F279232

General Info

Members Datasets Scaffolds Average Seq Length
182 123 182 81

Family's Representative Sequence

Representative Sequence 3300025907|Ga0207645_10353255|Ga0207645_103532552
Length 97
Sequence MKLPRDVSGDELAKRLRVFGYQISRQAGSHLRLTTSERGEHHVTIPRHDPIKLGTLAGILGDVGEHFDLDRDEVIVQVFGREAASDAQSNQRHRGAA

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
33 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
34 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
35 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
36 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
37 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
38 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
39 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
53 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
54 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
55 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
78 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
79 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
80 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
81 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
82 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
83 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
84 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
85 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
86 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
87 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
88 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
89 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
90 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
91 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
92 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
93 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
94 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
95 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
96 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
97 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
98 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
99 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
100 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
101 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
102 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
103 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
104 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
105 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
106 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
107 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
108 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
109 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
110 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
111 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
113 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
114 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
115 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
116 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
117 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
118 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
119 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
120 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
121 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
122 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
123 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.25
Metatranscriptomes 2.75
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.55
Rhizosphere 98.9
Stem 0
Stem Tuber 0
Unclassified 0.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10295124 3300005290 Unclassified 866
2 Ga0065715_10025944 3300005293 Unclassified 1353
3 Ga0065707_10937307 3300005295 Bacteria 556
4 Ga0070683_100076630 3300005329 Bacteria 3126
5 Ga0070683_100487114 3300005329 Unclassified 1178
6 Ga0070677_10625003 3300005333 Unclassified 599
7 Ga0070680_100819843 3300005336 Bacteria 802
8 Ga0070682_100000311 3300005337 Bacteria 33637
9 Ga0070660_100811391 3300005339 Bacteria 787
10 Ga0070692_11393982 3300005345 Bacteria 506
11 Ga0070669_102000987 3300005353 Bacteria 506
12 Ga0070675_100087016 3300005354 Bacteria 2612
13 Ga0070675_100367376 3300005354 Unclassified 1279
14 Ga0070688_100184370 3300005365 Bacteria 1450
15 Ga0070667_100935419 3300005367 Unclassified 807
16 Ga0070711_100788940 3300005439 Unclassified 805
17 Ga0070700_100304726 3300005441 Unclassified 1164
18 Ga0070694_101649917 3300005444 Unclassified 545
19 Ga0070708_100126384 3300005445 Unclassified 2364
20 Ga0070681_10067695 3300005458 Bacteria 3539
21 Ga0070681_11040588 3300005458 Unclassified 739
22 Ga0070681_11535853 3300005458 Bacteria 591
23 Ga0070706_100112491 3300005467 Unclassified 2534
24 Ga0070707_100018858 3300005468 Bacteria 6496
25 Ga0070707_100702335 3300005468 Bacteria 974
26 Ga0070707_100712184 3300005468 Bacteria 967
27 Ga0070698_100019698 3300005471 Bacteria 7076
28 Ga0070699_100716940 3300005518 Bacteria 914
29 Ga0070684_100139480 3300005535 Bacteria 2192
30 Ga0070686_100070644 3300005544 Bacteria 2284
31 Ga0070695_100058786 3300005545 Bacteria 2487
32 Ga0070695_100347368 3300005545 Bacteria 1110
33 Ga0070693_100047838 3300005547 Bacteria 2434
34 Ga0070693_100201790 3300005547 Bacteria 1292
35 Ga0070704_101748737 3300005549 Unclassified 575
36 Ga0068855_100018839 3300005563 Bacteria 8297
37 Ga0068855_100437916 3300005563 Bacteria 1428
38 Ga0068854_100186091 3300005578 Bacteria 1625
39 Ga0068861_100264902 3300005719 Bacteria 1473
40 Ga0068858_100107502 3300005842 Unclassified 2604
41 Ga0081540_1091290 3300005983 Bacteria 1339
42 Ga0081539_10108940 3300005985 Unclassified 1398
43 Ga0070715_10810485 3300006163 Unclassified 569
44 Ga0070716_100000001 3300006173 Bacteria 400668
45 Ga0070716_101145574 3300006173 Unclassified 622
46 Ga0075434_100452184 3300006871 Bacteria 1306
47 Ga0075434_101712540 3300006871 Unclassified 636
48 Ga0075429_101783721 3300006880 Unclassified 534
49 Ga0075436_100000537 3300006914 Bacteria 24720
50 Ga0099794_10012774 3300007265 Bacteria 3637
51 Ga0105240_10046726 3300009093 Bacteria 5483
52 Ga0105245_10971864 3300009098 Bacteria 893
53 Ga0114129_10276943 3300009147 Bacteria 2243
54 Ga0114129_10493343 3300009147 Unclassified 1600
55 Ga0114129_10604009 3300009147 Bacteria 1421
56 Ga0114129_10722008 3300009147 Bacteria 1278
57 Ga0105241_10582454 3300009174 Bacteria 1009
58 Ga0105242_10426904 3300009176 Unclassified 1243
59 Ga0105237_10939639 3300009545 Bacteria 872
60 Ga0105237_11868158 3300009545 Unclassified 608
61 Ga0105246_10383456 3300011119 Bacteria 1162
62 Ga0157370_10048387 3300013104 Bacteria 4074
63 Ga0157370_10092605 3300013104 Plasmid 2837
64 Ga0157370_10298001 3300013104 Unclassified 1489
65 Ga0157369_10284937 3300013105 Bacteria 1720
66 Ga0157374_11261155 3300013296 Unclassified 761
67 Ga0157372_10083476 3300013307 Bacteria 3619
68 Ga0157372_12188836 3300013307 Unclassified 635
69 Ga0157375_10624451 3300013308 Bacteria 1235
70 Ga0157375_12570659 3300013308 Bacteria 608
71 Ga0157380_10253792 3300014326 Bacteria 1593
72 Ga0157380_10618972 3300014326 Bacteria 1074
73 Ga0157379_11502950 3300014968 Unclassified 655
74 Ga0163161_11037782 3300017792 Bacteria 702
75 Ga0206354_10031652 3300020081 Bacteria 618
76 Ga0224712_10378681 3300022467 Unclassified 672
77 Ga0207688_10480968 3300025901 Unclassified 776
78 Ga0207645_10353255 3300025907 Bacteria 984
79 Ga0207684_10030570 3300025910 Bacteria 4583
80 Ga0207684_11378861 3300025910 Unclassified 578
81 Ga0207707_10115558 3300025912 Bacteria 2345
82 Ga0207695_10003129 3300025913 Bacteria 23676
83 Ga0207695_10204494 3300025913 Unclassified 1888
84 Ga0207663_10300229 3300025916 Unclassified 1199
85 Ga0207657_10703590 3300025919 Unclassified 785
86 Ga0207646_10002239 3300025922 Bacteria 23044
87 Ga0207646_10552647 3300025922 Bacteria 1035
88 Ga0207659_10061315 3300025926 Bacteria 2710
89 Ga0207687_10312457 3300025927 Bacteria 1269
90 Ga0207706_10027888 3300025933 Bacteria 5047
91 Ga0207670_10000002 3300025936 Bacteria 783058
92 Ga0207665_10000002 3300025939 Bacteria 267895
93 Ga0207665_11336891 3300025939 Unclassified 571
94 Ga0207661_10142598 3300025944 Bacteria 2063
95 Ga0207661_11500350 3300025944 Bacteria 618
96 Ga0207667_10228108 3300025949 Bacteria 1907
97 Ga0207667_10479250 3300025949 Bacteria 1263
98 Ga0207658_10912917 3300025986 Unclassified 800
99 Ga0207708_10374402 3300026075 Unclassified 1173
100 Ga0207674_10301657 3300026116 Unclassified 1551
101 Ga0207675_100082983 3300026118 Bacteria 3006
102 Ga0207675_102475295 3300026118 Unclassified 530
103 Ga0209588_1012046 3300027671 Bacteria 2621
104 Ga0209588_1197130 3300027671 Unclassified 628
105 Ga0265318_10098008 3300028577 Bacteria 1079
106 Ga0265336_10013871 3300028666 Bacteria 2680
107 Ga0265338_10903131 3300028800 Unclassified 601
108 Ga0265760_10338608 3300031090 Unclassified 537
109 Ga0316579_10008473 3300031691 Bacteria 4287
110 Ga0316579_10019111 3300031691 Bacteria 3023
111 Ga0316579_10107337 3300031691 Bacteria 1339
112 Ga0316579_10124268 3300031691 Bacteria 1241
113 Ga0316576_10601049 3300031727 Bacteria 803
114 Ga0316578_10091813 3300031728 Bacteria 1814
115 Ga0316578_10150470 3300031728 Viruses 1402
116 Ga0316577_10005295 3300031733 Bacteria 6759
117 Ga0316577_10066340 3300031733 Bacteria 2015
118 Ga0316577_10074799 3300031733 Viruses 1891
119 Ga0316577_10219196 3300031733 Bacteria 1075
120 Ga0316593_10055858 3300032168 Bacteria 1343
121 Ga0316593_10253297 3300032168 Unclassified 659
122 Ga0373947_0825648 3300035725 Bacteria 633
123 Ga0316582_0010269 3300036647 Bacteria 5121
124 Ga0316582_0031613 3300036647 Unclassified 3237
125 Ga0316582_0199755 3300036647 Unclassified 1364
126 Ga0316582_0330959 3300036647 Bacteria 1047
127 Ga0316582_0380858 3300036647 Unclassified 971
128 Ga0316582_0443555 3300036647 Bacteria 895
129 Ga0316584_0008861 3300036712 Bacteria 6953
130 Ga0316584_0248376 3300036712 Bacteria 1300
131 Ga0316584_0287163 3300036712 Bacteria 1194
132 Ga0316584_0432732 3300036712 Unclassified 933
133 Ga0316584_0596139 3300036712 Bacteria 767
134 Ga0395899_0761624 3300037312 Unclassified 602
135 Ga0395900_0161504 3300037418 Bacteria 2285
136 Ga0395900_0231540 3300037418 Bacteria 1858
137 Ga0395898_0533696 3300037466 Unclassified 1115
138 Ga0395905_0239576 3300037471 Bacteria 1695
139 Ga0316581_0004125 3300037588 Bacteria 3675
140 Ga0316581_0027048 3300037588 Bacteria 1714
141 Ga0395901_2082380 3300038443 Unclassified 513
142 Ga0400487_05582 3300039110 Bacteria 28626
143 Ga0439453_0059347 3300041408 Unclassified 789
144 Ga0451577_0001499 3300042876 Bacteria 30880
145 Ga0451577_0011941 3300042876 Bacteria 8186
146 Ga0453683_0009742 3300044673 Bacteria 6404
147 Ga0453684_0000698 3300044712 Bacteria 119496
148 Ga0453684_0195952 3300044712 Bacteria 2359
149 Ga0453684_0654742 3300044712 Unclassified 1146
150 Ga0453684_2127787 3300044712 Unclassified 562
151 Ga0466960_0493822 3300044901 Bacteria 716
152 Ga0451576_0006259 3300045051 Bacteria 14651
153 Ga0451576_0009132 3300045051 Bacteria 11525
154 Ga0451576_0066859 3300045051 Bacteria 3741
155 Ga0466967_0710874 3300045976 Unclassified 995
156 Ga0495610_0075791 3300046512 Bacteria 1557
157 Ga0495663_0000154 3300046525 Bacteria 27993
158 Ga0495663_0073307 3300046525 Unclassified 1093
159 Ga0495586_0646597 3300046535 Unclassified 611
160 Ga0495598_0000595 3300046537 Bacteria 6828
161 Ga0495621_0000982 3300046539 Bacteria 7290
162 Ga0495621_0004181 3300046539 Bacteria 4033
163 Ga0495604_0583921 3300047317 Bacteria 718
164 Ga0496112_0433729 3300048915 Unclassified 1252
165 Ga0501299_141702 3300049522 Unclassified 598
166 Ga0501038_0797715 3300049574 Bacteria 702
167 Ga0501076_0802367 3300049592 Bacteria 777
168 Ga0501076_1469095 3300049592 Bacteria 560
169 Ga0501079_0904721 3300049741 Bacteria 695
170 nmdc:mga05p37_168316_c1 3300050507 Bacteria 2674
171 nmdc:mga05p37_1740359_c1 3300050507 Bacteria 605
172 nmdc:mga05p37_82672_c1 3300050507 Bacteria 3957
173 nmdc:mga09592_1522419_c1 3300050508 Unclassified 544
174 nmdc:mga09592_1531137_c1 3300050508 Unclassified 542
175 nmdc:mga06r32_316487_c1 3300050510 Bacteria 1546
176 nmdc:mga0n895_328846_c1 3300050512 Unclassified 1549
177 nmdc:mga0rr50_41_c1 3300050513 Bacteria 82447
178 nmdc:mga08x19_803_c1 3300050514 Bacteria 20029
179 nmdc:mga0a205_823027_c1 3300050515 Unclassified 776
180 Ga0495619_0582567 3300053085 Unclassified 766
181 Ga0501082_1075542 3300060353 Bacteria 703
182 Ga0530510_0071966 3300061734 Bacteria 2510

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009147 Ga0114129_10493343 Ga0114129_104933433 65
2 3300036712 Ga0316584_0287163 Ga0316584_0287163_891_1118 74
3 3300005339 Ga0070660_100811391 Ga0070660_1008113913 79
4 3300005367 Ga0070667_100935419 Ga0070667_1009354192 79
5 3300005547 Ga0070693_100047838 Ga0070693_1000478383 79
6 3300005842 Ga0068858_100107502 Ga0068858_1001075022 79
7 3300005983 Ga0081540_1091290 Ga0081540_10912902 79
8 3300006914 Ga0075436_100000537 Ga0075436_10000053718 79
9 3300025986 Ga0207658_10912917 Ga0207658_109129173 79
10 3300031727 Ga0316576_10601049 Ga0316576_106010491 79
11 3300044712 Ga0453684_2127787 Ga0453684_2127787_291_530 79
12 3300044901 Ga0466960_0493822 Ga0466960_0493822_159_398 79
13 3300045051 Ga0451576_0006259 Ga0451576_0006259_9151_9390 79
14 3300049522 Ga0501299_141702 Ga0501299_141702_216_461 79
15 3300050513 nmdc:mga0rr50_41_c1 nmdc:mga0rr50_41_c1_37633_37872 79
16 3300050514 nmdc:mga08x19_803_c1 nmdc:mga08x19_803_c1_6808_7047 79
17 3300005290 Ga0065712_10295124 Ga0065712_102951242 80
18 3300005293 Ga0065715_10025944 Ga0065715_100259442 80
19 3300005295 Ga0065707_10937307 Ga0065707_109373071 80
20 3300005329 Ga0070683_100076630 Ga0070683_1000766306 80
21 3300005329 Ga0070683_100487114 Ga0070683_1004871143 80
22 3300005333 Ga0070677_10625003 Ga0070677_106250032 80
23 3300005336 Ga0070680_100819843 Ga0070680_1008198433 80
24 3300005337 Ga0070682_100000311 Ga0070682_10000031110 80
25 3300005345 Ga0070692_11393982 Ga0070692_113939821 80
26 3300005353 Ga0070669_102000987 Ga0070669_1020009871 80
27 3300005354 Ga0070675_100087016 Ga0070675_1000870165 80
28 3300005354 Ga0070675_100367376 Ga0070675_1003673763 80
29 3300005365 Ga0070688_100184370 Ga0070688_1001843702 80
30 3300005439 Ga0070711_100788940 Ga0070711_1007889401 80
31 3300005441 Ga0070700_100304726 Ga0070700_1003047262 80
32 3300005444 Ga0070694_101649917 Ga0070694_1016499171 80
33 3300005445 Ga0070708_100126384 Ga0070708_1001263842 80
34 3300005458 Ga0070681_10067695 Ga0070681_100676954 80
35 3300005458 Ga0070681_11040588 Ga0070681_110405883 80
36 3300005458 Ga0070681_11535853 Ga0070681_115358531 80
37 3300005467 Ga0070706_100112491 Ga0070706_1001124913 80
38 3300005468 Ga0070707_100018858 Ga0070707_1000188582 80
39 3300005468 Ga0070707_100702335 Ga0070707_1007023353 80
40 3300005468 Ga0070707_100712184 Ga0070707_1007121842 80
41 3300005471 Ga0070698_100019698 Ga0070698_1000196985 80
42 3300005518 Ga0070699_100716940 Ga0070699_1007169402 80
43 3300005535 Ga0070684_100139480 Ga0070684_1001394803 80
44 3300005544 Ga0070686_100070644 Ga0070686_1000706443 80
45 3300005545 Ga0070695_100058786 Ga0070695_1000587862 80
46 3300005545 Ga0070695_100347368 Ga0070695_1003473682 80
47 3300005547 Ga0070693_100201790 Ga0070693_1002017903 80
48 3300005549 Ga0070704_101748737 Ga0070704_1017487372 80
49 3300005563 Ga0068855_100018839 Ga0068855_1000188394 80
50 3300005563 Ga0068855_100437916 Ga0068855_1004379163 80
51 3300005578 Ga0068854_100186091 Ga0068854_1001860912 80
52 3300005719 Ga0068861_100264902 Ga0068861_1002649022 80
53 3300005985 Ga0081539_10108940 Ga0081539_101089403 80
54 3300006163 Ga0070715_10810485 Ga0070715_108104851 80
55 3300006173 Ga0070716_100000001 Ga0070716_100000001186 80
56 3300006173 Ga0070716_101145574 Ga0070716_1011455742 80
57 3300006871 Ga0075434_100452184 Ga0075434_1004521842 80
58 3300006871 Ga0075434_101712540 Ga0075434_1017125402 80
59 3300006880 Ga0075429_101783721 Ga0075429_1017837212 80
60 3300007265 Ga0099794_10012774 Ga0099794_100127743 80
61 3300009093 Ga0105240_10046726 Ga0105240_100467267 80
62 3300009098 Ga0105245_10971864 Ga0105245_109718642 80
63 3300009147 Ga0114129_10276943 Ga0114129_102769433 80
64 3300009147 Ga0114129_10604009 Ga0114129_106040092 80
65 3300009147 Ga0114129_10722008 Ga0114129_107220083 80
66 3300009174 Ga0105241_10582454 Ga0105241_105824542 80
67 3300009176 Ga0105242_10426904 Ga0105242_104269043 80
68 3300009545 Ga0105237_10939639 Ga0105237_109396393 80
69 3300009545 Ga0105237_11868158 Ga0105237_118681582 80
70 3300011119 Ga0105246_10383456 Ga0105246_103834561 80
71 3300013104 Ga0157370_10048387 Ga0157370_100483873 80
72 3300013104 Ga0157370_10092605 Ga0157370_100926052 80
73 3300013104 Ga0157370_10298001 Ga0157370_102980012 80
74 3300013105 Ga0157369_10284937 Ga0157369_102849373 80
75 3300013296 Ga0157374_11261155 Ga0157374_112611552 80
76 3300013307 Ga0157372_10083476 Ga0157372_100834767 80
77 3300013307 Ga0157372_12188836 Ga0157372_121888362 80
78 3300013308 Ga0157375_10624451 Ga0157375_106244512 80
79 3300013308 Ga0157375_12570659 Ga0157375_125706592 80
80 3300014326 Ga0157380_10253792 Ga0157380_102537923 80
81 3300014326 Ga0157380_10618972 Ga0157380_106189722 80
82 3300014968 Ga0157379_11502950 Ga0157379_115029502 80
83 3300017792 Ga0163161_11037782 Ga0163161_110377822 80
84 3300020081 Ga0206354_10031652 Ga0206354_100316521 80
85 3300022467 Ga0224712_10378681 Ga0224712_103786812 80
86 3300025901 Ga0207688_10480968 Ga0207688_104809683 80
87 3300025907 Ga0207645_10353255 Ga0207645_103532552 80
88 3300025910 Ga0207684_10030570 Ga0207684_100305702 80
89 3300025910 Ga0207684_11378861 Ga0207684_113788612 80
90 3300025912 Ga0207707_10115558 Ga0207707_101155582 80
91 3300025913 Ga0207695_10003129 Ga0207695_1000312910 80
92 3300025913 Ga0207695_10204494 Ga0207695_102044944 80
93 3300025916 Ga0207663_10300229 Ga0207663_103002293 80
94 3300025919 Ga0207657_10703590 Ga0207657_107035902 80
95 3300025922 Ga0207646_10002239 Ga0207646_100022397 80
96 3300025922 Ga0207646_10552647 Ga0207646_105526472 80
97 3300025926 Ga0207659_10061315 Ga0207659_100613152 80
98 3300025927 Ga0207687_10312457 Ga0207687_103124573 80
99 3300025933 Ga0207706_10027888 Ga0207706_100278885 80
100 3300025936 Ga0207670_10000002 Ga0207670_10000002377 80
101 3300025939 Ga0207665_10000002 Ga0207665_1000000264 80
102 3300025939 Ga0207665_11336891 Ga0207665_113368912 80
103 3300025944 Ga0207661_10142598 Ga0207661_101425982 80
104 3300025944 Ga0207661_11500350 Ga0207661_115003502 80
105 3300025949 Ga0207667_10228108 Ga0207667_102281082 80
106 3300025949 Ga0207667_10479250 Ga0207667_104792501 80
107 3300026075 Ga0207708_10374402 Ga0207708_103744022 80
108 3300026116 Ga0207674_10301657 Ga0207674_103016572 80
109 3300026118 Ga0207675_100082983 Ga0207675_1000829835 80
110 3300026118 Ga0207675_102475295 Ga0207675_1024752951 80
111 3300027671 Ga0209588_1012046 Ga0209588_10120462 80
112 3300027671 Ga0209588_1197130 Ga0209588_11971302 80
113 3300028577 Ga0265318_10098008 Ga0265318_100980082 80
114 3300028666 Ga0265336_10013871 Ga0265336_100138715 80
115 3300028800 Ga0265338_10903131 Ga0265338_109031311 80
116 3300031090 Ga0265760_10338608 Ga0265760_103386081 80
117 3300031691 Ga0316579_10008473 Ga0316579_100084734 80
118 3300031691 Ga0316579_10019111 Ga0316579_100191114 80
119 3300031691 Ga0316579_10107337 Ga0316579_101073372 80
120 3300031691 Ga0316579_10124268 Ga0316579_101242682 80
121 3300031728 Ga0316578_10091813 Ga0316578_100918132 80
122 3300031728 Ga0316578_10150470 Ga0316578_101504703 80
123 3300031733 Ga0316577_10005295 Ga0316577_100052956 80
124 3300031733 Ga0316577_10066340 Ga0316577_100663402 80
125 3300031733 Ga0316577_10074799 Ga0316577_100747992 80
126 3300031733 Ga0316577_10219196 Ga0316577_102191962 80
127 3300032168 Ga0316593_10055858 Ga0316593_100558582 80
128 3300032168 Ga0316593_10253297 Ga0316593_102532973 80
129 3300035725 Ga0373947_0825648 Ga0373947_0825648_180_422 80
130 3300036647 Ga0316582_0010269 Ga0316582_0010269_348_593 80
131 3300036647 Ga0316582_0031613 Ga0316582_0031613_2160_2405 80
132 3300036647 Ga0316582_0199755 Ga0316582_0199755_617_862 80
133 3300036647 Ga0316582_0330959 Ga0316582_0330959_250_495 80
134 3300036647 Ga0316582_0380858 Ga0316582_0380858_647_892 80
135 3300036647 Ga0316582_0443555 Ga0316582_0443555_61_306 80
136 3300036712 Ga0316584_0008861 Ga0316584_0008861_258_503 80
137 3300036712 Ga0316584_0248376 Ga0316584_0248376_775_1020 80
138 3300036712 Ga0316584_0432732 Ga0316584_0432732_186_431 80
139 3300036712 Ga0316584_0596139 Ga0316584_0596139_381_626 80
140 3300037312 Ga0395899_0761624 Ga0395899_0761624_39_281 80
141 3300037418 Ga0395900_0161504 Ga0395900_0161504_215_457 80
142 3300037418 Ga0395900_0231540 Ga0395900_0231540_973_1215 80
143 3300037466 Ga0395898_0533696 Ga0395898_0533696_287_529 80
144 3300037471 Ga0395905_0239576 Ga0395905_0239576_533_775 80
145 3300037588 Ga0316581_0004125 Ga0316581_0004125_3382_3627 80
146 3300037588 Ga0316581_0027048 Ga0316581_0027048_1157_1402 80
147 3300038443 Ga0395901_2082380 Ga0395901_2082380_116_358 80
148 3300039110 Ga0400487_05582 Ga0400487_05582_25822_26070 80
149 3300041408 Ga0439453_0059347 Ga0439453_0059347_187_432 80
150 3300042876 Ga0451577_0001499 Ga0451577_0001499_17490_17735 80
151 3300042876 Ga0451577_0011941 Ga0451577_0011941_4748_4996 80
152 3300044673 Ga0453683_0009742 Ga0453683_0009742_5319_5564 80
153 3300044712 Ga0453684_0000698 Ga0453684_0000698_96561_96806 80
154 3300044712 Ga0453684_0195952 Ga0453684_0195952_1522_1764 80
155 3300044712 Ga0453684_0654742 Ga0453684_0654742_307_555 80
156 3300045051 Ga0451576_0009132 Ga0451576_0009132_4870_5115 80
157 3300045051 Ga0451576_0066859 Ga0451576_0066859_102_344 80
158 3300045976 Ga0466967_0710874 Ga0466967_0710874_362_604 80
159 3300046512 Ga0495610_0075791 Ga0495610_0075791_815_1060 80
160 3300046525 Ga0495663_0000154 Ga0495663_0000154_4089_4334 80
161 3300046525 Ga0495663_0073307 Ga0495663_0073307_533_778 80
162 3300046535 Ga0495586_0646597 Ga0495586_0646597_30_272 80
163 3300046537 Ga0495598_0000595 Ga0495598_0000595_5191_5436 80
164 3300046539 Ga0495621_0000982 Ga0495621_0000982_6416_6661 80
165 3300046539 Ga0495621_0004181 Ga0495621_0004181_2239_2484 80
166 3300047317 Ga0495604_0583921 Ga0495604_0583921_86_328 80
167 3300048915 Ga0496112_0433729 Ga0496112_0433729_429_671 80
168 3300049574 Ga0501038_0797715 Ga0501038_0797715_250_495 80
169 3300049592 Ga0501076_0802367 Ga0501076_0802367_111_359 80
170 3300049592 Ga0501076_1469095 Ga0501076_1469095_158_403 80
171 3300049741 Ga0501079_0904721 Ga0501079_0904721_56_301 80
172 3300050507 nmdc:mga05p37_168316_c1 nmdc:mga05p37_168316_c1_859_1101 80
173 3300050507 nmdc:mga05p37_1740359_c1 nmdc:mga05p37_1740359_c1_136_384 80
174 3300050507 nmdc:mga05p37_82672_c1 nmdc:mga05p37_82672_c1_891_1136 80
175 3300050508 nmdc:mga09592_1522419_c1 nmdc:mga09592_1522419_c1_261_503 80
176 3300050508 nmdc:mga09592_1531137_c1 nmdc:mga09592_1531137_c1_221_463 80
177 3300050510 nmdc:mga06r32_316487_c1 nmdc:mga06r32_316487_c1_929_1174 80
178 3300050512 nmdc:mga0n895_328846_c1 nmdc:mga0n895_328846_c1_47_289 80
179 3300050515 nmdc:mga0a205_823027_c1 nmdc:mga0a205_823027_c1_331_573 80
180 3300053085 Ga0495619_0582567 Ga0495619_0582567_351_599 80
181 3300060353 Ga0501082_1075542 Ga0501082_1075542_341_583 80
182 3300061734 Ga0530510_0071966 Ga0530510_0071966_745_990 80

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07927

HicA_toxin

HicA toxin of bacterial toxin-antitoxin,

9

65

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1tdf-assembly1.cif.gz_A crystal structure of escherichia coli thioredoxin reductase refined at 2 angstrom resolution: implications for a large conformational change during catalysis 0.8711 21 47
5yrz-assembly1.cif.gz_D toxin-antitoxin complex from streptococcus pneumoniae 0.8653 4 64
5yrz-assembly1.cif.gz_D toxin-antitoxin complex from streptococcus pneumoniae 0.8387 4 64
4g74-assembly1.cif.gz_A crystal structure of ndh with quinone 0.8194 21 46
6g26-assembly1.cif.gz_F the crystal structure of the burkholderia pseudomallei hicab complex 0.8184 7 61
ID Description Score Start End Superfamily
af_P41890_5_329_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9319 54 78 3.20.20.140
5yrzD00 Alpha Beta;2-Layer Sandwich;Metal Transport, Frataxin; Chain A;Hypothetical protein. 0.8653 4 64 3.30.920.30
5yrzD00 Alpha Beta;2-Layer Sandwich;Metal Transport, Frataxin; Chain A;Hypothetical protein. 0.8387 4 64 3.30.920.30
af_Q54ZV3_691_741_2.30.30.60 Mainly Beta;Roll;SH3 type barrels.; 0.8309 21 47 2.30.30.60
4u99B00 Alpha Beta;Alpha-Beta Complex;H-NOX domain;H-NOX domain 0.8274 47 75 3.90.1520.10
ID Description Score Start End GO Terms
AF-A0A1B7VF26-F1-model_v4 Periplasmic or secreted lipoprotein 0.995 1 79 GO:0003729
GO:0004519
AF-A0A1H3DHM9-F1-model_v4 Predicted RNA binding protein YcfA, dsRBD-like fold, HicA-like mRNA interferase family 0.992 1 79 GO:0003729
GO:0004519
AF-A0A349JF85-F1-model_v4 Type II toxin-antitoxin system HicA family toxin 0.9919 1 80 GO:0003729
GO:0004519
AF-A0A532E0I8-F1-model_v4 Type II toxin-antitoxin system HicA family toxin 0.9893 1 62 GO:0003729
GO:0004519
AF-A0A1G3QQK5-F1-model_v4 Addiction module toxin, HicA family 0.9869 1 77 GO:0003729
GO:0004519

Feature Viewer

pLDDT pTM Quality
93.49 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map