F274665

General Info

Members Datasets Scaffolds Average Seq Length
179 151 358 404

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2599185156|2599334677
Length 436
Sequence ENASLTTEPWLTIVGLGEDGLAGLGEEAKQAISNARLVFGGTRHLALAAPLITGESCPWSSPFETAIDVVVAMAGMPVVVLASGDPFFFGVGVTLSRRIDPSQMRVLPAPSAFSLAAARLGWALQDVVCLSLHGRPLDLLRPHLHGGTRILALTSDGEGPAAVAALMRDTGFGASAFTVLEAMGGPQERISFHTANGFDLAACHSLNVCAIEVVAGQQARVLGLTPGLDDDLFEHDGQITKREVRALTLSALSPRRGECLWDIGAGAGSIAIEWMLADPSLRAVAIEAHPERAARIGRNARAFGVPELRIVEGVVPHALADLGREPRPDAIFVGGGGSEAGVMDAALDALRPGGRLVANAVTTEMEAVLLASRAAHGGSLTRIDIARASPVGAMTGWRPAMPVTQWVWIKPALTGPDDVSEDDMGIDVGKTRGELA

Samples

Sample ID Description Type Environment
1 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
4 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
5 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
6 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
7 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
23 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
24 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
27 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
28 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
29 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
30 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
31 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
32 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
35 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
36 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
37 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
38 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
39 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
40 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
41 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
42 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
43 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
44 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
46 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
47 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
49 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
50 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
66 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
67 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
68 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
69 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
70 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
71 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
72 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
73 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
74 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
75 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
76 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
77 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
78 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
79 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
80 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
81 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
82 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
83 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
84 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
85 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
86 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
87 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
88 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
89 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
90 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
91 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
92 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
93 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
94 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
95 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
96 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
97 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
98 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
99 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
100 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
101 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
102 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
103 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
104 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
105 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
106 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
107 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
114 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
115 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
116 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
117 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
118 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
119 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
120 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
121 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
122 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
123 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
124 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
125 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
126 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
127 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
128 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
129 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
130 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
131 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
132 2643221557 Ensifer sp. Root558 Isolate Unclassified
133 2643221607 Rhizobium sp. Root73 Isolate Unclassified
134 2643221610 Ensifer sp. Root74 Isolate Unclassified
135 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
136 2643221668 Ensifer sp. Root423 Isolate Unclassified
137 2643221675 Ensifer sp. Root1298 Isolate Unclassified
138 2643221680 Ensifer sp. Root1312 Isolate Unclassified
139 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
140 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
141 2643221723 Ensifer sp. Root278 Isolate Unclassified
142 2643221726 Ensifer sp. Root954 Isolate Unclassified
143 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
144 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
145 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
146 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
147 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
148 2919679072 Pseudotabrizicola sp. 4114 Isolate Unclassified
149 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
150 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
151 2996887358 Rhizobium sp. R711 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 87.15
Metatranscriptomes 0
Isolates 12.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.2
Nodule 1.12
Rhizoplane 3.35
Rhizosphere 55.31
Stem 0
Stem Tuber 0
Unclassified 0.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1000092 3300002987 Bacteria 42762
2 JGI25159J45721_1000403 3300002987 Bacteria 20187
3 rootH1_10051438 3300003316 Bacteria 4835
4 JGI25160J50197_1000134 3300003354 Bacteria 66627
5 JGI25161J50226_1000116 3300003374 Bacteria 62089
6 Ga0055526_1002223 3300003771 Bacteria 13288
7 Ga0055524_1001125 3300003775 Bacteria 16106
8 Ga0055524_1003343 3300003775 Bacteria 7820
9 Ga0065165_1000196 3300005262 Bacteria 104569
10 Ga0065707_10082198 3300005295 Bacteria 19357
11 Ga0070670_100000196 3300005331 Bacteria 56006
12 Ga0070689_100000836 3300005340 Bacteria 19082
13 Ga0070675_100059625 3300005354 Bacteria 3149
14 Ga0070671_100018992 3300005355 Bacteria 5591
15 Ga0070688_100019620 3300005365 Bacteria 3919
16 Ga0070667_100059710 3300005367 Bacteria 3226
17 Ga0070667_100173435 3300005367 Bacteria 1905
18 Ga0070714_100072189 3300005435 Bacteria 2987
19 Ga0070711_100067110 3300005439 Bacteria 2516
20 Ga0070694_100206969 3300005444 Bacteria 1465
21 Ga0070681_10006541 3300005458 Bacteria 11347
22 Ga0070706_100234218 3300005467 Bacteria 1714
23 Ga0070707_100040444 3300005468 Bacteria 4461
24 Ga0070665_100031307 3300005548 Bacteria 5354
25 Ga0070665_100133010 3300005548 Bacteria 2489
26 Ga0068859_100003663 3300005617 Bacteria 15658
27 Ga0068863_100014040 3300005841 Bacteria 7717
28 Ga0068858_100000887 3300005842 Bacteria 31036
29 Ga0068860_100000498 3300005843 Bacteria 48732
30 Ga0081539_10049131 3300005985 Bacteria 2396
31 Ga0075365_10024074 3300006038 Bacteria 3836
32 Ga0075362_10023076 3300006177 Bacteria 2628
33 Ga0075362_10023530 3300006177 Bacteria 2606
34 Ga0075430_100039096 3300006846 Bacteria 4018
35 Ga0075433_10244784 3300006852 Bacteria 1592
36 Ga0068865_100040946 3300006881 Bacteria 3151
37 Ga0097620_100003663 3300006931 Bacteria 15658
38 Ga0105240_10158328 3300009093 Bacteria 2692
39 Ga0105240_10188614 3300009093 Bacteria 2426
40 Ga0105248_10088818 3300009177 Bacteria 3479
41 Ga0105237_10334105 3300009545 Bacteria 1520
42 Ga0105249_10232769 3300009553 Bacteria 1818
43 Ga0105249_10379712 3300009553 Bacteria 1439
44 Ga0105239_10147424 3300010375 Unclassified 2626
45 Ga0171463_1014 3300013249 Bacteria 83917
46 Ga0163163_10113852 3300014325 Bacteria 2735
47 Ga0183363_1028 3300015690 Bacteria 50706
48 Ga0213876_10026846 3300021384 Bacteria 3038
49 Ga0209129_1001926 3300025258 Bacteria 10892
50 Ga0209130_1000198 3300025284 Bacteria 82557
51 Ga0209676_1003330 3300025292 Bacteria 10036
52 Ga0209025_1000339 3300025294 Bacteria 103239
53 Ga0209025_1016670 3300025294 Bacteria 4309
54 Ga0209564_1000353 3300025295 Bacteria 85747
55 Ga0209050_1000299 3300025298 Bacteria 104017
56 Ga0209050_1004839 3300025298 Bacteria 8838
57 Ga0209256_1000368 3300025299 Bacteria 72598
58 Ga0209256_1000456 3300025299 Bacteria 61717
59 Ga0209256_1000884 3300025299 Bacteria 37000
60 Ga0207426_1000048 3300025302 Bacteria 409127
61 Ga0209051_1001164 3300025303 Bacteria 23925
62 Ga0209257_1002967 3300025304 Bacteria 15506
63 Ga0207699_10175068 3300025906 Bacteria 1438
64 Ga0207645_10019218 3300025907 Bacteria 4482
65 Ga0207695_10131623 3300025913 Bacteria 2459
66 Ga0207693_10124700 3300025915 Bacteria 2024
67 Ga0207652_10051751 3300025921 Bacteria 3522
68 Ga0207646_10026247 3300025922 Bacteria 5318
69 Ga0207646_10209741 3300025922 Bacteria 1759
70 Ga0207650_10000347 3300025925 Bacteria 44769
71 Ga0207670_10000845 3300025936 Bacteria 16075
72 Ga0207703_10002684 3300026035 Bacteria 15262
73 Ga0207641_10000337 3300026088 Bacteria 57031
74 Ga0207683_10083228 3300026121 Bacteria 2843
75 Ga0268266_10050410 3300028379 Bacteria 3571
76 Ga0268264_10000375 3300028381 Bacteria 65683
77 Ga0307510_10000001 3300033180 Bacteria 1172244
78 Ga0307510_10024370 3300033180 Bacteria 6992
79 Ga0373923_0057486 3300035111 Bacteria 1645
80 Ga0373947_0111746 3300035725 Bacteria 1727
81 Ga0373937_0065504 3300036401 Bacteria 3345
82 Ga0395899_0030139 3300037312 Bacteria 4081
83 Ga0395900_0017386 3300037418 Bacteria 7340
84 Ga0395898_0087076 3300037466 Bacteria 3009
85 Ga0395901_0045113 3300038443 Bacteria 4573
86 Ga0436365_0813916 3300039437 Bacteria 7986
87 Ga0436365_0929432 3300039437 Bacteria 1599
88 Ga0436365_1707801 3300039437 Bacteria 13214
89 Ga0439438_033564 3300041405 Bacteria 1355
90 Ga0439464_0031652 3300042439 Bacteria 1485
91 Ga0466966_0016179 3300044684 Bacteria 4932
92 Ga0466961_0012174 3300044693 Bacteria 5501
93 Ga0466968_0006414 3300044735 Bacteria 4436
94 Ga0466968_0020015 3300044735 Bacteria 2697
95 Ga0466958_0008848 3300045836 Bacteria 5595
96 Ga0495629_0027078 3300046459 Bacteria 4072
97 Ga0495638_0002563 3300046460 Bacteria 14720
98 Ga0495651_0057813 3300046462 Bacteria 2977
99 Ga0495650_0041196 3300046471 Bacteria 1977
100 Ga0495606_0054981 3300046507 Bacteria 2576
101 Ga0495610_0000285 3300046512 Bacteria 52902
102 Ga0495643_0019538 3300046522 Bacteria 3917
103 Ga0495622_0037491 3300046557 Bacteria 2258
104 Ga0495625_0000420 3300046660 Bacteria 63775
105 Ga0495604_0030377 3300047317 Bacteria 4291
106 Ga0495604_0067073 3300047317 Bacteria 2727
107 Ga0495687_032684 3300047443 Bacteria 2371
108 Ga0495686_0002492 3300047472 Bacteria 17303
109 Ga0496102_0042839 3300048905 Bacteria 4103
110 Ga0496109_0034719 3300048912 Bacteria 4545
111 Ga0496110_0062307 3300048913 Bacteria 3294
112 Ga0496115_0120925 3300048918 Bacteria 2155
113 Ga0496116_0000060 3300048919 Bacteria 272219
114 Ga0496116_0063130 3300048919 Bacteria 2387
115 Ga0496117_0001061 3300048920 Bacteria 41887
116 Ga0496118_0000040 3300048921 Bacteria 304516
117 Ga0496118_0049104 3300048921 Bacteria 3252
118 Ga0496119_0001116 3300048922 Bacteria 33850
119 Ga0496119_0012808 3300048922 Bacteria 6766
120 Ga0496120_0000104 3300048923 Bacteria 140731
121 Ga0496121_0001779 3300048924 Bacteria 34950
122 Ga0496121_0053585 3300048924 Bacteria 3378
123 Ga0496122_0001106 3300048925 Bacteria 46592
124 Ga0496123_0000457 3300048926 Bacteria 71921
125 Ga0496124_0002877 3300048927 Bacteria 21757
126 Ga0496124_0007980 3300048927 Bacteria 11142
127 Ga0496124_0011273 3300048927 Bacteria 8948
128 Ga0496124_0082859 3300048927 Bacteria 2632
129 Ga0496125_0000424 3300048928 Bacteria 78587
130 Ga0496125_0004802 3300048928 Bacteria 15372
131 Ga0496125_0017253 3300048928 Bacteria 6896
132 Ga0496125_0162554 3300048928 Bacteria 1514
133 Ga0496126_0002193 3300048929 Bacteria 27133
134 Ga0501033_0090520 3300049570 Bacteria 2238
135 Ga0501036_0156836 3300049572 Bacteria 1920
136 Ga0501039_0043034 3300049575 Bacteria 3489
137 Ga0501040_0074894 3300049576 Bacteria 2339
138 Ga0501042_0035794 3300049578 Bacteria 3522
139 Ga0501043_0036012 3300049579 Bacteria 3892
140 Ga0501070_0056841 3300049586 Bacteria 3244
141 Ga0501071_0076324 3300049587 Bacteria 2447
142 Ga0501075_0029010 3300049591 Bacteria 4090
143 Ga0501076_0038613 3300049592 Bacteria 3749
144 Ga0501077_0004436 3300049593 Bacteria 8522
145 Ga0501079_0099928 3300049741 Bacteria 2249
146 Ga0501079_0157650 3300049741 Bacteria 1769
147 Ga0501080_0054371 3300049742 Bacteria 3728
148 Ga0501035_0079713 3300049822 Bacteria 2892
149 nmdc:mga03683_34878_c1 3300050489 Bacteria 2038
150 nmdc:mga0yw44_4675_c1 3300050492 Bacteria 6328
151 nmdc:mga0qj67_11312_c1 3300050509 Bacteria 6685
152 Ga0495601_0041000 3300053077 Bacteria 2901
153 Ga0500618_000146 3300053125 Bacteria 58637
154 Ga0500634_0002843 3300053161 Bacteria 7476
155 Ga0501084_0022998 3300054114 Bacteria 5203
156 Ga0530510_0011130 3300061734 Bacteria 6310
157 2599334677 2599185156 Bacteria 5403036
158 2512534330 2512047086 Bacteria 6850303
159 2600194174 2599185352 Bacteria 7228948
160 2643809685 2643221557 Bacteria 7184309
161 2644048399 2643221607 Bacteria 6314006
162 2644063865 2643221610 Bacteria 7480339
163 2644201760 2643221636 Bacteria 6583769
164 2644381387 2643221668 Bacteria 7306521
165 2644415698 2643221675 Bacteria 7473456
166 2644448738 2643221680 Bacteria 7473610
167 2644481201 2643221686 Bacteria 6310811
168 2644500111 2643221689 Bacteria 6042950
169 2644676659 2643221723 Bacteria 7095460
170 2644686868 2643221726 Bacteria 7455827
171 2808971005 2808606384 Bacteria 8474373
172 2809006092 2808606390 Bacteria 8476311
173 2809012972 2808606391 Bacteria 8308166
174 2819552051 2818991438 Bacteria 5793701
175 2842925801 2842922631 Bacteria 5824079
176 2919682019 2919679072 Bacteria 4629602
177 2920828402 2920822456 Bacteria 6897201
178 2941501609 2941499720 Bacteria 7599444
179 2996891353 2996887358 Bacteria 5795980
180 JGI25159J45721_1000092
181 JGI25159J45721_1000403
182 rootH1_10051438
183 JGI25160J50197_1000134
184 JGI25161J50226_1000116
185 Ga0055526_1002223
186 Ga0055524_1001125
187 Ga0055524_1003343
188 Ga0065165_1000196
189 Ga0065707_10082198
190 Ga0070670_100000196
191 Ga0070689_100000836
192 Ga0070675_100059625
193 Ga0070671_100018992
194 Ga0070688_100019620
195 Ga0070667_100059710
196 Ga0070667_100173435
197 Ga0070714_100072189
198 Ga0070711_100067110
199 Ga0070694_100206969
200 Ga0070681_10006541
201 Ga0070706_100234218
202 Ga0070707_100040444
203 Ga0070665_100031307
204 Ga0070665_100133010
205 Ga0068859_100003663
206 Ga0068863_100014040
207 Ga0068858_100000887
208 Ga0068860_100000498
209 Ga0081539_10049131
210 Ga0075365_10024074
211 Ga0075362_10023076
212 Ga0075362_10023530
213 Ga0075430_100039096
214 Ga0075433_10244784
215 Ga0068865_100040946
216 Ga0097620_100003663
217 Ga0105240_10158328
218 Ga0105240_10188614
219 Ga0105248_10088818
220 Ga0105237_10334105
221 Ga0105249_10232769
222 Ga0105249_10379712
223 Ga0105239_10147424
224 Ga0171463_1014
225 Ga0163163_10113852
226 Ga0183363_1028
227 Ga0213876_10026846
228 Ga0209129_1001926
229 Ga0209130_1000198
230 Ga0209676_1003330
231 Ga0209025_1000339
232 Ga0209025_1016670
233 Ga0209564_1000353
234 Ga0209050_1000299
235 Ga0209050_1004839
236 Ga0209256_1000368
237 Ga0209256_1000456
238 Ga0209256_1000884
239 Ga0207426_1000048
240 Ga0209051_1001164
241 Ga0209257_1002967
242 Ga0207699_10175068
243 Ga0207645_10019218
244 Ga0207695_10131623
245 Ga0207693_10124700
246 Ga0207652_10051751
247 Ga0207646_10026247
248 Ga0207646_10209741
249 Ga0207650_10000347
250 Ga0207670_10000845
251 Ga0207703_10002684
252 Ga0207641_10000337
253 Ga0207683_10083228
254 Ga0268266_10050410
255 Ga0268264_10000375
256 Ga0307510_10000001
257 Ga0307510_10024370
258 Ga0373923_0057486
259 Ga0373947_0111746
260 Ga0373937_0065504
261 Ga0395899_0030139
262 Ga0395900_0017386
263 Ga0395898_0087076
264 Ga0395901_0045113
265 Ga0436365_0813916
266 Ga0436365_0929432
267 Ga0436365_1707801
268 Ga0439438_033564
269 Ga0439464_0031652
270 Ga0466966_0016179
271 Ga0466961_0012174
272 Ga0466968_0006414
273 Ga0466968_0020015
274 Ga0466958_0008848
275 Ga0495629_0027078
276 Ga0495638_0002563
277 Ga0495651_0057813
278 Ga0495650_0041196
279 Ga0495606_0054981
280 Ga0495610_0000285
281 Ga0495643_0019538
282 Ga0495622_0037491
283 Ga0495625_0000420
284 Ga0495604_0030377
285 Ga0495604_0067073
286 Ga0495687_032684
287 Ga0495686_0002492
288 Ga0496102_0042839
289 Ga0496109_0034719
290 Ga0496110_0062307
291 Ga0496115_0120925
292 Ga0496116_0000060
293 Ga0496116_0063130
294 Ga0496117_0001061
295 Ga0496118_0000040
296 Ga0496118_0049104
297 Ga0496119_0001116
298 Ga0496119_0012808
299 Ga0496120_0000104
300 Ga0496121_0001779
301 Ga0496121_0053585
302 Ga0496122_0001106
303 Ga0496123_0000457
304 Ga0496124_0002877
305 Ga0496124_0007980
306 Ga0496124_0011273
307 Ga0496124_0082859
308 Ga0496125_0000424
309 Ga0496125_0004802
310 Ga0496125_0017253
311 Ga0496125_0162554
312 Ga0496126_0002193
313 Ga0501033_0090520
314 Ga0501036_0156836
315 Ga0501039_0043034
316 Ga0501040_0074894
317 Ga0501042_0035794
318 Ga0501043_0036012
319 Ga0501070_0056841
320 Ga0501071_0076324
321 Ga0501075_0029010
322 Ga0501076_0038613
323 Ga0501077_0004436
324 Ga0501079_0099928
325 Ga0501079_0157650
326 Ga0501080_0054371
327 Ga0501035_0079713
328 nmdc:mga03683_34878_c1
329 nmdc:mga0yw44_4675_c1
330 nmdc:mga0qj67_11312_c1
331 Ga0495601_0041000
332 Ga0500618_000146
333 Ga0500634_0002843
334 Ga0501084_0022998
335 Ga0530510_0011130
336 2599334677
337 2512534330
338 2600194174
339 2643809685
340 2644048399
341 2644063865
342 2644201760
343 2644381387
344 2644415698
345 2644448738
346 2644481201
347 2644500111
348 2644676659
349 2644686868
350 2808971005
351 2809006092
352 2809012972
353 2819552051
354 2842925801
355 2919682019
356 2920828402
357 2941501609
358 2996891353

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00590

TP_methylase

Tetrapyrrole (Corrin/Porphyrin) Methylases

10

197

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
3njr-assembly1.cif.gz_A crystal structure of c-terminal domain of precorrin-6y c5,15-methyltransferase from rhodobacter capsulatus 0.9526 227 412
3njr-assembly1.cif.gz_A crystal structure of c-terminal domain of precorrin-6y c5,15-methyltransferase from rhodobacter capsulatus 0.9476 227 412
3hm2-assembly2.cif.gz_H crystal structure of putative precorrin-6y c5,15-methyltransferase targeted domain from corynebacterium diphtheriae 0.9335 242 413
3hm2-assembly1.cif.gz_D crystal structure of putative precorrin-6y c5,15-methyltransferase targeted domain from corynebacterium diphtheriae 0.9298 242 413
3hm2-assembly2.cif.gz_H crystal structure of putative precorrin-6y c5,15-methyltransferase targeted domain from corynebacterium diphtheriae 0.9282 242 413
ID Description Score Start End Superfamily
af_P9WGA9_216_390_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9806 238 413 3.40.50.150
af_P9WGA9_216_390_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9696 238 413 3.40.50.150
3njrB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9499 227 409 3.40.50.150
af_P9WGA9_1_101_3.40.1010.10 Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain 0.9323 16 116 3.40.1010.10
3njrB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.93 227 409 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A0F5LEH7-F1-model_v4 Precorrin-6Y C5,15-methyltransferase (Decarboxylating) (Precorrin-6Y methyltransferase) 0.9947 14 413 GO:0008276
GO:0009236
GO:0032259
AF-A0A0F5LEH7-F1-model_v4 Precorrin-6Y C5,15-methyltransferase (Decarboxylating) (Precorrin-6Y methyltransferase) 0.9898 14 413 GO:0008276
GO:0009236
GO:0032259
AF-A0A2R7KID8-F1-model_v4 deleted 0.9896 228 381
AF-A0A3S1Q8E7-F1-model_v4 Precorrin-6Y C5,15-methyltransferase (Decarboxylating) subunit CbiT 0.9875 156 321 GO:0008276
GO:0009236
GO:0032259
AF-A0A6V6ZYN5-F1-model_v4 deleted 0.9847 43 412

Map