F278397

General Info

Members Datasets Scaffolds Average Seq Length
182 109 364 328

Family's Representative Sequence

Representative Sequence 3300003322|rootL2_10118208|rootL2_101182083
Length 353
Sequence MDCDKTKLMTRDIFCFTKRTVMCLRKGLYTGLLIMAGLRAGAQQNVQFSQYVFNGLSVNPAYAGYKDAWYLNTIYRKQWTGFPGAPVTGGVSYDGPFRPLKTGAGIGLGVQLMADMVGPQKSYSLYGSYAYRIPLDAEQTRRLSFGLAVGVTQYHLEGNTLAYFDSDDPVFPGGSVNAYTPDARFGIYYSSPSFYAGLSVMDLFSRYTSTKYAWKGFNYQNIRKSQHIYLTTGVMLPLSEHLQLKPSLMIKDDFKGPTNLDVNAMLLIDRVFWIGGSFRTAVPVWKKQLPNGLESLNAASAIVEYYIGGKWRIGYAYDLNINELAGTQGGSHEISIGILFPQKKFSTSSPRYF

Samples

Sample ID Description Type Environment
1 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
13 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
14 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
15 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
16 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
17 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
18 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
23 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
24 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
25 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
26 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
27 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
28 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
29 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
30 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
31 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
32 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
33 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
34 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
35 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
36 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
37 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
38 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
39 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
40 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
41 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
42 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
43 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
44 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
46 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
51 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
52 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
53 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
54 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
55 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
56 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
57 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
58 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
59 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
60 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
61 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
62 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
63 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
64 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
65 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
66 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
67 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
68 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
69 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
70 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
71 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
72 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
73 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
74 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
75 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
76 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
77 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
78 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
79 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
80 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
81 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
82 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
83 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
84 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
85 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
86 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
87 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
88 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
89 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
90 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
91 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
92 2738541284 Pedobacter sp. YR016 Isolate Unclassified
93 2738541302 Pedobacter sp. CF074 Isolate Unclassified
94 2738543023 Pedobacter sp. OK628 Isolate Unclassified
95 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
96 2818991444 Filimonas endophytica 3197 Isolate Unclassified
97 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
98 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
99 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
100 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
101 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
102 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
103 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
104 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
105 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
106 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
107 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
108 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified
109 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.71
Metatranscriptomes 0
Isolates 14.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 29.67
Nodule 0
Rhizoplane 1.1
Rhizosphere 43.96
Stem 0
Stem Tuber 0
Unclassified 11.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10118208 3300003322 Bacteria 6822
2 JGI24740J21852_10008543 3300001979 Unclassified 4073
3 JGI24740J21852_10027610 3300001979 Unclassified 1887
4 JGI24739J22299_10001259 3300001989 Bacteria 9498
5 JGI24737J22298_10004921 3300001990 Bacteria 4630
6 JGI24735J21928_10010408 3300002067 Bacteria 2966
7 JGI25154J39366_1000016 3300002738 Bacteria 255057
8 JGI25158J39367_1007213 3300002739 Unclassified 1572
9 JGI25153J46596_10025644 3300003215 Bacteria 2102
10 rootH1_10024077 3300003316 Bacteria 5910
11 rootH1_10053174 3300003316 Bacteria 1134
12 rootH1_10110545 3300003316 Bacteria 2445
13 rootH2_10006701 3300003320 Bacteria 5410
14 rootH2_10033339 3300003320 Bacteria 6494
15 rootH2_10054169 3300003320 Bacteria 16718
16 rootH2_10069919 3300003320 Bacteria 2730
17 rootH2_10149759 3300003320 Bacteria 4111
18 rootH2_10322424 3300003320 Bacteria 3020
19 rootL2_10003563 3300003322 Bacteria 5436
20 rootL2_10086609 3300003322 Bacteria 3778
21 rootL2_10122408 3300003322 Bacteria 9314
22 rootL2_10139276 3300003322 Bacteria 7755
23 rootH1_10014052 3300003323 Bacteria 12146
24 rootH1_10043620 3300003323 Unclassified 4281
25 rootH1_10127793 3300003323 Bacteria 1908
26 rootH1_10180623 3300003323 Bacteria 9613
27 rootH1_10199997 3300003323 Bacteria 4402
28 rootH1_10346144 3300003323 Bacteria 2799
29 JGI25160J50197_1003636 3300003354 Bacteria 6843
30 JGI25160J50197_1004098 3300003354 Bacteria 6350
31 JGI25160J50197_1008342 3300003354 Bacteria 3954
32 Ga0055535_1009466 3300003761 Bacteria 1678
33 Ga0055542_1003367 3300003762 Bacteria 4385
34 Ga0055528_1004005 3300003790 Bacteria 7206
35 Ga0055528_1012644 3300003790 Bacteria 3260
36 Ga0055531_10000055 3300003794 Bacteria 123621
37 Ga0065165_1005464 3300005262 Bacteria 7120
38 Ga0065165_1025931 3300005262 Bacteria 1937
39 Ga0065714_10070923 3300005288 Bacteria 3727
40 Ga0065714_10090261 3300005288 Bacteria 1950
41 Ga0065704_10088996 3300005289 Bacteria 2893
42 Ga0070659_100026097 3300005366 Unclassified 4493
43 Ga0068857_100309403 3300005577 Unclassified 1457
44 Ga0075366_10000682 3300006195 Bacteria 16076
45 Ga0075370_10037734 3300006353 Bacteria 2717
46 Ga0105239_10000002 3300010375 Bacteria 610298
47 Ga0157373_10000328 3300013100 Bacteria 38459
48 Ga0157373_10003657 3300013100 Bacteria 11622
49 Ga0157373_10131216 3300013100 Bacteria 1762
50 Ga0157371_10000315 3300013102 Bacteria 62944
51 Ga0157371_10006015 3300013102 Bacteria 10110
52 Ga0157370_10006800 3300013104 Bacteria 12539
53 Ga0157370_10007275 3300013104 Bacteria 12080
54 Ga0157370_10043507 3300013104 Bacteria 4321
55 Ga0157370_10180066 3300013104 Bacteria 1964
56 Ga0157369_10133943 3300013105 Unclassified 2624
57 Ga0163162_10027531 3300013306 Bacteria 5621
58 Ga0157372_10000186 3300013307 Bacteria 68701
59 Ga0157372_10001960 3300013307 Bacteria 22372
60 Ga0157375_10089147 3300013308 Bacteria 3140
61 Ga0182008_10000731 3300014497 Bacteria 23325
62 Ga0182005_1000179 3300015265 Bacteria 43636
63 Ga0182005_1001059 3300015265 Bacteria 11641
64 Ga0163161_10000649 3300017792 Bacteria 27745
65 Ga0209436_100987 3300025208 Bacteria 10969
66 Ga0209436_101393 3300025208 Bacteria 8530
67 Ga0209436_101697 3300025208 Bacteria 7257
68 Ga0209258_100151 3300025242 Bacteria 160444
69 Ga0209646_1000003 3300025246 Bacteria 1160860
70 Ga0209026_1000333 3300025250 Bacteria 45722
71 Ga0209026_1000361 3300025250 Bacteria 42722
72 Ga0209148_1000154 3300025254 Bacteria 145214
73 Ga0209673_1000014 3300025273 Bacteria 537082
74 Ga0209673_1000018 3300025273 Bacteria 458281
75 Ga0209673_1000166 3300025273 Bacteria 135260
76 Ga0209673_1040454 3300025273 Bacteria 1333
77 Ga0209130_1002088 3300025284 Bacteria 10734
78 Ga0209564_1001302 3300025295 Bacteria 26894
79 Ga0209564_1003917 3300025295 Bacteria 9528
80 Ga0209564_1010106 3300025295 Bacteria 4392
81 Ga0209564_1014550 3300025295 Bacteria 3265
82 Ga0209758_1000465 3300025297 Bacteria 67058
83 Ga0209758_1004938 3300025297 Bacteria 10707
84 Ga0209758_1009092 3300025297 Bacteria 6265
85 Ga0209050_1017716 3300025298 Bacteria 2817
86 Ga0207426_1000216 3300025302 Bacteria 136337
87 Ga0207426_1000277 3300025302 Bacteria 106036
88 Ga0207426_1004084 3300025302 Bacteria 7362
89 Ga0207426_1016286 3300025302 Unclassified 2674
90 Ga0209051_1014153 3300025303 Bacteria 3739
91 Ga0209257_1000025 3300025304 Bacteria 724838
92 Ga0207647_10000030 3300025904 Bacteria 106974
93 Ga0207690_10029003 3300025932 Unclassified 3514
94 Ga0307515_10213833 3300028794 Bacteria 1765
95 Ga0265338_10107045 3300028800 Bacteria 2262
96 Ga0316177_1141088 3300030731 Bacteria 11308
97 Ga0316176_1073963 3300030732 Bacteria 5544
98 Ga0316176_1160749 3300030732 Bacteria 4558
99 Ga0316183_1009917 3300030742 Bacteria 46001
100 Ga0316183_1019028 3300030742 Bacteria 6947
101 Ga0316183_1111136 3300030742 Bacteria 32649
102 Ga0316181_1148979 3300030744 Bacteria 13161
103 Ga0316181_1158951 3300030744 Bacteria 1816
104 Ga0316182_1191260 3300030745 Unclassified 2861
105 Ga0265327_10000090 3300031251 Bacteria 197158
106 Ga0265327_10147053 3300031251 Unclassified 1097
107 Ga0307408_100000974 3300031548 Bacteria 22170
108 Ga0307408_100001775 3300031548 Bacteria 15744
109 Ga0307408_100002139 3300031548 Bacteria 14161
110 Ga0307408_100005632 3300031548 Bacteria 8375
111 Ga0307412_10001402 3300031911 Bacteria 13396
112 Ga0307416_100176850 3300032002 Bacteria 1995
113 Ga0307414_10006638 3300032004 Bacteria 6469
114 Ga0307414_10009023 3300032004 Bacteria 5703
115 Ga0307414_10342127 3300032004 Unclassified 1281
116 Ga0466972_0000001 3300044658 Bacteria 412457
117 Ga0466972_0000026 3300044658 Bacteria 184739
118 Ga0466972_0000046 3300044658 Bacteria 127926
119 Ga0466972_0096153 3300044658 Bacteria 1403
120 Ga0453683_0004027 3300044673 Bacteria 10598
121 Ga0466970_0000335 3300044765 Bacteria 22998
122 Ga0466970_0000422 3300044765 Bacteria 20695
123 Ga0466970_0000579 3300044765 Bacteria 17895
124 Ga0451576_0009814 3300045051 Bacteria 11063
125 Ga0495627_014423 3300046453 Bacteria 2757
126 Ga0495644_0043583 3300046523 Unclassified 1688
127 Ga0495633_0000383 3300046558 Bacteria 46815
128 Ga0495633_0000561 3300046558 Bacteria 36426
129 Ga0495633_0001141 3300046558 Bacteria 21334
130 Ga0495633_0016799 3300046558 Bacteria 3760
131 Ga0495677_0049341 3300047445 Unclassified 1547
132 Ga0495685_012780 3300047447 Unclassified 2844
133 Ga0495686_0003019 3300047472 Bacteria 14949
134 Ga0496101_0111480 3300048904 Bacteria 2060
135 Ga0496114_0044858 3300048917 Unclassified 3670
136 Ga0496121_0000028 3300048924 Bacteria 439193
137 Ga0496121_0004873 3300048924 Bacteria 17625
138 Ga0496124_0126333 3300048927 Unclassified 2037
139 Ga0496126_0010104 3300048929 Bacteria 9955
140 Ga0501238_009609 3300049671 Unclassified 1283
141 nmdc:mga0k408_1109_c1 3300050493 Bacteria 14749
142 nmdc:mga07m45_22022_c1 3300050496 Bacteria 3477
143 Ga0500635_0002352 3300053080 Unclassified 4669
144 Ga0500644_0000283 3300053088 Bacteria 28078
145 Ga0500651_0076905 3300053093 Unclassified 2072
146 Ga0500651_0121072 3300053093 Bacteria 1589
147 Ga0500562_000030 3300053108 Bacteria 92407
148 Ga0500569_021059 3300053109 Bacteria 1719
149 Ga0500658_0057806 3300053134 Bacteria 1604
150 Ga0500577_0000888 3300053142 Bacteria 7733
151 Ga0500616_0040614 3300053153 Bacteria 2502
152 Ga0500622_0000132 3300053156 Bacteria 78669
153 Ga0500622_0001995 3300053156 Bacteria 15284
154 Ga0500633_0071685 3300053160 Unclassified 1238
155 Ga0500636_0118164 3300053177 Bacteria 1490
156 Ga0500645_006201 3300053730 Bacteria 4293
157 2738764372 2738541284 Bacteria 5199923
158 2738855094 2738541302 Bacteria 5944758
159 2739305047 2738543023 Bacteria 6767879
160 2819572277 2818991442 Bacteria 8318214
161 2819572700 2818991442 Bacteria 8318214
162 2819591015 2818991444 Bacteria 6968812
163 2821139895 2821136567 Bacteria 8080116
164 2821140360 2821136567 Bacteria 8080116
165 2842909102 2842903701 Bacteria 6986368
166 2842909497 2842903701 Bacteria 6986368
167 2883072370 2883068021 Bacteria 6192739
168 2884794229 2884791551 Bacteria 8511252
169 2884796230 2884791551 Bacteria 8511252
170 2896110123 2896109856 Bacteria 7140722
171 2896114360 2896109856 Bacteria 7140722
172 2898716191 2898713307 Bacteria 4110805
173 2904473847 2904467357 Bacteria 8057758
174 2904473943 2904467357 Bacteria 8057758
175 2919190196 2919186247 Bacteria 6244071
176 2919191508 2919186247 Bacteria 6244071
177 2929241234 2929239360 Bacteria 7745570
178 2929926386 2929921140 Bacteria 8649150
179 2939668477 2939664404 Bacteria 6364494
180 2939669785 2939664404 Bacteria 6364494
181 8003151731 8003151029 Bacteria 8187759
182 8055591634 8055588893 Bacteria 3619545
183 rootL2_10118208
184 JGI24740J21852_10008543
185 JGI24740J21852_10027610
186 JGI24739J22299_10001259
187 JGI24737J22298_10004921
188 JGI24735J21928_10010408
189 JGI25154J39366_1000016
190 JGI25158J39367_1007213
191 JGI25153J46596_10025644
192 rootH1_10024077
193 rootH1_10053174
194 rootH1_10110545
195 rootH2_10006701
196 rootH2_10033339
197 rootH2_10054169
198 rootH2_10069919
199 rootH2_10149759
200 rootH2_10322424
201 rootL2_10003563
202 rootL2_10086609
203 rootL2_10122408
204 rootL2_10139276
205 rootH1_10014052
206 rootH1_10043620
207 rootH1_10127793
208 rootH1_10180623
209 rootH1_10199997
210 rootH1_10346144
211 JGI25160J50197_1003636
212 JGI25160J50197_1004098
213 JGI25160J50197_1008342
214 Ga0055535_1009466
215 Ga0055542_1003367
216 Ga0055528_1004005
217 Ga0055528_1012644
218 Ga0055531_10000055
219 Ga0065165_1005464
220 Ga0065165_1025931
221 Ga0065714_10070923
222 Ga0065714_10090261
223 Ga0065704_10088996
224 Ga0070659_100026097
225 Ga0068857_100309403
226 Ga0075366_10000682
227 Ga0075370_10037734
228 Ga0105239_10000002
229 Ga0157373_10000328
230 Ga0157373_10003657
231 Ga0157373_10131216
232 Ga0157371_10000315
233 Ga0157371_10006015
234 Ga0157370_10006800
235 Ga0157370_10007275
236 Ga0157370_10043507
237 Ga0157370_10180066
238 Ga0157369_10133943
239 Ga0163162_10027531
240 Ga0157372_10000186
241 Ga0157372_10001960
242 Ga0157375_10089147
243 Ga0182008_10000731
244 Ga0182005_1000179
245 Ga0182005_1001059
246 Ga0163161_10000649
247 Ga0209436_100987
248 Ga0209436_101393
249 Ga0209436_101697
250 Ga0209258_100151
251 Ga0209646_1000003
252 Ga0209026_1000333
253 Ga0209026_1000361
254 Ga0209148_1000154
255 Ga0209673_1000014
256 Ga0209673_1000018
257 Ga0209673_1000166
258 Ga0209673_1040454
259 Ga0209130_1002088
260 Ga0209564_1001302
261 Ga0209564_1003917
262 Ga0209564_1010106
263 Ga0209564_1014550
264 Ga0209758_1000465
265 Ga0209758_1004938
266 Ga0209758_1009092
267 Ga0209050_1017716
268 Ga0207426_1000216
269 Ga0207426_1000277
270 Ga0207426_1004084
271 Ga0207426_1016286
272 Ga0209051_1014153
273 Ga0209257_1000025
274 Ga0207647_10000030
275 Ga0207690_10029003
276 Ga0307515_10213833
277 Ga0265338_10107045
278 Ga0316177_1141088
279 Ga0316176_1073963
280 Ga0316176_1160749
281 Ga0316183_1009917
282 Ga0316183_1019028
283 Ga0316183_1111136
284 Ga0316181_1148979
285 Ga0316181_1158951
286 Ga0316182_1191260
287 Ga0265327_10000090
288 Ga0265327_10147053
289 Ga0307408_100000974
290 Ga0307408_100001775
291 Ga0307408_100002139
292 Ga0307408_100005632
293 Ga0307412_10001402
294 Ga0307416_100176850
295 Ga0307414_10006638
296 Ga0307414_10009023
297 Ga0307414_10342127
298 Ga0466972_0000001
299 Ga0466972_0000026
300 Ga0466972_0000046
301 Ga0466972_0096153
302 Ga0453683_0004027
303 Ga0466970_0000335
304 Ga0466970_0000422
305 Ga0466970_0000579
306 Ga0451576_0009814
307 Ga0495627_014423
308 Ga0495644_0043583
309 Ga0495633_0000383
310 Ga0495633_0000561
311 Ga0495633_0001141
312 Ga0495633_0016799
313 Ga0495677_0049341
314 Ga0495685_012780
315 Ga0495686_0003019
316 Ga0496101_0111480
317 Ga0496114_0044858
318 Ga0496121_0000028
319 Ga0496121_0004873
320 Ga0496124_0126333
321 Ga0496126_0010104
322 Ga0501238_009609
323 nmdc:mga0k408_1109_c1
324 nmdc:mga07m45_22022_c1
325 Ga0500635_0002352
326 Ga0500644_0000283
327 Ga0500651_0076905
328 Ga0500651_0121072
329 Ga0500562_000030
330 Ga0500569_021059
331 Ga0500658_0057806
332 Ga0500577_0000888
333 Ga0500616_0040614
334 Ga0500622_0000132
335 Ga0500622_0001995
336 Ga0500633_0071685
337 Ga0500636_0118164
338 Ga0500645_006201
339 2738764372
340 2738855094
341 2739305047
342 2819572277
343 2819572700
344 2819591015
345 2821139895
346 2821140360
347 2842909102
348 2842909497
349 2883072370
350 2884794229
351 2884796230
352 2896110123
353 2896114360
354 2898716191
355 2904473847
356 2904473943
357 2919190196
358 2919191508
359 2929241234
360 2929926386
361 2939668477
362 2939669785
363 8003151731
364 8055591634

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11751

PorP_SprF

Type IX secretion system membrane protein PorP/SprF

40

338

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2dsl-assembly1.cif.gz_A mutant n33d structure of phenylacetic acid degradation protein paai from thermus thermophilus hb8 0.7138 287 333
1wlu-assembly1.cif.gz_A crystal structure of tt0310 protein from thermus thermophilus hb8 0.7088 287 333
4akr-assembly2.cif.gz_D crystal structure of the cytoplasmic actin capping protein cap32_34 from dictyostelium discoideum 0.6873 83 184
6gie-assembly1.cif.gz_A crystal structure of the acinetobacter baumannii outer membrane protein omp33 0.6786 57 333
6gie-assembly1.cif.gz_A crystal structure of the acinetobacter baumannii outer membrane protein omp33 0.6732 57 333
ID Description Score Start End Superfamily
1wluA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.7088 287 333 3.10.129.10
4fqeA00 Mainly Beta;Beta Barrel;Porin;monomeric porin ompg 0.6727 63 334 2.40.160.40
4ctdB00 Mainly Beta;Beta Barrel;Porin;monomeric porin ompg 0.6681 60 333 2.40.160.40
4fqeA00 Mainly Beta;Beta Barrel;Porin;monomeric porin ompg 0.6679 63 334 2.40.160.40
4ctdB00 Mainly Beta;Beta Barrel;Porin;monomeric porin ompg 0.6588 60 333 2.40.160.40
ID Description Score Start End GO Terms
AF-A0A3D6DIC4-F1-model_v4 Type IX secretion system membrane protein PorP/SprF 0.896 35 346
AF-S2DE20-F1-model_v4 Type IX secretion system membrane protein PorP/SprF 0.8886 46 346
AF-S2DE20-F1-model_v4 Type IX secretion system membrane protein PorP/SprF 0.8828 46 346
AF-A0A2A4Q8W6-F1-model_v4 Type IX secretion system membrane protein PorP/SprF 0.8805 46 245
AF-A0A1Q3ZIR3-F1-model_v4 Type IX secretion system membrane protein PorP/SprF 0.8741 30 335

Map