRAQTDPHFSQYYVYPAWLNPALTGAFDGDYRISGIYRSQWGNISSPFSTPGLSADFTTSKNSNFGASILNQTAGDGGYNYLTAYGSYAYTGVRFGPQEYHRVVMGMQIGIIQRKFNPSKLTFGDQWNPITGYNPGTQTAEVFGRTSATSFDAGAGILYYDAQPGKKMNLFGGFAVSHLTQPDDQFSATGKGKIPLRYTAHAGVRITLNEVLSLTPNILYLKQGSAQEKMAGAYARLIAAPGTDFMLGANYRFKDALSPYVGFAHKNFVLGVSYDVNTSDLGKMARGSNSFEISLSFIGKRSVKTPEVDFVCPRL

Samples

Sample ID Description Type Environment
1 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
13 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
14 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
15 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
16 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
17 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
18 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
27 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
28 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
31 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
32 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
33 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
34 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
35 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
36 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
37 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
38 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
39 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
40 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
41 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
42 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
43 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
45 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
46 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
48 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
49 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
50 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
51 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
53 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
61 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
62 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
63 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
64 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
65 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
66 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
67 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
68 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
69 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
70 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
71 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
72 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
73 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
74 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
75 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
76 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
77 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
78 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
79 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
80 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
81 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
82 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
83 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
84 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
85 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
86 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
87 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
88 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
89 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
90 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
91 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
92 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
93 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
94 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
95 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
96 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
97 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
98 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
99 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
100 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
101 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
102 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
103 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
104 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
105 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
106 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
107 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
108 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
109 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
110 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
111 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
112 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
113 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
114 2738541278 Niastella sp. CF465 Isolate Unclassified
115 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
116 2818991444 Filimonas endophytica 3197 Isolate Unclassified
117 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
118 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
119 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
120 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
121 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
122 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
123 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
124 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
125 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
126 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
127 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 88.83
Metatranscriptomes 0
Isolates 11.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 34.08
Nodule 0
Rhizoplane 2.23
Rhizosphere 39.11
Stem 0
Stem Tuber 0
Unclassified 7.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0k408_88545_c1 3300050493 Bacteria 1818
2 JGI24740J21852_10001045 3300001979 Bacteria 12434
3 JGI24739J22299_10000642 3300001989 Bacteria 12579
4 JGI24751J29686_10000631 3300002459 Bacteria 9058
5 JGI25154J39366_1000019 3300002738 Bacteria 234419
6 JGI25157J39369_1003099 3300002741 Bacteria 3582
7 JGI25153J46596_10001065 3300003215 Bacteria 16737
8 JGI25153J46596_10016102 3300003215 Bacteria 3014
9 rootH1_10001613 3300003316 Bacteria 3297
10 rootH1_10030496 3300003316 Bacteria 19315
11 rootH2_10079678 3300003320 Bacteria 3206
12 rootH2_10095264 3300003320 Bacteria 2471
13 rootH2_10225104 3300003320 Bacteria 1949
14 rootL2_10176307 3300003322 Unclassified 1595
15 rootL2_10211963 3300003322 Bacteria 1390
16 rootH1_10017472 3300003323 Bacteria 25637
17 rootH1_10061235 3300003323 Bacteria 6004
18 rootH1_10304062 3300003323 Unclassified 2513
19 Ga0055535_1006193 3300003761 Bacteria 2471
20 Ga0055526_1013922 3300003771 Bacteria 3355
21 Ga0055528_1000541 3300003790 Bacteria 28864
22 Ga0055530_10000801 3300003791 Bacteria 26132
23 Ga0055531_10000045 3300003794 Bacteria 132131
24 Ga0055531_10000153 3300003794 Bacteria 80166
25 Ga0055543_1008243 3300004625 Bacteria 2320
26 Ga0065165_1000172 3300005262 Bacteria 114850
27 Ga0065165_1014632 3300005262 Bacteria 3037
28 Ga0070670_100015240 3300005331 Bacteria 6597
29 Ga0070707_100278655 3300005468 Unclassified 1625
30 Ga0070698_100200594 3300005471 Bacteria 1931
31 Ga0068855_100013612 3300005563 Bacteria 9809
32 Ga0068857_100128578 3300005577 Bacteria 2283
33 Ga0068857_100194909 3300005577 Unclassified 1846
34 Ga0068859_100010738 3300005617 Bacteria 9217
35 Ga0068860_100075397 3300005843 Bacteria 3208
36 Ga0075366_10004483 3300006195 Bacteria 7491
37 Ga0075366_10021364 3300006195 Bacteria 3762
38 Ga0075366_10065896 3300006195 Bacteria 2154
39 Ga0097620_100010738 3300006931 Bacteria 9217
40 Ga0111539_10589813 3300009094 Unclassified 1294
41 Ga0114129_10010212 3300009147 Bacteria 13386
42 Ga0114129_10030870 3300009147 Bacteria 7579
43 Ga0105241_10082965 3300009174 Bacteria 2514
44 Ga0105237_10009397 3300009545 Bacteria 10471
45 Ga0105237_10199537 3300009545 Unclassified 2000
46 Ga0105249_10016306 3300009553 Bacteria 6589
47 Ga0105239_10001450 3300010375 Bacteria 31601
48 Ga0105239_10001680 3300010375 Bacteria 29168
49 Ga0157373_10084957 3300013100 Bacteria 2231
50 Ga0157371_10038665 3300013102 Bacteria 3413
51 Ga0157370_10248956 3300013104 Bacteria 1644
52 Ga0157369_10433910 3300013105 Bacteria 1361
53 Ga0157374_10053457 3300013296 Bacteria 3765
54 Ga0157374_10073080 3300013296 Bacteria 3237
55 Ga0157380_10012154 3300014326 Bacteria 6235
56 Ga0157376_10414986 3300014969 Bacteria 1305
57 Ga0182005_1001154 3300015265 Bacteria 10956
58 Ga0182005_1005721 3300015265 Bacteria 3858
59 Ga0209436_100397 3300025208 Bacteria 19600
60 Ga0209258_100247 3300025242 Bacteria 99442
61 Ga0209646_1000003 3300025246 Bacteria 1160860
62 Ga0209026_1000182 3300025250 Bacteria 92580
63 Ga0209148_1000207 3300025254 Bacteria 104094
64 Ga0209673_1000081 3300025273 Bacteria 220762
65 Ga0209130_1001250 3300025284 Bacteria 17758
66 Ga0209564_1011319 3300025295 Unclassified 4010
67 Ga0209758_1008093 3300025297 Bacteria 6930
68 Ga0209050_1000346 3300025298 Bacteria 91427
69 Ga0207426_1000412 3300025302 Bacteria 71401
70 Ga0207426_1002827 3300025302 Bacteria 10370
71 Ga0207426_1009825 3300025302 Unclassified 3752
72 Ga0209257_1000001 3300025304 Bacteria 2274655
73 Ga0207671_10244898 3300025914 Bacteria 1409
74 Ga0207650_10025691 3300025925 Bacteria 4196
75 Ga0207667_10028260 3300025949 Bacteria 6093
76 Ga0207639_10274157 3300026041 Bacteria 1481
77 Ga0207674_10065154 3300026116 Bacteria 3673
78 Ga0268264_10032123 3300028381 Bacteria 4307
79 Ga0307515_10000002 3300028794 Bacteria 1231751
80 Ga0307513_10066206 3300031456 Bacteria 3798
81 Ga0307513_10208666 3300031456 Bacteria 1787
82 Ga0307509_10022757 3300031507 Bacteria 7056
83 Ga0307509_10039762 3300031507 Bacteria 5121
84 Ga0307508_10002685 3300031616 Bacteria 18623
85 Ga0307413_10031266 3300031824 Bacteria 3002
86 Ga0307518_10247102 3300031838 Bacteria 1138
87 Ga0307415_100026444 3300032126 Bacteria 3661
88 Ga0373927_0049311 3300035695 Bacteria 2723
89 Ga0373925_0222162 3300037068 Bacteria 1508
90 Ga0451795_0284458 3300041456 Bacteria 1769
91 Ga0451802_1252042 3300041460 Bacteria 1684
92 Ga0451807_1737917 3300041486 Bacteria 1397
93 Ga0451851_0064156 3300041507 Unclassified 1084
94 Ga0451853_2401353 3300041512 Bacteria 2514
95 Ga0439449_0051558 3300042007 Bacteria 1522
96 Ga0439457_001229 3300042014 Bacteria 7709
97 Ga0439457_006026 3300042014 Bacteria 2996
98 Ga0451577_0002871 3300042876 Bacteria 19800
99 Ga0466969_0000427 3300044656 Bacteria 23025
100 Ga0466972_0000040 3300044658 Bacteria 133427
101 Ga0466972_0000101 3300044658 Bacteria 75550
102 Ga0466966_0017086 3300044684 Bacteria 4799
103 Ga0466970_0156398 3300044765 Bacteria 1260
104 Ga0466957_0000085 3300044842 Bacteria 37682
105 Ga0466957_0000725 3300044842 Bacteria 16890
106 Ga0466957_0009109 3300044842 Bacteria 5660
107 Ga0466959_0000053 3300045049 Bacteria 81055
108 Ga0495627_006242 3300046453 Bacteria 4687
109 Ga0495633_0000005 3300046558 Bacteria 357644
110 Ga0495668_0001443 3300046616 Bacteria 22991
111 Ga0495686_0007948 3300047472 Bacteria 7868
112 Ga0495686_0019038 3300047472 Bacteria 4592
113 Ga0496101_0027894 3300048904 Bacteria 3938
114 Ga0496121_0000020 3300048924 Bacteria 498732
115 Ga0496126_0019422 3300048929 Bacteria 6692
116 Ga0496126_0055335 3300048929 Bacteria 3590
117 Ga0501292_016164 3300049515 Bacteria 1172
118 Ga0501032_0220042 3300049569 Unclassified 1236
119 Ga0501043_0242187 3300049579 Bacteria 1391
120 Ga0501225_0007241 3300049705 Bacteria 3219
121 Ga0501241_000314 3300049758 Bacteria 10572
122 Ga0501241_000666 3300049758 Bacteria 7395
123 nmdc:mga0k408_106515_c1 3300050493 Bacteria 1656
124 nmdc:mga0k408_18229_c1 3300050493 Bacteria 3917
125 nmdc:mga0k408_19279_c1 3300050493 Bacteria 3810
126 nmdc:mga0k408_23793_c1 3300050493 Bacteria 3460
127 nmdc:mga07m45_59456_c1 3300050496 Bacteria 2162
128 nmdc:mga05p37_23467_c1 3300050507 Bacteria 7485
129 nmdc:mga05p37_6859_c1 3300050507 Bacteria 13426
130 nmdc:mga08y16_246661_c1 3300050511 Unclassified 1845
131 Ga0500578_0000018 3300053086 Bacteria 172537
132 Ga0500578_0000054 3300053086 Bacteria 121082
133 Ga0500644_0000041 3300053088 Bacteria 77645
134 Ga0500646_0007007 3300053090 Bacteria 2874
135 Ga0500583_0000005 3300053092 Bacteria 166480
136 Ga0500583_0000125 3300053092 Bacteria 35448
137 Ga0500583_0003145 3300053092 Bacteria 5122
138 Ga0500651_0084319 3300053093 Bacteria 1965
139 Ga0500562_000012 3300053108 Bacteria 168210
140 Ga0500562_000015 3300053108 Bacteria 143120
141 Ga0500562_000016 3300053108 Bacteria 131323
142 Ga0500569_013982 3300053109 Bacteria 1978
143 Ga0500652_009109 3300053131 Bacteria 3343
144 Ga0500568_0003861 3300053139 Bacteria 8171
145 Ga0500568_0059566 3300053139 Bacteria 1481
146 Ga0500590_009193 3300053148 Bacteria 4965
147 Ga0500616_0069856 3300053153 Unclassified 1794
148 Ga0500616_0110158 3300053153 Unclassified 1331
149 Ga0500622_0000042 3300053156 Bacteria 161253
150 Ga0500622_0000220 3300053156 Bacteria 60029
151 Ga0500622_0004075 3300053156 Bacteria 9381
152 Ga0500622_0005834 3300053156 Bacteria 7292
153 Ga0500622_0033232 3300053156 Bacteria 2704
154 Ga0500622_0040513 3300053156 Bacteria 2425
155 Ga0500633_0000185 3300053160 Bacteria 8657
156 Ga0500634_0140170 3300053161 Bacteria 1146
157 Ga0500636_0062208 3300053177 Bacteria 2177
158 Ga0500661_015318 3300055283 Bacteria 1376
159 2738726965 2738541278 Bacteria 9755573
160 2738729584 2738541278 Bacteria 9755573
161 2819573472 2818991442 Bacteria 8318214
162 2819573947 2818991442 Bacteria 8318214
163 2819586199 2818991444 Bacteria 6968812
164 2819587413 2818991444 Bacteria 6968812
165 2819682223 2818991460 Bacteria 7595395
166 2821137260 2821136567 Bacteria 8080116
167 2884795650 2884791551 Bacteria 8511252
168 2904467998 2904467357 Bacteria 8057758
169 2929154997 2929154850 Bacteria 6753285
170 2929156955 2929154850 Bacteria 6753285
171 2929158885 2929154850 Bacteria 6753285
172 2929181395 2929177148 Bacteria 7883697
173 2929241101 2929239360 Bacteria 7745570
174 2929241566 2929239360 Bacteria 7745570
175 2929927022 2929921140 Bacteria 8649150
176 2945983775 2945977869 Bacteria 7777518
177 2946016816 2946013367 Bacteria 7766675
178 8003155081 8003151029 Bacteria 8187759
179 nmdc:mga0k408_88545_c1
180 JGI24740J21852_10001045
181 JGI24739J22299_10000642
182 JGI24751J29686_10000631
183 JGI25154J39366_1000019
184 JGI25157J39369_1003099
185 JGI25153J46596_10001065
186 JGI25153J46596_10016102
187 rootH1_10001613
188 rootH1_10030496
189 rootH2_10079678
190 rootH2_10095264
191 rootH2_10225104
192 rootL2_10176307
193 rootL2_10211963
194 rootH1_10017472
195 rootH1_10061235
196 rootH1_10304062
197 Ga0055535_1006193
198 Ga0055526_1013922
199 Ga0055528_1000541
200 Ga0055530_10000801
201 Ga0055531_10000045
202 Ga0055531_10000153
203 Ga0055543_1008243
204 Ga0065165_1000172
205 Ga0065165_1014632
206 Ga0070670_100015240
207 Ga0070707_100278655
208 Ga0070698_100200594
209 Ga0068855_100013612
210 Ga0068857_100128578
211 Ga0068857_100194909
212 Ga0068859_100010738
213 Ga0068860_100075397
214 Ga0075366_10004483
215 Ga0075366_10021364
216 Ga0075366_10065896
217 Ga0097620_100010738
218 Ga0111539_10589813
219 Ga0114129_10010212
220 Ga0114129_10030870
221 Ga0105241_10082965
222 Ga0105237_10009397
223 Ga0105237_10199537
224 Ga0105249_10016306
225 Ga0105239_10001450
226 Ga0105239_10001680
227 Ga0157373_10084957
228 Ga0157371_10038665
229 Ga0157370_10248956
230 Ga0157369_10433910
231 Ga0157374_10053457
232 Ga0157374_10073080
233 Ga0157380_10012154
234 Ga0157376_10414986
235 Ga0182005_1001154
236 Ga0182005_1005721
237 Ga0209436_100397
238 Ga0209258_100247
239 Ga0209646_1000003
240 Ga0209026_1000182
241 Ga0209148_1000207
242 Ga0209673_1000081
243 Ga0209130_1001250
244 Ga0209564_1011319
245 Ga0209758_1008093
246 Ga0209050_1000346
247 Ga0207426_1000412
248 Ga0207426_1002827
249 Ga0207426_1009825
250 Ga0209257_1000001
251 Ga0207671_10244898
252 Ga0207650_10025691
253 Ga0207667_10028260
254 Ga0207639_10274157
255 Ga0207674_10065154
256 Ga0268264_10032123
257 Ga0307515_10000002
258 Ga0307513_10066206
259 Ga0307513_10208666
260 Ga0307509_10022757
261 Ga0307509_10039762
262 Ga0307508_10002685
263 Ga0307413_10031266
264 Ga0307518_10247102
265 Ga0307415_100026444
266 Ga0373927_0049311
267 Ga0373925_0222162
268 Ga0451795_0284458
269 Ga0451802_1252042
270 Ga0451807_1737917
271 Ga0451851_0064156
272 Ga0451853_2401353
273 Ga0439449_0051558
274 Ga0439457_001229
275 Ga0439457_006026
276 Ga0451577_0002871
277 Ga0466969_0000427
278 Ga0466972_0000040
279 Ga0466972_0000101
280 Ga0466966_0017086
281 Ga0466970_0156398
282 Ga0466957_0000085
283 Ga0466957_0000725
284 Ga0466957_0009109
285 Ga0466959_0000053
286 Ga0495627_006242
287 Ga0495633_0000005
288 Ga0495668_0001443
289 Ga0495686_0007948
290 Ga0495686_0019038
291 Ga0496101_0027894
292 Ga0496121_0000020
293 Ga0496126_0019422
294 Ga0496126_0055335
295 Ga0501292_016164
296 Ga0501032_0220042
297 Ga0501043_0242187
298 Ga0501225_0007241
299 Ga0501241_000314
300 Ga0501241_000666
301 nmdc:mga0k408_106515_c1
302 nmdc:mga0k408_18229_c1
303 nmdc:mga0k408_19279_c1
304 nmdc:mga0k408_23793_c1
305 nmdc:mga07m45_59456_c1
306 nmdc:mga05p37_23467_c1
307 nmdc:mga05p37_6859_c1
308 nmdc:mga08y16_246661_c1
309 Ga0500578_0000018
310 Ga0500578_0000054
311 Ga0500644_0000041
312 Ga0500646_0007007
313 Ga0500583_0000005
314 Ga0500583_0000125
315 Ga0500583_0003145
316 Ga0500651_0084319
317 Ga0500562_000012
318 Ga0500562_000015
319 Ga0500562_000016
320 Ga0500569_013982
321 Ga0500652_009109
322 Ga0500568_0003861
323 Ga0500568_0059566
324 Ga0500590_009193
325 Ga0500616_0069856
326 Ga0500616_0110158
327 Ga0500622_0000042
328 Ga0500622_0000220
329 Ga0500622_0004075
330 Ga0500622_0005834
331 Ga0500622_0033232
332 Ga0500622_0040513
333 Ga0500633_0000185
334 Ga0500634_0140170
335 Ga0500636_0062208
336 Ga0500661_015318
337 2738726965
338 2738729584
339 2819573472
340 2819573947
341 2819586199
342 2819587413
343 2819682223
344 2821137260
345 2884795650
346 2904467998
347 2929154997
348 2929156955
349 2929158885
350 2929181395
351 2929241101
352 2929241566
353 2929927022
354 2945983775
355 2946016816
356 8003155081

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11751

PorP_SprF

Type IX secretion system membrane protein PorP/SprF

56

352

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ctd-assembly1.cif.gz_A x-ray structure of an engineered ompg loop6-deletion 0.7052 78 346
4ctd-assembly1.cif.gz_B x-ray structure of an engineered ompg loop6-deletion 0.6998 78 346
4fqe-assembly1.cif.gz_A kdgm porin 0.6954 81 346
2wvp-assembly1.cif.gz_A synthetically modified ompg 0.6904 80 346
4ctd-assembly1.cif.gz_A x-ray structure of an engineered ompg loop6-deletion 0.69 78 346
ID Description Score Start End Superfamily
af_Q553U9_108_208_2.40.128.20 Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain 0.7091 282 346 2.40.128.20
4ctdB00 Mainly Beta;Beta Barrel;Porin;monomeric porin ompg 0.6998 78 346 2.40.160.40
4fqeA00 Mainly Beta;Beta Barrel;Porin;monomeric porin ompg 0.6954 81 346 2.40.160.40
2wvpA00 Mainly Beta;Beta Barrel;Porin;monomeric porin ompg 0.6904 80 346 2.40.160.40
4ctdB00 Mainly Beta;Beta Barrel;Porin;monomeric porin ompg 0.6841 78 346 2.40.160.40
ID Description Score Start End GO Terms
AF-A0A4Q5U9F3-F1-model_v4 deleted 0.9325 65 357
AF-A0A1J5M2C5-F1-model_v4 Type IX secretion system membrane protein PorP/SprF 0.9324 60 364
AF-A0A1J5M2C5-F1-model_v4 Type IX secretion system membrane protein PorP/SprF 0.9294 60 364
AF-A0A522EAP0-F1-model_v4 Type IX secretion system membrane protein PorP/SprF 0.9278 82 364
AF-A0A0Q5NAX0-F1-model_v4 Type IX secretion system membrane protein PorP/SprF 0.9193 69 353

Map