F278397
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 182 | 109 | 364 | 328 |
Family's Representative Sequence
| Representative Sequence | 3300003322|rootL2_10118208|rootL2_101182083 |
| Length | 353 |
| Sequence | MDCDKTKLMTRDIFCFTKRTVMCLRKGLYTGLLIMAGLRAGAQQNVQFSQYVFNGLSVNPAYAGYKDAWYLNTIYRKQWTGFPGAPVTGGVSYDGPFRPLKTGAGIGLGVQLMADMVGPQKSYSLYGSYAYRIPLDAEQTRRLSFGLAVGVTQYHLEGNTLAYFDSDDPVFPGGSVNAYTPDARFGIYYSSPSFYAGLSVMDLFSRYTSTKYAWKGFNYQNIRKSQHIYLTTGVMLPLSEHLQLKPSLMIKDDFKGPTNLDVNAMLLIDRVFWIGGSFRTAVPVWKKQLPNGLESLNAASAIVEYYIGGKWRIGYAYDLNINELAGTQGGSHEISIGILFPQKKFSTSSPRYF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 6 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 7 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 8 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 9 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 10 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 11 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 12 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 13 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 14 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 15 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 16 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 17 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 18 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 22 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 23 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 24 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 25 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 26 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 27 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 28 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 29 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 30 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 31 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 32 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 33 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 34 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 35 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 36 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 37 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 38 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 39 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 40 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 41 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 42 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 43 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 44 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 45 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 46 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 47 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 48 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 51 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 52 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 53 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 54 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 55 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 56 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 57 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 58 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 59 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 60 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 61 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 62 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 63 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 64 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 65 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 66 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 67 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 68 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 69 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 70 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 71 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 72 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 73 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 74 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 75 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 76 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 77 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 78 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 79 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 80 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 81 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 82 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 83 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 84 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 85 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 86 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 87 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 88 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 89 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 90 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 91 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 92 | 2738541284 | Pedobacter sp. YR016 | Isolate | Unclassified |
| 93 | 2738541302 | Pedobacter sp. CF074 | Isolate | Unclassified |
| 94 | 2738543023 | Pedobacter sp. OK628 | Isolate | Unclassified |
| 95 | 2818991442 | Chitinophaga pinensis 1204 | Isolate | Unclassified |
| 96 | 2818991444 | Filimonas endophytica 3197 | Isolate | Unclassified |
| 97 | 2821136567 | Chitinophaga sancti 1232 | Isolate | Unclassified |
| 98 | 2842903701 | Olivibacter sp. R-72191 | Isolate | Unclassified |
| 99 | 2883068021 | Chitinophaga rhizosphaerae T16R-86 | Isolate | Rhizosphere |
| 100 | 2884791551 | Chitinophaga oryzae 1310 | Isolate | Unclassified |
| 101 | 2896109856 | Chitinophaga sp. SYP-B3965 | Isolate | Rhizosphere |
| 102 | 2898713307 | Sphingobacterium sp. SGG-5 | Isolate | Rhizosphere |
| 103 | 2904467357 | Chitinophaga sancti 3198 | Isolate | Unclassified |
| 104 | 2919186247 | Pedobacter africanus 2697 | Isolate | Rhizosphere |
| 105 | 2929239360 | Chitinophaga sp. R-73072 Hybrid assembly | Isolate | Unclassified |
| 106 | 2929921140 | Chitinophaga sp. R-72609 Hybrid assembly | Isolate | Unclassified |
| 107 | 2939664404 | Pedobacter africanus 2990 | Isolate | Rhizosphere |
| 108 | 8003151029 | Chitinophaga sp. GbtcB8 | Isolate | Unclassified |
| 109 | 8055588893 | Parapedobacter lycopersici KACC 18788 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 85.71 |
| Metatranscriptomes | 0 |
| Isolates | 14.29 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 29.67 |
| Nodule | 0 |
| Rhizoplane | 1.1 |
| Rhizosphere | 43.96 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.54 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootL2_10118208 | 3300003322 | Bacteria | 6822 |
| 2 | JGI24740J21852_10008543 | 3300001979 | Unclassified | 4073 |
| 3 | JGI24740J21852_10027610 | 3300001979 | Unclassified | 1887 |
| 4 | JGI24739J22299_10001259 | 3300001989 | Bacteria | 9498 |
| 5 | JGI24737J22298_10004921 | 3300001990 | Bacteria | 4630 |
| 6 | JGI24735J21928_10010408 | 3300002067 | Bacteria | 2966 |
| 7 | JGI25154J39366_1000016 | 3300002738 | Bacteria | 255057 |
| 8 | JGI25158J39367_1007213 | 3300002739 | Unclassified | 1572 |
| 9 | JGI25153J46596_10025644 | 3300003215 | Bacteria | 2102 |
| 10 | rootH1_10024077 | 3300003316 | Bacteria | 5910 |
| 11 | rootH1_10053174 | 3300003316 | Bacteria | 1134 |
| 12 | rootH1_10110545 | 3300003316 | Bacteria | 2445 |
| 13 | rootH2_10006701 | 3300003320 | Bacteria | 5410 |
| 14 | rootH2_10033339 | 3300003320 | Bacteria | 6494 |
| 15 | rootH2_10054169 | 3300003320 | Bacteria | 16718 |
| 16 | rootH2_10069919 | 3300003320 | Bacteria | 2730 |
| 17 | rootH2_10149759 | 3300003320 | Bacteria | 4111 |
| 18 | rootH2_10322424 | 3300003320 | Bacteria | 3020 |
| 19 | rootL2_10003563 | 3300003322 | Bacteria | 5436 |
| 20 | rootL2_10086609 | 3300003322 | Bacteria | 3778 |
| 21 | rootL2_10122408 | 3300003322 | Bacteria | 9314 |
| 22 | rootL2_10139276 | 3300003322 | Bacteria | 7755 |
| 23 | rootH1_10014052 | 3300003323 | Bacteria | 12146 |
| 24 | rootH1_10043620 | 3300003323 | Unclassified | 4281 |
| 25 | rootH1_10127793 | 3300003323 | Bacteria | 1908 |
| 26 | rootH1_10180623 | 3300003323 | Bacteria | 9613 |
| 27 | rootH1_10199997 | 3300003323 | Bacteria | 4402 |
| 28 | rootH1_10346144 | 3300003323 | Bacteria | 2799 |
| 29 | JGI25160J50197_1003636 | 3300003354 | Bacteria | 6843 |
| 30 | JGI25160J50197_1004098 | 3300003354 | Bacteria | 6350 |
| 31 | JGI25160J50197_1008342 | 3300003354 | Bacteria | 3954 |
| 32 | Ga0055535_1009466 | 3300003761 | Bacteria | 1678 |
| 33 | Ga0055542_1003367 | 3300003762 | Bacteria | 4385 |
| 34 | Ga0055528_1004005 | 3300003790 | Bacteria | 7206 |
| 35 | Ga0055528_1012644 | 3300003790 | Bacteria | 3260 |
| 36 | Ga0055531_10000055 | 3300003794 | Bacteria | 123621 |
| 37 | Ga0065165_1005464 | 3300005262 | Bacteria | 7120 |
| 38 | Ga0065165_1025931 | 3300005262 | Bacteria | 1937 |
| 39 | Ga0065714_10070923 | 3300005288 | Bacteria | 3727 |
| 40 | Ga0065714_10090261 | 3300005288 | Bacteria | 1950 |
| 41 | Ga0065704_10088996 | 3300005289 | Bacteria | 2893 |
| 42 | Ga0070659_100026097 | 3300005366 | Unclassified | 4493 |
| 43 | Ga0068857_100309403 | 3300005577 | Unclassified | 1457 |
| 44 | Ga0075366_10000682 | 3300006195 | Bacteria | 16076 |
| 45 | Ga0075370_10037734 | 3300006353 | Bacteria | 2717 |
| 46 | Ga0105239_10000002 | 3300010375 | Bacteria | 610298 |
| 47 | Ga0157373_10000328 | 3300013100 | Bacteria | 38459 |
| 48 | Ga0157373_10003657 | 3300013100 | Bacteria | 11622 |
| 49 | Ga0157373_10131216 | 3300013100 | Bacteria | 1762 |
| 50 | Ga0157371_10000315 | 3300013102 | Bacteria | 62944 |
| 51 | Ga0157371_10006015 | 3300013102 | Bacteria | 10110 |
| 52 | Ga0157370_10006800 | 3300013104 | Bacteria | 12539 |
| 53 | Ga0157370_10007275 | 3300013104 | Bacteria | 12080 |
| 54 | Ga0157370_10043507 | 3300013104 | Bacteria | 4321 |
| 55 | Ga0157370_10180066 | 3300013104 | Bacteria | 1964 |
| 56 | Ga0157369_10133943 | 3300013105 | Unclassified | 2624 |
| 57 | Ga0163162_10027531 | 3300013306 | Bacteria | 5621 |
| 58 | Ga0157372_10000186 | 3300013307 | Bacteria | 68701 |
| 59 | Ga0157372_10001960 | 3300013307 | Bacteria | 22372 |
| 60 | Ga0157375_10089147 | 3300013308 | Bacteria | 3140 |
| 61 | Ga0182008_10000731 | 3300014497 | Bacteria | 23325 |
| 62 | Ga0182005_1000179 | 3300015265 | Bacteria | 43636 |
| 63 | Ga0182005_1001059 | 3300015265 | Bacteria | 11641 |
| 64 | Ga0163161_10000649 | 3300017792 | Bacteria | 27745 |
| 65 | Ga0209436_100987 | 3300025208 | Bacteria | 10969 |
| 66 | Ga0209436_101393 | 3300025208 | Bacteria | 8530 |
| 67 | Ga0209436_101697 | 3300025208 | Bacteria | 7257 |
| 68 | Ga0209258_100151 | 3300025242 | Bacteria | 160444 |
| 69 | Ga0209646_1000003 | 3300025246 | Bacteria | 1160860 |
| 70 | Ga0209026_1000333 | 3300025250 | Bacteria | 45722 |
| 71 | Ga0209026_1000361 | 3300025250 | Bacteria | 42722 |
| 72 | Ga0209148_1000154 | 3300025254 | Bacteria | 145214 |
| 73 | Ga0209673_1000014 | 3300025273 | Bacteria | 537082 |
| 74 | Ga0209673_1000018 | 3300025273 | Bacteria | 458281 |
| 75 | Ga0209673_1000166 | 3300025273 | Bacteria | 135260 |
| 76 | Ga0209673_1040454 | 3300025273 | Bacteria | 1333 |
| 77 | Ga0209130_1002088 | 3300025284 | Bacteria | 10734 |
| 78 | Ga0209564_1001302 | 3300025295 | Bacteria | 26894 |
| 79 | Ga0209564_1003917 | 3300025295 | Bacteria | 9528 |
| 80 | Ga0209564_1010106 | 3300025295 | Bacteria | 4392 |
| 81 | Ga0209564_1014550 | 3300025295 | Bacteria | 3265 |
| 82 | Ga0209758_1000465 | 3300025297 | Bacteria | 67058 |
| 83 | Ga0209758_1004938 | 3300025297 | Bacteria | 10707 |
| 84 | Ga0209758_1009092 | 3300025297 | Bacteria | 6265 |
| 85 | Ga0209050_1017716 | 3300025298 | Bacteria | 2817 |
| 86 | Ga0207426_1000216 | 3300025302 | Bacteria | 136337 |
| 87 | Ga0207426_1000277 | 3300025302 | Bacteria | 106036 |
| 88 | Ga0207426_1004084 | 3300025302 | Bacteria | 7362 |
| 89 | Ga0207426_1016286 | 3300025302 | Unclassified | 2674 |
| 90 | Ga0209051_1014153 | 3300025303 | Bacteria | 3739 |
| 91 | Ga0209257_1000025 | 3300025304 | Bacteria | 724838 |
| 92 | Ga0207647_10000030 | 3300025904 | Bacteria | 106974 |
| 93 | Ga0207690_10029003 | 3300025932 | Unclassified | 3514 |
| 94 | Ga0307515_10213833 | 3300028794 | Bacteria | 1765 |
| 95 | Ga0265338_10107045 | 3300028800 | Bacteria | 2262 |
| 96 | Ga0316177_1141088 | 3300030731 | Bacteria | 11308 |
| 97 | Ga0316176_1073963 | 3300030732 | Bacteria | 5544 |
| 98 | Ga0316176_1160749 | 3300030732 | Bacteria | 4558 |
| 99 | Ga0316183_1009917 | 3300030742 | Bacteria | 46001 |
| 100 | Ga0316183_1019028 | 3300030742 | Bacteria | 6947 |
| 101 | Ga0316183_1111136 | 3300030742 | Bacteria | 32649 |
| 102 | Ga0316181_1148979 | 3300030744 | Bacteria | 13161 |
| 103 | Ga0316181_1158951 | 3300030744 | Bacteria | 1816 |
| 104 | Ga0316182_1191260 | 3300030745 | Unclassified | 2861 |
| 105 | Ga0265327_10000090 | 3300031251 | Bacteria | 197158 |
| 106 | Ga0265327_10147053 | 3300031251 | Unclassified | 1097 |
| 107 | Ga0307408_100000974 | 3300031548 | Bacteria | 22170 |
| 108 | Ga0307408_100001775 | 3300031548 | Bacteria | 15744 |
| 109 | Ga0307408_100002139 | 3300031548 | Bacteria | 14161 |
| 110 | Ga0307408_100005632 | 3300031548 | Bacteria | 8375 |
| 111 | Ga0307412_10001402 | 3300031911 | Bacteria | 13396 |
| 112 | Ga0307416_100176850 | 3300032002 | Bacteria | 1995 |
| 113 | Ga0307414_10006638 | 3300032004 | Bacteria | 6469 |
| 114 | Ga0307414_10009023 | 3300032004 | Bacteria | 5703 |
| 115 | Ga0307414_10342127 | 3300032004 | Unclassified | 1281 |
| 116 | Ga0466972_0000001 | 3300044658 | Bacteria | 412457 |
| 117 | Ga0466972_0000026 | 3300044658 | Bacteria | 184739 |
| 118 | Ga0466972_0000046 | 3300044658 | Bacteria | 127926 |
| 119 | Ga0466972_0096153 | 3300044658 | Bacteria | 1403 |
| 120 | Ga0453683_0004027 | 3300044673 | Bacteria | 10598 |
| 121 | Ga0466970_0000335 | 3300044765 | Bacteria | 22998 |
| 122 | Ga0466970_0000422 | 3300044765 | Bacteria | 20695 |
| 123 | Ga0466970_0000579 | 3300044765 | Bacteria | 17895 |
| 124 | Ga0451576_0009814 | 3300045051 | Bacteria | 11063 |
| 125 | Ga0495627_014423 | 3300046453 | Bacteria | 2757 |
| 126 | Ga0495644_0043583 | 3300046523 | Unclassified | 1688 |
| 127 | Ga0495633_0000383 | 3300046558 | Bacteria | 46815 |
| 128 | Ga0495633_0000561 | 3300046558 | Bacteria | 36426 |
| 129 | Ga0495633_0001141 | 3300046558 | Bacteria | 21334 |
| 130 | Ga0495633_0016799 | 3300046558 | Bacteria | 3760 |
| 131 | Ga0495677_0049341 | 3300047445 | Unclassified | 1547 |
| 132 | Ga0495685_012780 | 3300047447 | Unclassified | 2844 |
| 133 | Ga0495686_0003019 | 3300047472 | Bacteria | 14949 |
| 134 | Ga0496101_0111480 | 3300048904 | Bacteria | 2060 |
| 135 | Ga0496114_0044858 | 3300048917 | Unclassified | 3670 |
| 136 | Ga0496121_0000028 | 3300048924 | Bacteria | 439193 |
| 137 | Ga0496121_0004873 | 3300048924 | Bacteria | 17625 |
| 138 | Ga0496124_0126333 | 3300048927 | Unclassified | 2037 |
| 139 | Ga0496126_0010104 | 3300048929 | Bacteria | 9955 |
| 140 | Ga0501238_009609 | 3300049671 | Unclassified | 1283 |
| 141 | nmdc:mga0k408_1109_c1 | 3300050493 | Bacteria | 14749 |
| 142 | nmdc:mga07m45_22022_c1 | 3300050496 | Bacteria | 3477 |
| 143 | Ga0500635_0002352 | 3300053080 | Unclassified | 4669 |
| 144 | Ga0500644_0000283 | 3300053088 | Bacteria | 28078 |
| 145 | Ga0500651_0076905 | 3300053093 | Unclassified | 2072 |
| 146 | Ga0500651_0121072 | 3300053093 | Bacteria | 1589 |
| 147 | Ga0500562_000030 | 3300053108 | Bacteria | 92407 |
| 148 | Ga0500569_021059 | 3300053109 | Bacteria | 1719 |
| 149 | Ga0500658_0057806 | 3300053134 | Bacteria | 1604 |
| 150 | Ga0500577_0000888 | 3300053142 | Bacteria | 7733 |
| 151 | Ga0500616_0040614 | 3300053153 | Bacteria | 2502 |
| 152 | Ga0500622_0000132 | 3300053156 | Bacteria | 78669 |
| 153 | Ga0500622_0001995 | 3300053156 | Bacteria | 15284 |
| 154 | Ga0500633_0071685 | 3300053160 | Unclassified | 1238 |
| 155 | Ga0500636_0118164 | 3300053177 | Bacteria | 1490 |
| 156 | Ga0500645_006201 | 3300053730 | Bacteria | 4293 |
| 157 | 2738764372 | 2738541284 | Bacteria | 5199923 |
| 158 | 2738855094 | 2738541302 | Bacteria | 5944758 |
| 159 | 2739305047 | 2738543023 | Bacteria | 6767879 |
| 160 | 2819572277 | 2818991442 | Bacteria | 8318214 |
| 161 | 2819572700 | 2818991442 | Bacteria | 8318214 |
| 162 | 2819591015 | 2818991444 | Bacteria | 6968812 |
| 163 | 2821139895 | 2821136567 | Bacteria | 8080116 |
| 164 | 2821140360 | 2821136567 | Bacteria | 8080116 |
| 165 | 2842909102 | 2842903701 | Bacteria | 6986368 |
| 166 | 2842909497 | 2842903701 | Bacteria | 6986368 |
| 167 | 2883072370 | 2883068021 | Bacteria | 6192739 |
| 168 | 2884794229 | 2884791551 | Bacteria | 8511252 |
| 169 | 2884796230 | 2884791551 | Bacteria | 8511252 |
| 170 | 2896110123 | 2896109856 | Bacteria | 7140722 |
| 171 | 2896114360 | 2896109856 | Bacteria | 7140722 |
| 172 | 2898716191 | 2898713307 | Bacteria | 4110805 |
| 173 | 2904473847 | 2904467357 | Bacteria | 8057758 |
| 174 | 2904473943 | 2904467357 | Bacteria | 8057758 |
| 175 | 2919190196 | 2919186247 | Bacteria | 6244071 |
| 176 | 2919191508 | 2919186247 | Bacteria | 6244071 |
| 177 | 2929241234 | 2929239360 | Bacteria | 7745570 |
| 178 | 2929926386 | 2929921140 | Bacteria | 8649150 |
| 179 | 2939668477 | 2939664404 | Bacteria | 6364494 |
| 180 | 2939669785 | 2939664404 | Bacteria | 6364494 |
| 181 | 8003151731 | 8003151029 | Bacteria | 8187759 |
| 182 | 8055591634 | 8055588893 | Bacteria | 3619545 |
| 183 | rootL2_10118208 | |||
| 184 | JGI24740J21852_10008543 | |||
| 185 | JGI24740J21852_10027610 | |||
| 186 | JGI24739J22299_10001259 | |||
| 187 | JGI24737J22298_10004921 | |||
| 188 | JGI24735J21928_10010408 | |||
| 189 | JGI25154J39366_1000016 | |||
| 190 | JGI25158J39367_1007213 | |||
| 191 | JGI25153J46596_10025644 | |||
| 192 | rootH1_10024077 | |||
| 193 | rootH1_10053174 | |||
| 194 | rootH1_10110545 | |||
| 195 | rootH2_10006701 | |||
| 196 | rootH2_10033339 | |||
| 197 | rootH2_10054169 | |||
| 198 | rootH2_10069919 | |||
| 199 | rootH2_10149759 | |||
| 200 | rootH2_10322424 | |||
| 201 | rootL2_10003563 | |||
| 202 | rootL2_10086609 | |||
| 203 | rootL2_10122408 | |||
| 204 | rootL2_10139276 | |||
| 205 | rootH1_10014052 | |||
| 206 | rootH1_10043620 | |||
| 207 | rootH1_10127793 | |||
| 208 | rootH1_10180623 | |||
| 209 | rootH1_10199997 | |||
| 210 | rootH1_10346144 | |||
| 211 | JGI25160J50197_1003636 | |||
| 212 | JGI25160J50197_1004098 | |||
| 213 | JGI25160J50197_1008342 | |||
| 214 | Ga0055535_1009466 | |||
| 215 | Ga0055542_1003367 | |||
| 216 | Ga0055528_1004005 | |||
| 217 | Ga0055528_1012644 | |||
| 218 | Ga0055531_10000055 | |||
| 219 | Ga0065165_1005464 | |||
| 220 | Ga0065165_1025931 | |||
| 221 | Ga0065714_10070923 | |||
| 222 | Ga0065714_10090261 | |||
| 223 | Ga0065704_10088996 | |||
| 224 | Ga0070659_100026097 | |||
| 225 | Ga0068857_100309403 | |||
| 226 | Ga0075366_10000682 | |||
| 227 | Ga0075370_10037734 | |||
| 228 | Ga0105239_10000002 | |||
| 229 | Ga0157373_10000328 | |||
| 230 | Ga0157373_10003657 | |||
| 231 | Ga0157373_10131216 | |||
| 232 | Ga0157371_10000315 | |||
| 233 | Ga0157371_10006015 | |||
| 234 | Ga0157370_10006800 | |||
| 235 | Ga0157370_10007275 | |||
| 236 | Ga0157370_10043507 | |||
| 237 | Ga0157370_10180066 | |||
| 238 | Ga0157369_10133943 | |||
| 239 | Ga0163162_10027531 | |||
| 240 | Ga0157372_10000186 | |||
| 241 | Ga0157372_10001960 | |||
| 242 | Ga0157375_10089147 | |||
| 243 | Ga0182008_10000731 | |||
| 244 | Ga0182005_1000179 | |||
| 245 | Ga0182005_1001059 | |||
| 246 | Ga0163161_10000649 | |||
| 247 | Ga0209436_100987 | |||
| 248 | Ga0209436_101393 | |||
| 249 | Ga0209436_101697 | |||
| 250 | Ga0209258_100151 | |||
| 251 | Ga0209646_1000003 | |||
| 252 | Ga0209026_1000333 | |||
| 253 | Ga0209026_1000361 | |||
| 254 | Ga0209148_1000154 | |||
| 255 | Ga0209673_1000014 | |||
| 256 | Ga0209673_1000018 | |||
| 257 | Ga0209673_1000166 | |||
| 258 | Ga0209673_1040454 | |||
| 259 | Ga0209130_1002088 | |||
| 260 | Ga0209564_1001302 | |||
| 261 | Ga0209564_1003917 | |||
| 262 | Ga0209564_1010106 | |||
| 263 | Ga0209564_1014550 | |||
| 264 | Ga0209758_1000465 | |||
| 265 | Ga0209758_1004938 | |||
| 266 | Ga0209758_1009092 | |||
| 267 | Ga0209050_1017716 | |||
| 268 | Ga0207426_1000216 | |||
| 269 | Ga0207426_1000277 | |||
| 270 | Ga0207426_1004084 | |||
| 271 | Ga0207426_1016286 | |||
| 272 | Ga0209051_1014153 | |||
| 273 | Ga0209257_1000025 | |||
| 274 | Ga0207647_10000030 | |||
| 275 | Ga0207690_10029003 | |||
| 276 | Ga0307515_10213833 | |||
| 277 | Ga0265338_10107045 | |||
| 278 | Ga0316177_1141088 | |||
| 279 | Ga0316176_1073963 | |||
| 280 | Ga0316176_1160749 | |||
| 281 | Ga0316183_1009917 | |||
| 282 | Ga0316183_1019028 | |||
| 283 | Ga0316183_1111136 | |||
| 284 | Ga0316181_1148979 | |||
| 285 | Ga0316181_1158951 | |||
| 286 | Ga0316182_1191260 | |||
| 287 | Ga0265327_10000090 | |||
| 288 | Ga0265327_10147053 | |||
| 289 | Ga0307408_100000974 | |||
| 290 | Ga0307408_100001775 | |||
| 291 | Ga0307408_100002139 | |||
| 292 | Ga0307408_100005632 | |||
| 293 | Ga0307412_10001402 | |||
| 294 | Ga0307416_100176850 | |||
| 295 | Ga0307414_10006638 | |||
| 296 | Ga0307414_10009023 | |||
| 297 | Ga0307414_10342127 | |||
| 298 | Ga0466972_0000001 | |||
| 299 | Ga0466972_0000026 | |||
| 300 | Ga0466972_0000046 | |||
| 301 | Ga0466972_0096153 | |||
| 302 | Ga0453683_0004027 | |||
| 303 | Ga0466970_0000335 | |||
| 304 | Ga0466970_0000422 | |||
| 305 | Ga0466970_0000579 | |||
| 306 | Ga0451576_0009814 | |||
| 307 | Ga0495627_014423 | |||
| 308 | Ga0495644_0043583 | |||
| 309 | Ga0495633_0000383 | |||
| 310 | Ga0495633_0000561 | |||
| 311 | Ga0495633_0001141 | |||
| 312 | Ga0495633_0016799 | |||
| 313 | Ga0495677_0049341 | |||
| 314 | Ga0495685_012780 | |||
| 315 | Ga0495686_0003019 | |||
| 316 | Ga0496101_0111480 | |||
| 317 | Ga0496114_0044858 | |||
| 318 | Ga0496121_0000028 | |||
| 319 | Ga0496121_0004873 | |||
| 320 | Ga0496124_0126333 | |||
| 321 | Ga0496126_0010104 | |||
| 322 | Ga0501238_009609 | |||
| 323 | nmdc:mga0k408_1109_c1 | |||
| 324 | nmdc:mga07m45_22022_c1 | |||
| 325 | Ga0500635_0002352 | |||
| 326 | Ga0500644_0000283 | |||
| 327 | Ga0500651_0076905 | |||
| 328 | Ga0500651_0121072 | |||
| 329 | Ga0500562_000030 | |||
| 330 | Ga0500569_021059 | |||
| 331 | Ga0500658_0057806 | |||
| 332 | Ga0500577_0000888 | |||
| 333 | Ga0500616_0040614 | |||
| 334 | Ga0500622_0000132 | |||
| 335 | Ga0500622_0001995 | |||
| 336 | Ga0500633_0071685 | |||
| 337 | Ga0500636_0118164 | |||
| 338 | Ga0500645_006201 | |||
| 339 | 2738764372 | |||
| 340 | 2738855094 | |||
| 341 | 2739305047 | |||
| 342 | 2819572277 | |||
| 343 | 2819572700 | |||
| 344 | 2819591015 | |||
| 345 | 2821139895 | |||
| 346 | 2821140360 | |||
| 347 | 2842909102 | |||
| 348 | 2842909497 | |||
| 349 | 2883072370 | |||
| 350 | 2884794229 | |||
| 351 | 2884796230 | |||
| 352 | 2896110123 | |||
| 353 | 2896114360 | |||
| 354 | 2898716191 | |||
| 355 | 2904473847 | |||
| 356 | 2904473943 | |||
| 357 | 2919190196 | |||
| 358 | 2919191508 | |||
| 359 | 2929241234 | |||
| 360 | 2929926386 | |||
| 361 | 2939668477 | |||
| 362 | 2939669785 | |||
| 363 | 8003151731 | |||
| 364 | 8055591634 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2dsl-assembly1.cif.gz_A | mutant n33d structure of phenylacetic acid degradation protein paai from thermus thermophilus hb8 | 0.7138 | 287 | 333 |
| 1wlu-assembly1.cif.gz_A | crystal structure of tt0310 protein from thermus thermophilus hb8 | 0.7088 | 287 | 333 |
| 4akr-assembly2.cif.gz_D | crystal structure of the cytoplasmic actin capping protein cap32_34 from dictyostelium discoideum | 0.6873 | 83 | 184 |
| 6gie-assembly1.cif.gz_A | crystal structure of the acinetobacter baumannii outer membrane protein omp33 | 0.6786 | 57 | 333 |
| 6gie-assembly1.cif.gz_A | crystal structure of the acinetobacter baumannii outer membrane protein omp33 | 0.6732 | 57 | 333 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1wluA00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.7088 | 287 | 333 | 3.10.129.10 |
| 4fqeA00 | Mainly Beta;Beta Barrel;Porin;monomeric porin ompg | 0.6727 | 63 | 334 | 2.40.160.40 |
| 4ctdB00 | Mainly Beta;Beta Barrel;Porin;monomeric porin ompg | 0.6681 | 60 | 333 | 2.40.160.40 |
| 4fqeA00 | Mainly Beta;Beta Barrel;Porin;monomeric porin ompg | 0.6679 | 63 | 334 | 2.40.160.40 |
| 4ctdB00 | Mainly Beta;Beta Barrel;Porin;monomeric porin ompg | 0.6588 | 60 | 333 | 2.40.160.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D6DIC4-F1-model_v4 | Type IX secretion system membrane protein PorP/SprF | 0.896 | 35 | 346 |
|
| AF-S2DE20-F1-model_v4 | Type IX secretion system membrane protein PorP/SprF | 0.8886 | 46 | 346 |
|
| AF-S2DE20-F1-model_v4 | Type IX secretion system membrane protein PorP/SprF | 0.8828 | 46 | 346 |
|
| AF-A0A2A4Q8W6-F1-model_v4 | Type IX secretion system membrane protein PorP/SprF | 0.8805 | 46 | 245 |
|
| AF-A0A1Q3ZIR3-F1-model_v4 | Type IX secretion system membrane protein PorP/SprF | 0.8741 | 30 | 335 |
|