F277635

General Info

Members Datasets Scaffolds Average Seq Length
181 137 150 268

Family's Representative Sequence

Representative Sequence 3300031731|Ga0307405_10190620|Ga0307405_101906202
Length 287
Sequence MTQTRPAGAAGPNSAESLASETRYVGVSTKMYLGYADSLRWLGGLRSEVDARPALAAGRVVPFVIPSFPMLPAAADILAGSPVLLGAQDCGWADGPWTGEVSPSLLAELGVRIVEIGHAERRRHFGEDDAMIGLKVRAADDAGITPLLCVGEETAGPGSGTGNASETPADAATEAAASFVYGQIEAATGGDWALASRVVIAYEPVWAIGAAEPASAGYVSAVVNQLRARLAVHGLRDLPIIYGGSAKPGLLPTLDGVSGLFLGRFAHDATNFGKVLDEALAVTVAAD

Samples

Sample ID Description Type Environment
1 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
2 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
3 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
4 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
5 2808606368 Microbacterium sp. SLBN-1 Isolate Unclassified
6 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
7 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
8 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
9 2857720070 Microbacterium sp. R-72113 Isolate Unclassified
10 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
11 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
12 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
13 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
14 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
15 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
16 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
17 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
18 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
19 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
20 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
21 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
22 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
23 2945916053 Arthrobacter ulcerisalmonis W1I2 Isolate Rhizosphere
24 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
25 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
26 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
27 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
28 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
29 2984580707 Microbacterium paludicola SORGH_AS919 Isolate Aerial Root
30 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
31 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
32 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
33 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
34 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
35 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
36 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
37 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
38 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
39 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
40 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
41 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
42 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
45 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
48 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
53 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
66 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
68 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
69 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
70 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
71 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
72 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
73 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
74 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
75 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
76 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
77 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
78 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
79 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
80 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
81 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
82 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
83 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
84 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
85 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
86 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
87 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
88 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
89 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
90 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
91 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
92 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
93 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
94 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
95 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
96 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
97 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
98 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
99 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
100 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
101 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
102 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
103 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
104 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
105 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
106 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
107 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
108 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
109 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
110 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
111 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
112 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
113 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
114 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
115 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
116 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
117 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
118 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
119 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
120 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
121 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
122 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
123 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
124 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
125 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
126 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
127 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
128 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
129 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
133 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
134 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
135 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
136 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere
137 8004025490 Arthrobacter wenxiniae AETb3-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.87
Metatranscriptomes 0
Isolates 17.13

Biome Distribution

Category Percentage (%)
Aerial Root 0.55
Bulb 0
Endosphere 2.76
Nodule 0
Rhizoplane 12.71
Rhizosphere 74.59
Stem 0
Stem Tuber 0
Unclassified 9.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1000581 3300000549 Bacteria 5932
2 rootH1_10017997 3300003316 Bacteria 2900
3 rootH2_10050291 3300003320 Bacteria 5362
4 rootL2_10146429 3300003322 Bacteria 2654
5 Ga0055540_1032449 3300003792 Bacteria 1191
6 Ga0070670_100187222 3300005331 Bacteria 1797
7 Ga0070677_10038311 3300005333 Bacteria 1875
8 Ga0070666_10017782 3300005335 Bacteria 4562
9 Ga0070668_100481429 3300005347 Bacteria 1072
10 Ga0070669_100131343 3300005353 Bacteria 1922
11 Ga0070675_100099732 3300005354 Bacteria 2445
12 Ga0070671_100110413 3300005355 Bacteria 2310
13 Ga0070673_100008443 3300005364 Bacteria 6848
14 Ga0070672_100145035 3300005543 Bacteria 1961
15 Ga0075432_10000086 3300006058 Bacteria 19052
16 Ga0105244_10021476 3300009036 Bacteria 3570
17 Ga0105244_10107473 3300009036 Bacteria 1360
18 Ga0105244_10116565 3300009036 Bacteria 1296
19 Ga0105244_10122031 3300009036 Bacteria 1261
20 Ga0105243_10097719 3300009148 Bacteria 2431
21 Ga0105246_10450355 3300011119 Bacteria 1082
22 Ga0157371_10110724 3300013102 Bacteria 1949
23 Ga0157371_10313009 3300013102 Bacteria 1138
24 Ga0157370_10008333 3300013104 Bacteria 11180
25 Ga0157369_10590231 3300013105 Bacteria 1147
26 Ga0163162_10434206 3300013306 Bacteria 1445
27 Ga0163162_10539141 3300013306 Bacteria 1295
28 Ga0157375_10351664 3300013308 Bacteria 1639
29 Ga0157375_10373094 3300013308 Bacteria 1593
30 Ga0209051_1002275 3300025303 Bacteria 14067
31 Ga0207697_10012941 3300025315 Bacteria 3487
32 Ga0207655_1009434 3300025728 Bacteria 6054
33 Ga0207655_1039649 3300025728 Bacteria 2042
34 Ga0207688_10092273 3300025901 Bacteria 1740
35 Ga0207680_10417792 3300025903 Bacteria 949
36 Ga0207645_10003028 3300025907 Bacteria 12964
37 Ga0207643_10356574 3300025908 Bacteria 919
38 Ga0207681_10268468 3300025923 Bacteria 1338
39 Ga0207659_10068407 3300025926 Bacteria 2582
40 Ga0207669_10169743 3300025937 Bacteria 1551
41 Ga0207691_10002705 3300025940 Bacteria 17329
42 Ga0207683_10004075 3300026121 Bacteria 12628
43 Ga0207428_10225143 3300027907 Bacteria 1405
44 Ga0268266_10125264 3300028379 Bacteria 2292
45 Ga0307405_10045361 3300031731 Bacteria 2693
46 Ga0307405_10190620 3300031731 Bacteria 1480
47 Ga0307413_10030507 3300031824 Bacteria 3030
48 Ga0307413_10221555 3300031824 Bacteria 1382
49 Ga0307410_10068141 3300031852 Bacteria 2456
50 Ga0307410_10087304 3300031852 Bacteria 2205
51 Ga0307410_10122385 3300031852 Bacteria 1899
52 Ga0307410_10189408 3300031852 Bacteria 1563
53 Ga0307410_10232460 3300031852 Bacteria 1424
54 Ga0307406_10021044 3300031901 Bacteria 3852
55 Ga0307407_10027586 3300031903 Bacteria 3024
56 Ga0307412_10016918 3300031911 Bacteria 4356
57 Ga0307412_10100394 3300031911 Bacteria 2045
58 Ga0307409_100229623 3300031995 Bacteria 1681
59 Ga0307409_100339520 3300031995 Bacteria 1413
60 Ga0307416_100012216 3300032002 Bacteria 5771
61 Ga0307416_100095520 3300032002 Bacteria 2567
62 Ga0307416_100131931 3300032002 Bacteria 2251
63 Ga0307416_100167479 3300032002 Bacteria 2040
64 Ga0307416_100234029 3300032002 Bacteria 1773
65 Ga0307416_100957360 3300032002 Bacteria 958
66 Ga0307414_10164898 3300032004 Bacteria 1765
67 Ga0307414_10435355 3300032004 Bacteria 1147
68 Ga0307411_10004354 3300032005 Bacteria 6767
69 Ga0307415_100108268 3300032126 Bacteria 2056
70 Ga0395899_0100279 3300037312 Bacteria 2091
71 Ga0395900_0043625 3300037418 Bacteria 4622
72 Ga0395898_0091595 3300037466 Bacteria 2925
73 Ga0395898_0517445 3300037466 Bacteria 1134
74 Ga0395901_0022982 3300038443 Bacteria 6391
75 Ga0395901_0809097 3300038443 Bacteria 925
76 Ga0439436_0003646 3300041404 Bacteria 4693
77 Ga0439465_0013398 3300041413 Bacteria 2558
78 Ga0439433_0000128 3300041999 Bacteria 11104
79 Ga0439442_001069 3300042002 Bacteria 5521
80 Ga0439449_0000948 3300042007 Bacteria 11362
81 Ga0439449_0003937 3300042007 Bacteria 5756
82 Ga0439449_0037439 3300042007 Bacteria 1805
83 Ga0439457_002110 3300042014 Bacteria 5784
84 Ga0439462_0045828 3300042015 Bacteria 1171
85 Ga0495653_0082649 3300046463 Bacteria 2370
86 Ga0495650_0000856 3300046471 Bacteria 36574
87 Ga0495580_0005331 3300046472 Bacteria 10658
88 Ga0495580_0020648 3300046472 Bacteria 4872
89 Ga0495582_0115536 3300046473 Bacteria 1509
90 Ga0495639_0003861 3300046475 Bacteria 6433
91 Ga0495662_0064623 3300046476 Bacteria 1768
92 Ga0495594_0192182 3300046499 Bacteria 1163
93 Ga0495630_0207611 3300046517 Bacteria 1495
94 Ga0495643_0039290 3300046522 Bacteria 2589
95 Ga0495642_0125303 3300046528 Bacteria 1104
96 Ga0495586_0015718 3300046535 Bacteria 4026
97 Ga0495586_0017686 3300046535 Bacteria 3791
98 Ga0495586_0054693 3300046535 Bacteria 2164
99 Ga0495586_0265429 3300046535 Bacteria 981
100 Ga0495587_0054456 3300046536 Bacteria 2357
101 Ga0495645_0185567 3300046543 Bacteria 1421
102 Ga0495633_0158512 3300046558 Bacteria 1044
103 Ga0495667_0038455 3300046559 Bacteria 3185
104 Ga0495656_0033423 3300046615 Bacteria 2099
105 Ga0495668_0185210 3300046616 Bacteria 1140
106 Ga0495588_0006494 3300046674 Bacteria 5271
107 Ga0495588_0035545 3300046674 Bacteria 2525
108 Ga0495588_0067944 3300046674 Bacteria 1850
109 Ga0495657_0210490 3300046675 Bacteria 1182
110 Ga0495670_0018372 3300046691 Bacteria 3442
111 Ga0495581_0011514 3300047315 Bacteria 5117
112 Ga0495581_0058443 3300047315 Bacteria 2227
113 Ga0495581_0116063 3300047315 Bacteria 1557
114 Ga0495581_0144248 3300047315 Bacteria 1389
115 Ga0495604_0179566 3300047317 Bacteria 1482
116 Ga0495636_0003037 3300047318 Bacteria 6501
117 Ga0495636_0264544 3300047318 Bacteria 798
118 Ga0495680_0272813 3300047322 Bacteria 1194
119 Ga0495675_0026716 3300047444 Bacteria 3680
120 Ga0496100_0141934 3300048903 Bacteria 1703
121 Ga0496100_0181011 3300048903 Bacteria 1524
122 Ga0496101_0141706 3300048904 Bacteria 1832
123 Ga0496102_0161662 3300048905 Bacteria 2106
124 Ga0496103_0052148 3300048906 Bacteria 2533
125 Ga0496104_0362132 3300048907 Bacteria 1362
126 Ga0496105_0067972 3300048908 Bacteria 2942
127 Ga0496106_0117620 3300048909 Bacteria 2074
128 Ga0496106_0152182 3300048909 Bacteria 1825
129 Ga0496107_0040567 3300048910 Bacteria 3342
130 Ga0496107_0166901 3300048910 Bacteria 1632
131 Ga0496107_0263844 3300048910 Bacteria 1281
132 Ga0496108_0594346 3300048911 Bacteria 964
133 Ga0496109_0047694 3300048912 Bacteria 3895
134 Ga0496109_0297887 3300048912 Bacteria 1521
135 Ga0496110_0177708 3300048913 Bacteria 1932
136 Ga0496110_0259234 3300048913 Bacteria 1583
137 Ga0496111_0008479 3300048914 Bacteria 6806
138 Ga0496111_0180598 3300048914 Bacteria 1568
139 Ga0496111_0242677 3300048914 Bacteria 1337
140 Ga0496112_0040880 3300048915 Bacteria 4535
141 Ga0496112_0403626 3300048915 Bacteria 1306
142 Ga0496114_0123322 3300048917 Bacteria 2230
143 Ga0496125_0124245 3300048928 Bacteria 1833
144 Ga0501032_0004511 3300049569 Bacteria 10478
145 Ga0501034_0000112 3300049571 Bacteria 150146
146 Ga0501038_0346390 3300049574 Bacteria 1158
147 Ga0501043_0120380 3300049579 Bacteria 2058
148 Ga0500650_0028201 3300053098 Bacteria 2532
149 Ga0500573_0086076 3300053140 Bacteria 1781
150 Ga0500577_0043412 3300053142 Bacteria 1651

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047444 Ga0495675_0026716 Ga0495675_0026716_11_709 222
2 3300046472 Ga0495580_0005331 Ga0495580_0005331_1198_1893 231
3 3300009036 Ga0105244_10021476 Ga0105244_100214762 239
4 3300025901 Ga0207688_10092273 Ga0207688_100922732 239
5 3300046535 Ga0495586_0265429 Ga0495586_0265429_10_729 239
6 3300013102 Ga0157371_10110724 Ga0157371_101107242 240
7 3300013104 Ga0157370_10008333 Ga0157370_100083338 240
8 3300041404 Ga0439436_0003646 Ga0439436_0003646_56_832 240
9 3300041413 Ga0439465_0013398 Ga0439465_0013398_644_1420 240
10 3300041999 Ga0439433_0000128 Ga0439433_0000128_7965_8741 240
11 3300042002 Ga0439442_001069 Ga0439442_001069_3098_3874 240
12 3300042007 Ga0439449_0000948 Ga0439449_0000948_5174_5950 240
13 3300042014 Ga0439457_002110 Ga0439457_002110_2426_3202 240
14 3300042015 Ga0439462_0045828 Ga0439462_0045828_152_928 240
15 3300047318 Ga0495636_0264544 Ga0495636_0264544_23_754 240
16 3300032002 Ga0307416_100957360 Ga0307416_1009573601 242
17 3300053140 Ga0500573_0086076 Ga0500573_0086076_510_1256 244
18 3300048915 Ga0496112_0040880 Ga0496112_0040880_1936_2715 245
19 iso_pu_bacteria 2808606368 2808883878 245
20 iso_pu_bacteria 2984580707 2984583452 245
21 3300038443 Ga0395901_0809097 Ga0395901_0809097_17_760 247
22 3300046675 Ga0495657_0210490 Ga0495657_0210490_26_799 247
23 3300006058 Ga0075432_10000086 Ga0075432_1000008613 248
24 3300009036 Ga0105244_10116565 Ga0105244_101165652 248
25 iso_pu_bacteria 2808606370 2808891423 248
26 3300053098 Ga0500650_0028201 Ga0500650_0028201_58_846 249
27 3300053142 Ga0500577_0043412 Ga0500577_0043412_486_1283 249
28 iso_pu_bacteria 8004025490 8004026838 249
29 iso_pu_bacteria 2904776348 2904778292 250
30 iso_pu_bacteria 2808606360 2808851262 251
31 iso_pu_bacteria 2857740372 2857740752 251
32 3300031852 Ga0307410_10068141 Ga0307410_100681412 252
33 3300031852 Ga0307410_10189408 Ga0307410_101894082 252
34 3300031901 Ga0307406_10021044 Ga0307406_100210442 252
35 3300031903 Ga0307407_10027586 Ga0307407_100275862 252
36 3300031911 Ga0307412_10016918 Ga0307412_100169182 252
37 3300032002 Ga0307416_100012216 Ga0307416_1000122162 252
38 3300032002 Ga0307416_100095520 Ga0307416_1000955202 252
39 3300032005 Ga0307411_10004354 Ga0307411_100043544 252
40 iso_pu_bacteria 2775506735 2775658473 252
41 iso_pu_bacteria 2808606357 2808830086 252
42 iso_pu_bacteria 2808606366 2808876213 252
43 iso_pu_bacteria 2808606371 2808897715 252
44 iso_pu_bacteria 2811994871 2812318138 252
45 iso_pu_bacteria 2933418574 2933418697 252
46 iso_pu_bacteria 2945916053 2945920236 252
47 iso_pu_bacteria 2946059875 2946063953 252
48 3300046471 Ga0495650_0000856 Ga0495650_0000856_22327_23124 253
49 iso_pu_bacteria 2910809715 2910813608 253
50 iso_pu_bacteria 2939598168 2939599390 253
51 iso_pu_bacteria 8004021418 8004025276 253
52 3300003792 Ga0055540_1032449 Ga0055540_10324492 254
53 3300031995 Ga0307409_100339520 Ga0307409_1003395203 255
54 iso_pu_bacteria 2919538618 2919539158 255
55 3300013105 Ga0157369_10590231 Ga0157369_105902311 256
56 3300037312 Ga0395899_0100279 Ga0395899_0100279_568_1377 256
57 3300038443 Ga0395901_0022982 Ga0395901_0022982_2852_3667 256
58 3300042007 Ga0439449_0037439 Ga0439449_0037439_289_1149 256
59 3300046535 Ga0495586_0054693 Ga0495586_0054693_332_1147 256
60 iso_pu_bacteria 2919034639 2919035649 256
61 iso_pu_bacteria 2939647034 2939650126 256
62 3300031995 Ga0307409_100229623 Ga0307409_1002296232 257
63 3300032002 Ga0307416_100234029 Ga0307416_1002340292 257
64 3300049569 Ga0501032_0004511 Ga0501032_0004511_3080_3853 257
65 3300049571 Ga0501034_0000112 Ga0501034_0000112_137095_137868 257
66 3300049574 Ga0501038_0346390 Ga0501038_0346390_372_1145 257
67 iso_pu_bacteria 2919391150 2919394017 257
68 iso_pu_bacteria 2945956166 2945957425 257
69 iso_pu_bacteria 2919059106 2919060349 258
70 iso_pu_bacteria 2946037020 2946038825 258
71 3300009036 Ga0105244_10122031 Ga0105244_101220312 259
72 3300013306 Ga0163162_10539141 Ga0163162_105391411 259
73 3300013308 Ga0157375_10351664 Ga0157375_103516641 259
74 3300025303 Ga0209051_1002275 Ga0209051_10022757 259
75 3300025728 Ga0207655_1009434 Ga0207655_10094347 259
76 3300031852 Ga0307410_10087304 Ga0307410_100873042 259
77 3300048903 Ga0496100_0181011 Ga0496100_0181011_455_1234 259
78 3300048904 Ga0496101_0141706 Ga0496101_0141706_254_1033 259
79 3300048906 Ga0496103_0052148 Ga0496103_0052148_794_1573 259
80 3300048913 Ga0496110_0259234 Ga0496110_0259234_762_1541 259
81 3300048914 Ga0496111_0008479 Ga0496111_0008479_4755_5534 259
82 iso_pu_bacteria 2857720070 2857721790 259
83 iso_pu_bacteria 2945920336 2945920927 259
84 iso_pu_bacteria 2953998280 2954000087 259
85 3300009148 Ga0105243_10097719 Ga0105243_100977191 260
86 3300037466 Ga0395898_0091595 Ga0395898_0091595_48_836 260
87 iso_pu_bacteria 2904497146 2904499201 260
88 3300003316 rootH1_10017997 rootH1_100179972 261
89 3300003320 rootH2_10050291 rootH2_100502913 261
90 3300003322 rootL2_10146429 rootL2_101464293 261
91 3300005331 Ga0070670_100187222 Ga0070670_1001872222 261
92 3300005333 Ga0070677_10038311 Ga0070677_100383111 261
93 3300005335 Ga0070666_10017782 Ga0070666_100177822 261
94 3300005347 Ga0070668_100481429 Ga0070668_1004814291 261
95 3300005353 Ga0070669_100131343 Ga0070669_1001313432 261
96 3300005354 Ga0070675_100099732 Ga0070675_1000997321 261
97 3300005355 Ga0070671_100110413 Ga0070671_1001104132 261
98 3300005364 Ga0070673_100008443 Ga0070673_1000084431 261
99 3300005543 Ga0070672_100145035 Ga0070672_1001450351 261
100 3300009036 Ga0105244_10107473 Ga0105244_101074731 261
101 3300011119 Ga0105246_10450355 Ga0105246_104503551 261
102 3300013102 Ga0157371_10313009 Ga0157371_103130091 261
103 3300013306 Ga0163162_10434206 Ga0163162_104342062 261
104 3300013308 Ga0157375_10373094 Ga0157375_103730942 261
105 3300025315 Ga0207697_10012941 Ga0207697_100129413 261
106 3300025728 Ga0207655_1039649 Ga0207655_10396491 261
107 3300025903 Ga0207680_10417792 Ga0207680_104177921 261
108 3300025907 Ga0207645_10003028 Ga0207645_1000302811 261
109 3300025908 Ga0207643_10356574 Ga0207643_103565741 261
110 3300025923 Ga0207681_10268468 Ga0207681_102684682 261
111 3300025926 Ga0207659_10068407 Ga0207659_100684072 261
112 3300025937 Ga0207669_10169743 Ga0207669_101697431 261
113 3300025940 Ga0207691_10002705 Ga0207691_100027051 261
114 3300026121 Ga0207683_10004075 Ga0207683_100040752 261
115 3300027907 Ga0207428_10225143 Ga0207428_102251431 261
116 3300028379 Ga0268266_10125264 Ga0268266_101252642 261
117 3300031731 Ga0307405_10045361 Ga0307405_100453612 261
118 3300031824 Ga0307413_10030507 Ga0307413_100305072 261
119 3300031824 Ga0307413_10221555 Ga0307413_102215552 261
120 3300031852 Ga0307410_10122385 Ga0307410_101223851 261
121 3300031852 Ga0307410_10232460 Ga0307410_102324602 261
122 3300032002 Ga0307416_100131931 Ga0307416_1001319312 261
123 3300032002 Ga0307416_100167479 Ga0307416_1001674792 261
124 3300032004 Ga0307414_10164898 Ga0307414_101648982 261
125 3300032004 Ga0307414_10435355 Ga0307414_104353552 261
126 3300032126 Ga0307415_100108268 Ga0307415_1001082682 261
127 3300037418 Ga0395900_0043625 Ga0395900_0043625_2970_3800 261
128 3300037466 Ga0395898_0517445 Ga0395898_0517445_57_887 261
129 3300046463 Ga0495653_0082649 Ga0495653_0082649_873_1688 261
130 3300046472 Ga0495580_0020648 Ga0495580_0020648_1102_1932 261
131 3300046473 Ga0495582_0115536 Ga0495582_0115536_61_876 261
132 3300046475 Ga0495639_0003861 Ga0495639_0003861_3911_4741 261
133 3300046476 Ga0495662_0064623 Ga0495662_0064623_261_1076 261
134 3300046499 Ga0495594_0192182 Ga0495594_0192182_61_876 261
135 3300046517 Ga0495630_0207611 Ga0495630_0207611_339_1154 261
136 3300046522 Ga0495643_0039290 Ga0495643_0039290_1500_2327 261
137 3300046528 Ga0495642_0125303 Ga0495642_0125303_231_1058 261
138 3300046535 Ga0495586_0015718 Ga0495586_0015718_263_1093 261
139 3300046535 Ga0495586_0017686 Ga0495586_0017686_1950_2765 261
140 3300046536 Ga0495587_0054456 Ga0495587_0054456_1309_2124 261
141 3300046543 Ga0495645_0185567 Ga0495645_0185567_452_1267 261
142 3300046558 Ga0495633_0158512 Ga0495633_0158512_74_907 261
143 3300046559 Ga0495667_0038455 Ga0495667_0038455_1943_2758 261
144 3300046615 Ga0495656_0033423 Ga0495656_0033423_476_1303 261
145 3300046616 Ga0495668_0185210 Ga0495668_0185210_46_873 261
146 3300046674 Ga0495588_0006494 Ga0495588_0006494_3279_4136 261
147 3300046674 Ga0495588_0035545 Ga0495588_0035545_1065_1898 261
148 3300046674 Ga0495588_0067944 Ga0495588_0067944_891_1685 261
149 3300046691 Ga0495670_0018372 Ga0495670_0018372_189_1022 261
150 3300047315 Ga0495581_0011514 Ga0495581_0011514_2171_3001 261
151 3300047315 Ga0495581_0058443 Ga0495581_0058443_133_960 261
152 3300047315 Ga0495581_0116063 Ga0495581_0116063_681_1532 261
153 3300047315 Ga0495581_0144248 Ga0495581_0144248_262_1077 261
154 3300047317 Ga0495604_0179566 Ga0495604_0179566_139_954 261
155 3300047318 Ga0495636_0003037 Ga0495636_0003037_328_1161 261
156 3300047322 Ga0495680_0272813 Ga0495680_0272813_67_882 261
157 3300048903 Ga0496100_0141934 Ga0496100_0141934_363_1190 261
158 3300048905 Ga0496102_0161662 Ga0496102_0161662_163_990 261
159 3300048907 Ga0496104_0362132 Ga0496104_0362132_384_1211 261
160 3300048908 Ga0496105_0067972 Ga0496105_0067972_1616_2443 261
161 3300048909 Ga0496106_0117620 Ga0496106_0117620_409_1236 261
162 3300048909 Ga0496106_0152182 Ga0496106_0152182_985_1812 261
163 3300048910 Ga0496107_0040567 Ga0496107_0040567_226_1068 261
164 3300048910 Ga0496107_0166901 Ga0496107_0166901_256_1083 261
165 3300048910 Ga0496107_0263844 Ga0496107_0263844_161_988 261
166 3300048911 Ga0496108_0594346 Ga0496108_0594346_95_922 261
167 3300048912 Ga0496109_0047694 Ga0496109_0047694_2660_3493 261
168 3300048912 Ga0496109_0297887 Ga0496109_0297887_300_1142 261
169 3300048913 Ga0496110_0177708 Ga0496110_0177708_431_1258 261
170 3300048914 Ga0496111_0180598 Ga0496111_0180598_67_894 261
171 3300048914 Ga0496111_0242677 Ga0496111_0242677_129_956 261
172 3300048915 Ga0496112_0403626 Ga0496112_0403626_413_1240 261
173 3300048917 Ga0496114_0123322 Ga0496114_0123322_503_1330 261
174 3300048928 Ga0496125_0124245 Ga0496125_0124245_20_847 261
175 3300049579 Ga0501043_0120380 Ga0501043_0120380_791_1612 261
176 iso_pu_bacteria 2932426870 2932427739 261
177 iso_pu_bacteria 2939674588 2939677610 261
178 3300031731 Ga0307405_10190620 Ga0307405_101906202 263
179 3300031911 Ga0307412_10100394 Ga0307412_101003942 263
180 3300042007 Ga0439449_0003937 Ga0439449_0003937_1377_2231 263
181 3300000549 LJQas_1000581 LJQas_10005816 271

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00121

TIM

Triosephosphate isomerase

23

279

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
1aw1-assembly1.cif.gz_A triosephosphate isomerase of vibrio marinus complexed with 2-phosphoglycolate 0.9073 23 270
1tmh-assembly2.cif.gz_D modular mutagenesis of a tim-barrel enzyme: the crystal structure of a chimeric e. coli tim having the eighth (beta-alpha)-unit replaced by the equivalent unit of chicken tim 0.9029 22 269
4y96-assembly1.cif.gz_A crystal structure of triosephosphate isomerase from gemmata obscuriglobus 0.8994 22 265
2btm-assembly1.cif.gz_B does the his12-lys13 pair play a role in the adaptation of thermophilic tims to high temperatures? 0.8975 23 265
1btm-assembly1.cif.gz_B triosephosphate isomerase (tim) complexed with 2-phosphoglycolic acid 0.8964 23 265
ID Description Score Start End Superfamily
af_P0A858_1_255_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9095 22 265 3.20.20.70
4y96A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8994 22 265 3.20.20.70
af_P17751_41_299_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8882 66 263 3.20.20.70
3taoB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8879 22 265 3.20.20.70
6bveB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8878 22 262 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A1E5KDV6-F1-model_v4 deleted 0.9872 32 270
AF-A0A1D9FAQ1-F1-model_v4 deleted 0.987 21 270
AF-A0A328LDD9-F1-model_v4 deleted 0.984 21 268
AF-A0A1E5KDV6-F1-model_v4 deleted 0.9831 32 270
AF-A0A0K2RFZ9-F1-model_v4 Triosephosphate isomerase (EC 5.3.1.1) 0.9818 143 268 GO:0004807
GO:0005829
GO:0006094
GO:0006096
GO:0019563
GO:0046166

Feature Viewer

pLDDT pTM Quality
89.97 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map