F279797

General Info

Members Datasets Scaffolds Average Seq Length
182 120 158 362

Family's Representative Sequence

Representative Sequence 3300048924|Ga0496121_0000079|Ga0496121_0000079_222480_223796
Length 438
Sequence MASLLGIEMSEQTGRLAVPEKSSFFRRFYLDQCTPALIRSFPATSGSDSHLPLENGTSPQAGRLWWFAEEIHMPPITPVRFSPAVEDVAPDEAKTIEGLNDAFDLILERTSEDGGHAIRSVHAKSHGILEGELTIDGGLPPELAQGLFANPGIHKVVLRMSTNAGDILPDSVSLPRGLAIKVLDVEGERLPGADGNTQDFVMVNGPVFQAKTAEKFLGNLRMLAKTTDRMERTKVALSAVLRGINMALGAVGIESSAVNSLGGAPNVEPLGETYYSATPFRHGDYIAKFSLRPVEPAMTALTGKIIDVDGRDNAIREDVRDEMRSIDAVWEFRVQLCRDLEKQPIEDSTVEWSEDEAPFQRVGIIRANAQDSWQQERVRDVEDTMRFSVWTGLAAHQPLGNINRVRRDTYRHSADFRAAFNHCPYHEPATNPEKSITE

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
3 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
4 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
5 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
6 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
7 2643221558 Rhizobium sp. Root149 Isolate Unclassified
8 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
9 2643221568 Rhizobium sp. Root564 Isolate Unclassified
10 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
11 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
12 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
13 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
14 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
15 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
16 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
17 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
18 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
19 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
20 2902330777 Methylobacterium sp. 2A Isolate Unclassified
21 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
22 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
23 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
24 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
25 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
26 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
27 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
28 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
29 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
30 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
31 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
32 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
33 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
45 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
48 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
50 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
51 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
52 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
53 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
54 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
56 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
57 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
58 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
59 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
73 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
74 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
75 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
76 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
77 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
78 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
79 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
80 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
81 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
82 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
83 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
84 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
85 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
86 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
87 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
88 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
89 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
90 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
91 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
92 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
93 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
94 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
95 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
96 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
97 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
98 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
99 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
100 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
101 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
102 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
103 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
104 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
105 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
106 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
107 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
108 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
109 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
110 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
111 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
115 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
116 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
117 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
118 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
119 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
120 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.81
Metatranscriptomes 0
Isolates 13.19

Biome Distribution

Category Percentage (%)
Aerial Root 0.55
Bulb 0
Endosphere 18.68
Nodule 0
Rhizoplane 6.04
Rhizosphere 36.81
Stem 0
Stem Tuber 0
Unclassified 37.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1733293 2162886007 Bacteria 15656
2 JGI25152J39213_1000829 3300002773 Bacteria 15367
3 JGI25150J39212_1000537 3300002774 Bacteria 15372
4 JGI25151J46595_10001067 3300003187 Bacteria 20456
5 JGI25151J46595_10001675 3300003187 Bacteria 14507
6 JGI25153J46596_10004001 3300003215 Bacteria 8048
7 rootL2_10038199 3300003322 Bacteria 16331
8 rootH1_10005488 3300003323 Bacteria 5937
9 Ga0055524_1009128 3300003775 Bacteria 4058
10 Ga0055528_1001234 3300003790 Bacteria 16310
11 Ga0070666_10147478 3300005335 Bacteria 1640
12 Ga0070668_100005150 3300005347 Bacteria 9695
13 Ga0070669_100001397 3300005353 Bacteria 17434
14 Ga0070671_100014526 3300005355 Bacteria 6366
15 Ga0070667_100012977 3300005367 Bacteria 6890
16 Ga0070665_100007079 3300005548 Bacteria 11396
17 Ga0068855_100000276 3300005563 Bacteria 63303
18 Ga0068855_100419504 3300005563 Bacteria 1464
19 Ga0068862_100058497 3300005844 Bacteria 3306
20 Ga0075364_10000957 3300006051 Bacteria 15215
21 Ga0105240_10013410 3300009093 Bacteria 11255
22 Ga0105240_10013733 3300009093 Bacteria 11100
23 Ga0105240_10040509 3300009093 Bacteria 5956
24 Ga0105248_10087095 3300009177 Bacteria 3514
25 Ga0157371_10010871 3300013102 Bacteria 7061
26 Ga0157370_10032711 3300013104 Bacteria 5077
27 Ga0157369_10165505 3300013105 Bacteria 2332
28 Ga0157372_10291802 3300013307 Bacteria 1897
29 Ga0209147_100455 3300025229 Bacteria 25651
30 Ga0207427_100158 3300025231 Bacteria 76687
31 Ga0207425_1000261 3300025245 Bacteria 38979
32 Ga0209129_1000166 3300025258 Bacteria 97875
33 Ga0209129_1000328 3300025258 Bacteria 41383
34 Ga0209673_1000416 3300025273 Bacteria 74754
35 Ga0209130_1019305 3300025284 Unclassified 1583
36 Ga0209676_1032714 3300025292 Bacteria 1560
37 Ga0209025_1000336 3300025294 Bacteria 103514
38 Ga0209025_1001099 3300025294 Bacteria 38979
39 Ga0209025_1002650 3300025294 Bacteria 18304
40 Ga0209564_1011314 3300025295 Bacteria 4010
41 Ga0209758_1000958 3300025297 Bacteria 38979
42 Ga0209256_1001363 3300025299 Bacteria 25683
43 Ga0209051_1021610 3300025303 Bacteria 2732
44 Ga0207696_1005937 3300025711 Bacteria 4994
45 Ga0207713_1025721 3300025735 Bacteria 2711
46 Ga0207713_1028309 3300025735 Bacteria 2530
47 Ga0207680_10190534 3300025903 Bacteria 1392
48 Ga0207695_10086588 3300025913 Bacteria 3159
49 Ga0207695_10249553 3300025913 Bacteria 1674
50 Ga0207681_10055359 3300025923 Bacteria 2701
51 Ga0207644_10015023 3300025931 Bacteria 5193
52 Ga0207711_10188539 3300025941 Bacteria 1878
53 Ga0207667_10007833 3300025949 Bacteria 12762
54 Ga0207668_10022989 3300025972 Bacteria 3999
55 Ga0207658_10001951 3300025986 Bacteria 15407
56 Ga0268266_10043736 3300028379 Bacteria 3828
57 Ga0268265_10057108 3300028380 Bacteria 2973
58 Ga0265336_10000006 3300028666 Bacteria 348453
59 Ga0307412_10008477 3300031911 Bacteria 5871
60 Ga0395905_0000172 3300037471 Bacteria 105228
61 Ga0495627_000632 3300046453 Bacteria 27766
62 Ga0495627_002394 3300046453 Bacteria 9105
63 Ga0495650_0002269 3300046471 Bacteria 16023
64 Ga0495583_0000331 3300046506 Bacteria 74785
65 Ga0495606_0002742 3300046507 Bacteria 19777
66 Ga0495606_0128379 3300046507 Bacteria 1510
67 Ga0495610_0000585 3300046512 Bacteria 36085
68 Ga0495610_0001469 3300046512 Bacteria 20783
69 Ga0495610_0005934 3300046512 Bacteria 8555
70 Ga0495632_0001547 3300046519 Bacteria 18996
71 Ga0495637_0013047 3300046520 Bacteria 3957
72 Ga0495648_0090252 3300046524 Bacteria 1718
73 Ga0495625_0021406 3300046660 Bacteria 4980
74 Ga0495669_0008799 3300046684 Bacteria 4253
75 Ga0495671_0121154 3300046692 Bacteria 1276
76 Ga0495649_0001513 3300046694 Bacteria 17457
77 Ga0495672_0049771 3300047320 Bacteria 2478
78 Ga0495681_0000130 3300047470 Bacteria 65799
79 Ga0495686_0009874 3300047472 Bacteria 6839
80 Ga0495686_0022874 3300047472 Bacteria 4130
81 Ga0495626_0004641 3300048091 Bacteria 8348
82 Ga0496100_0109165 3300048903 Bacteria 1919
83 Ga0496102_0000295 3300048905 Bacteria 63973
84 Ga0496103_0000111 3300048906 Bacteria 89596
85 Ga0496104_0002963 3300048907 Bacteria 14627
86 Ga0496105_0000381 3300048908 Bacteria 29098
87 Ga0496111_0001832 3300048914 Bacteria 12514
88 Ga0496111_0037390 3300048914 Bacteria 3474
89 Ga0496112_0010948 3300048915 Bacteria 8260
90 Ga0496113_0000124 3300048916 Bacteria 33183
91 Ga0496115_0029193 3300048918 Bacteria 4330
92 Ga0496116_0000042 3300048919 Bacteria 330516
93 Ga0496116_0001940 3300048919 Bacteria 22279
94 Ga0496116_0017922 3300048919 Bacteria 5476
95 Ga0496116_0030849 3300048919 Bacteria 3845
96 Ga0496116_0046425 3300048919 Bacteria 2931
97 Ga0496116_0075119 3300048919 Bacteria 2122
98 Ga0496117_0001258 3300048920 Bacteria 37710
99 Ga0496118_0037370 3300048921 Bacteria 3908
100 Ga0496118_0137097 3300048921 Bacteria 1559
101 Ga0496119_0000838 3300048922 Bacteria 40796
102 Ga0496121_0000079 3300048924 Bacteria 232653
103 Ga0496121_0000512 3300048924 Bacteria 73820
104 Ga0496121_0004795 3300048924 Bacteria 17829
105 Ga0496121_0006670 3300048924 Bacteria 14200
106 Ga0496121_0090645 3300048924 Bacteria 2389
107 Ga0496121_0160623 3300048924 Bacteria 1643
108 Ga0496121_0217947 3300048924 Bacteria 1346
109 Ga0496122_0000269 3300048925 Bacteria 116292
110 Ga0496122_0005407 3300048925 Bacteria 15240
111 Ga0496122_0009399 3300048925 Bacteria 10313
112 Ga0496122_0019808 3300048925 Bacteria 6125
113 Ga0496122_0022732 3300048925 Bacteria 5562
114 Ga0496122_0028885 3300048925 Bacteria 4691
115 Ga0496122_0031752 3300048925 Bacteria 4384
116 Ga0496122_0058520 3300048925 Bacteria 2852
117 Ga0496122_0129464 3300048925 Bacteria 1607
118 Ga0496123_0000737 3300048926 Bacteria 53083
119 Ga0496123_0007759 3300048926 Bacteria 10012
120 Ga0496123_0032052 3300048926 Bacteria 3813
121 Ga0496123_0038309 3300048926 Bacteria 3371
122 Ga0496123_0039516 3300048926 Bacteria 3299
123 Ga0496124_0000080 3300048927 Bacteria 210439
124 Ga0496124_0002360 3300048927 Bacteria 24907
125 Ga0496124_0004450 3300048927 Bacteria 16341
126 Ga0496124_0005493 3300048927 Bacteria 14227
127 Ga0496124_0025383 3300048927 Bacteria 5367
128 Ga0496124_0053020 3300048927 Bacteria 3441
129 Ga0496124_0090879 3300048927 Bacteria 2489
130 Ga0496124_0096385 3300048927 Bacteria 2403
131 Ga0496124_0280354 3300048927 Bacteria 1215
132 Ga0496125_0000034 3300048928 Bacteria 348231
133 Ga0496125_0003682 3300048928 Bacteria 18307
134 Ga0496125_0045780 3300048928 Bacteria 3677
135 Ga0496126_0000053 3300048929 Bacteria 311989
136 Ga0496126_0000219 3300048929 Bacteria 125157
137 Ga0496126_0002532 3300048929 Bacteria 24465
138 Ga0496126_0010506 3300048929 Bacteria 9695
139 Ga0496126_0019723 3300048929 Bacteria 6634
140 Ga0496126_0032295 3300048929 Bacteria 4933
141 Ga0496126_0040819 3300048929 Bacteria 4300
142 Ga0496126_0051719 3300048929 Bacteria 3738
143 Ga0495678_001605 3300049459 Bacteria 17313
144 Ga0501032_0017698 3300049569 Bacteria 5002
145 Ga0501033_0000486 3300049570 Bacteria 37382
146 Ga0501035_0001902 3300049822 Bacteria 20971
147 Ga0501044_0000058 3300049823 Bacteria 135713
148 nmdc:mga00v17_47609_c1 3300050491 Bacteria 2597
149 nmdc:mga00v17_68_c1 3300050491 Bacteria 62705
150 Ga0500635_0000007 3300053080 Bacteria 169379
151 Ga0500635_0000613 3300053080 Bacteria 9314
152 Ga0500635_0011734 3300053080 Bacteria 2500
153 Ga0500618_000111 3300053125 Bacteria 65821
154 Ga0500618_000154 3300053125 Bacteria 56791
155 Ga0500559_0004331 3300053136 Bacteria 6767
156 Ga0500559_0004975 3300053136 Bacteria 6177
157 Ga0500559_0049223 3300053136 Bacteria 1856
158 Ga0500636_0018208 3300053177 Bacteria 4153

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046453 Ga0495627_000632 Ga0495627_000632_16608_17765 334
2 3300046524 Ga0495648_0090252 Ga0495648_0090252_351_1529 336
3 3300047470 Ga0495681_0000130 Ga0495681_0000130_16715_17905 338
4 3300025229 Ga0209147_100455 Ga0209147_10045510 340
5 3300046453 Ga0495627_002394 Ga0495627_002394_898_2088 340
6 3300046512 Ga0495610_0000585 Ga0495610_0000585_13039_14229 340
7 3300047472 Ga0495686_0022874 Ga0495686_0022874_2468_3658 340
8 3300049459 Ga0495678_001605 Ga0495678_001605_7587_8765 340
9 3300003323 rootH1_10005488 rootH1_100054882 341
10 3300003322 rootL2_10038199 rootL2_100381994 343
11 iso_pu_bacteria 2585427594 2585847476 352
12 iso_pu_bacteria 2595698237 2596375271 352
13 iso_pu_bacteria 2738541281 2738747108 352
14 iso_pu_bacteria 2738543032 2739356337 352
15 iso_pu_bacteria 2751185897 2753763560 352
16 iso_pu_bacteria 2861691609 2861695835 352
17 iso_pu_bacteria 2902330777 2902336190 352
18 iso_pu_bacteria 2928125067 2928126515 352
19 iso_pu_bacteria 2643221563 2643833847 353
20 iso_pu_bacteria 2643221568 2643857020 353
21 iso_pu_bacteria 2643221608 2644054773 353
22 iso_pu_bacteria 2643221689 2644498145 353
23 iso_pu_bacteria 2830075706 2830079219 353
24 iso_pu_bacteria 2894817345 2894822256 353
25 iso_pu_bacteria 2919166419 2919170137 353
26 iso_pu_bacteria 2978969890 2978970206 353
27 iso_pu_bacteria 2984587000 2984587233 353
28 3300048925 Ga0496122_0028885 Ga0496122_0028885_2894_4003 354
29 3300048926 Ga0496123_0032052 Ga0496123_0032052_1714_2823 354
30 3300048927 Ga0496124_0004450 Ga0496124_0004450_3841_4950 354
31 iso_pu_bacteria 2600254933 2600376239 354
32 iso_pu_bacteria 2643221558 2643811223 354
33 iso_pu_bacteria 2818991461 2819688841 354
34 iso_pu_bacteria 2821123053 2821130097 354
35 iso_pu_bacteria 8054302542 8054303138 354
36 3300003775 Ga0055524_1009128 Ga0055524_10091284 356
37 3300003790 Ga0055528_1001234 Ga0055528_100123418 356
38 3300009093 Ga0105240_10013410 Ga0105240_100134102 356
39 3300025273 Ga0209673_1000416 Ga0209673_100041625 356
40 3300025292 Ga0209676_1032714 Ga0209676_10327141 356
41 3300025294 Ga0209025_1002650 Ga0209025_100265011 356
42 3300025295 Ga0209564_1011314 Ga0209564_10113144 356
43 3300025299 Ga0209256_1001363 Ga0209256_10013632 356
44 3300025303 Ga0209051_1021610 Ga0209051_10216102 356
45 3300031911 Ga0307412_10008477 Ga0307412_100084772 356
46 3300047320 Ga0495672_0049771 Ga0495672_0049771_488_1561 356
47 3300048903 Ga0496100_0109165 Ga0496100_0109165_162_1232 356
48 3300048905 Ga0496102_0000295 Ga0496102_0000295_8412_9482 356
49 3300048906 Ga0496103_0000111 Ga0496103_0000111_1482_2552 356
50 3300048907 Ga0496104_0002963 Ga0496104_0002963_1457_2527 356
51 3300048908 Ga0496105_0000381 Ga0496105_0000381_26555_27625 356
52 3300048914 Ga0496111_0037390 Ga0496111_0037390_870_1940 356
53 3300048915 Ga0496112_0010948 Ga0496112_0010948_7022_8092 356
54 3300048916 Ga0496113_0000124 Ga0496113_0000124_23504_24574 356
55 3300048918 Ga0496115_0029193 Ga0496115_0029193_1579_2649 356
56 3300048919 Ga0496116_0001940 Ga0496116_0001940_7583_8656 356
57 3300048919 Ga0496116_0030849 Ga0496116_0030849_1856_2926 356
58 3300048919 Ga0496116_0075119 Ga0496116_0075119_230_1303 356
59 3300048920 Ga0496117_0001258 Ga0496117_0001258_26673_27743 356
60 3300048921 Ga0496118_0037370 Ga0496118_0037370_569_1639 356
61 3300048922 Ga0496119_0000838 Ga0496119_0000838_1474_2544 356
62 3300048924 Ga0496121_0004795 Ga0496121_0004795_6698_7771 356
63 3300048924 Ga0496121_0160623 Ga0496121_0160623_99_1169 356
64 3300048925 Ga0496122_0000269 Ga0496122_0000269_54495_55565 356
65 3300048925 Ga0496122_0009399 Ga0496122_0009399_7970_9043 356
66 3300048926 Ga0496123_0000737 Ga0496123_0000737_5339_6409 356
67 3300048926 Ga0496123_0038309 Ga0496123_0038309_2031_3104 356
68 3300048927 Ga0496124_0002360 Ga0496124_0002360_9922_10992 356
69 3300048927 Ga0496124_0005493 Ga0496124_0005493_11373_12446 356
70 3300048927 Ga0496124_0053020 Ga0496124_0053020_1347_2420 356
71 3300048928 Ga0496125_0000034 Ga0496125_0000034_274950_276023 356
72 3300048928 Ga0496125_0003682 Ga0496125_0003682_7151_8221 356
73 3300048929 Ga0496126_0000219 Ga0496126_0000219_69593_70663 356
74 3300048929 Ga0496126_0051719 Ga0496126_0051719_1048_2121 356
75 3300049569 Ga0501032_0017698 Ga0501032_0017698_1657_2739 356
76 3300049570 Ga0501033_0000486 Ga0501033_0000486_35568_36650 356
77 3300049822 Ga0501035_0001902 Ga0501035_0001902_3632_4714 356
78 3300049823 Ga0501044_0000058 Ga0501044_0000058_49235_50317 356
79 3300053080 Ga0500635_0000613 Ga0500635_0000613_7527_8693 356
80 3300053136 Ga0500559_0049223 Ga0500559_0049223_550_1641 356
81 3300002773 JGI25152J39213_1000829 JGI25152J39213_100082918 357
82 3300002774 JGI25150J39212_1000537 JGI25150J39212_10005373 357
83 3300003187 JGI25151J46595_10001067 JGI25151J46595_100010673 357
84 3300003187 JGI25151J46595_10001675 JGI25151J46595_100016753 357
85 3300003215 JGI25153J46596_10004001 JGI25153J46596_100040014 357
86 3300005563 Ga0068855_100000276 Ga0068855_10000027611 357
87 3300005563 Ga0068855_100419504 Ga0068855_1004195042 357
88 3300006051 Ga0075364_10000957 Ga0075364_1000095716 357
89 3300009093 Ga0105240_10013733 Ga0105240_1001373310 357
90 3300009093 Ga0105240_10040509 Ga0105240_100405094 357
91 3300013102 Ga0157371_10010871 Ga0157371_100108712 357
92 3300013104 Ga0157370_10032711 Ga0157370_100327114 357
93 3300013105 Ga0157369_10165505 Ga0157369_101655051 357
94 3300013307 Ga0157372_10291802 Ga0157372_102918022 357
95 3300025231 Ga0207427_100158 Ga0207427_10015843 357
96 3300025245 Ga0207425_1000261 Ga0207425_10002613 357
97 3300025258 Ga0209129_1000166 Ga0209129_100016612 357
98 3300025258 Ga0209129_1000328 Ga0209129_10003283 357
99 3300025284 Ga0209130_1019305 Ga0209130_10193051 357
100 3300025294 Ga0209025_1000336 Ga0209025_100033615 357
101 3300025294 Ga0209025_1001099 Ga0209025_10010993 357
102 3300025297 Ga0209758_1000958 Ga0209758_10009583 357
103 3300025913 Ga0207695_10086588 Ga0207695_100865883 357
104 3300025913 Ga0207695_10249553 Ga0207695_102495532 357
105 3300025949 Ga0207667_10007833 Ga0207667_100078334 357
106 3300028666 Ga0265336_10000006 Ga0265336_10000006151 357
107 3300037471 Ga0395905_0000172 Ga0395905_0000172_83555_84709 357
108 3300046471 Ga0495650_0002269 Ga0495650_0002269_11159_12274 357
109 3300046506 Ga0495583_0000331 Ga0495583_0000331_61158_62270 357
110 3300046507 Ga0495606_0002742 Ga0495606_0002742_12572_13684 357
111 3300046507 Ga0495606_0128379 Ga0495606_0128379_10_1083 357
112 3300046512 Ga0495610_0001469 Ga0495610_0001469_18798_19871 357
113 3300046512 Ga0495610_0005934 Ga0495610_0005934_4716_5798 357
114 3300046519 Ga0495632_0001547 Ga0495632_0001547_3405_4481 357
115 3300046520 Ga0495637_0013047 Ga0495637_0013047_1488_2666 357
116 3300046660 Ga0495625_0021406 Ga0495625_0021406_3021_4133 357
117 3300046684 Ga0495669_0008799 Ga0495669_0008799_1092_2204 357
118 3300046692 Ga0495671_0121154 Ga0495671_0121154_137_1249 357
119 3300046694 Ga0495649_0001513 Ga0495649_0001513_12486_13598 357
120 3300047472 Ga0495686_0009874 Ga0495686_0009874_2517_3590 357
121 3300048091 Ga0495626_0004641 Ga0495626_0004641_1247_2329 357
122 3300048914 Ga0496111_0001832 Ga0496111_0001832_4906_5982 357
123 3300048919 Ga0496116_0000042 Ga0496116_0000042_168093_169166 357
124 3300048919 Ga0496116_0017922 Ga0496116_0017922_1125_2198 357
125 3300048921 Ga0496118_0137097 Ga0496118_0137097_268_1344 357
126 3300048924 Ga0496121_0000079 Ga0496121_0000079_222480_223796 357
127 3300048924 Ga0496121_0000512 Ga0496121_0000512_64015_65136 357
128 3300048924 Ga0496121_0006670 Ga0496121_0006670_7644_8720 357
129 3300048924 Ga0496121_0090645 Ga0496121_0090645_166_1242 357
130 3300048924 Ga0496121_0217947 Ga0496121_0217947_67_1143 357
131 3300048925 Ga0496122_0005407 Ga0496122_0005407_8108_9184 357
132 3300048925 Ga0496122_0019808 Ga0496122_0019808_3612_4688 357
133 3300048925 Ga0496122_0022732 Ga0496122_0022732_1819_2895 357
134 3300048925 Ga0496122_0031752 Ga0496122_0031752_1460_2536 357
135 3300048925 Ga0496122_0058520 Ga0496122_0058520_1612_2685 357
136 3300048925 Ga0496122_0129464 Ga0496122_0129464_257_1411 357
137 3300048926 Ga0496123_0007759 Ga0496123_0007759_4174_5250 357
138 3300048926 Ga0496123_0039516 Ga0496123_0039516_1384_2538 357
139 3300048927 Ga0496124_0000080 Ga0496124_0000080_200385_201458 357
140 3300048927 Ga0496124_0025383 Ga0496124_0025383_906_1982 357
141 3300048927 Ga0496124_0090879 Ga0496124_0090879_670_1746 357
142 3300048927 Ga0496124_0096385 Ga0496124_0096385_1241_2317 357
143 3300048927 Ga0496124_0280354 Ga0496124_0280354_25_1149 357
144 3300048928 Ga0496125_0045780 Ga0496125_0045780_32_1108 357
145 3300048929 Ga0496126_0000053 Ga0496126_0000053_146017_147090 357
146 3300048929 Ga0496126_0002532 Ga0496126_0002532_15017_16093 357
147 3300048929 Ga0496126_0010506 Ga0496126_0010506_8007_9128 357
148 3300048929 Ga0496126_0019723 Ga0496126_0019723_3669_4985 357
149 3300048929 Ga0496126_0032295 Ga0496126_0032295_680_1756 357
150 3300048929 Ga0496126_0040819 Ga0496126_0040819_729_1805 357
151 3300050491 nmdc:mga00v17_47609_c1 nmdc:mga00v17_47609_c1_88_1167 357
152 3300050491 nmdc:mga00v17_68_c1 nmdc:mga00v17_68_c1_61270_62349 357
153 3300053080 Ga0500635_0000007 Ga0500635_0000007_61747_62862 357
154 3300053080 Ga0500635_0011734 Ga0500635_0011734_148_1260 357
155 3300053125 Ga0500618_000111 Ga0500618_000111_3427_4503 357
156 3300053125 Ga0500618_000154 Ga0500618_000154_40926_42002 357
157 3300053136 Ga0500559_0004331 Ga0500559_0004331_3509_4615 357
158 3300053136 Ga0500559_0004975 Ga0500559_0004975_765_1877 357
159 3300053177 Ga0500636_0018208 Ga0500636_0018208_2854_3966 357
160 iso_pu_bacteria 2510917021 2511126387 357
161 iso_pu_bacteria 2523231044 2523387157 357
162 2162886007 SwRhRL2b_contig_1733293 SwRhRL2b_0056.00005120 361
163 3300005335 Ga0070666_10147478 Ga0070666_101474782 361
164 3300005347 Ga0070668_100005150 Ga0070668_1000051503 361
165 3300005353 Ga0070669_100001397 Ga0070669_1000013979 361
166 3300005355 Ga0070671_100014526 Ga0070671_1000145262 361
167 3300005367 Ga0070667_100012977 Ga0070667_1000129772 361
168 3300005548 Ga0070665_100007079 Ga0070665_1000070792 361
169 3300005844 Ga0068862_100058497 Ga0068862_1000584972 361
170 3300009177 Ga0105248_10087095 Ga0105248_100870952 361
171 3300025711 Ga0207696_1005937 Ga0207696_10059373 361
172 3300025735 Ga0207713_1025721 Ga0207713_10257212 361
173 3300025735 Ga0207713_1028309 Ga0207713_10283092 361
174 3300025903 Ga0207680_10190534 Ga0207680_101905342 361
175 3300025923 Ga0207681_10055359 Ga0207681_100553592 361
176 3300025931 Ga0207644_10015023 Ga0207644_100150232 361
177 3300025941 Ga0207711_10188539 Ga0207711_101885392 361
178 3300025972 Ga0207668_10022989 Ga0207668_100229892 361
179 3300025986 Ga0207658_10001951 Ga0207658_1000195112 361
180 3300028379 Ga0268266_10043736 Ga0268266_100437362 361
181 3300028380 Ga0268265_10057108 Ga0268265_100571082 361
182 3300048919 Ga0496116_0046425 Ga0496116_0046425_1761_2846 361

Structural Annotation

Top 5 Hits

ID Description Score Start End
3e4y-assembly1.cif.gz_A crystal structure of a 33kda catalase-related protein from mycobacterium avium subsp. paratuberculosis. i2(1)2(1)2(1) crystal form 0.6986 23 344
2xq1-assembly3.cif.gz_K crystal structure of peroxisomal catalase from the yeast hansenula polymorpha 0.6866 39 361
3e4y-assembly1.cif.gz_A crystal structure of a 33kda catalase-related protein from mycobacterium avium subsp. paratuberculosis. i2(1)2(1)2(1) crystal form 0.6838 23 344
1si8-assembly1.cif.gz_D crystal structure of e. faecalis catalase 0.6805 39 360
1m7s-assembly1.cif.gz_C crystal structure analysis of catalase catf of pseudomonas syringae 0.6802 35 361
ID Description Score Start End Superfamily
3e4wB02 Mainly Beta;Beta Barrel;Catalase HpII,;Catalase core domain 0.7276 54 326 2.40.180.10
4b7fD02 Mainly Beta;Beta Barrel;Catalase HpII,;Catalase core domain 0.724 44 355 2.40.180.10
4b7fD02 Mainly Beta;Beta Barrel;Catalase HpII,;Catalase core domain 0.7189 44 355 2.40.180.10
3e4wB02 Mainly Beta;Beta Barrel;Catalase HpII,;Catalase core domain 0.7147 54 326 2.40.180.10
1m7sC00 Mainly Beta;Beta Barrel;Catalase HpII,;Catalase core domain 0.6802 35 361 2.40.180.10
ID Description Score Start End GO Terms
AF-A0A4V1ZUA4-F1-model_v4 Catalase 0.9645 196 349 GO:0020037
AF-A0A430BKV0-F1-model_v4 Uncharacterized protein 0.9571 205 301 GO:0020037
AF-A0A4V1U8H7-F1-model_v4 deleted 0.9556 198 359
AF-A0A895ZPL3-F1-model_v4 Catalase 0.9549 205 349 GO:0020037
AF-A0A520JQI9-F1-model_v4 Catalase 0.9496 241 349 GO:0020037

Feature Viewer

pLDDT pTM Quality
83.02 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map