F280116

General Info

Members Datasets Scaffolds Average Seq Length
183 156 366 148

Family's Representative Sequence

Representative Sequence 3300002737|JGI25162J39368_1002349|JGI25162J39368_100234911
Length 159
Sequence MLDLFRRRGNRLGLIRGLVATSALAILVSGCQSMESGALVTSAAQPEVSGPAAGAIAGDMVSRLAEQIGQGKATVTLKQDGSPFGQALEAALRGWGYAVVTDQKTDGGAAVVPLAYVIVPYEGQVLARLSTSSVELGRAYKVTTSGATPASALSLMRRG

Samples

Sample ID Description Type Environment
1 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
2 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
3 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
6 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
7 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
8 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
9 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
10 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
11 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
12 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
13 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
14 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
15 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
16 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
17 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
18 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
19 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
20 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
21 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
22 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
23 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
24 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
25 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
26 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
27 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
28 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
29 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
30 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
31 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
34 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
35 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
36 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
37 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
38 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
39 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
40 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
41 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
42 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
43 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
44 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
45 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
46 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
47 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
48 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
49 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
50 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
51 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
52 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
53 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
54 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
55 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
56 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
57 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
58 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
59 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
60 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
61 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
62 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
63 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
64 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
65 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
66 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
67 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
68 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
69 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
70 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
71 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
72 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
73 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
74 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
75 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
76 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
77 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
78 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
79 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
80 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
81 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
82 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
83 2516143018 Ensifer sp. BR816 Isolate Nodule
84 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
85 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
86 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
87 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
88 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
89 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
90 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
91 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
92 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
93 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
94 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
95 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
96 2643221558 Rhizobium sp. Root149 Isolate Unclassified
97 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
98 2738543024 Aminobacter sp. AP02 Isolate Unclassified
99 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
100 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
101 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
102 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
103 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
104 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
105 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
106 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
107 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
108 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
109 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
110 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
111 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
112 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
113 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
114 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
115 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
116 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
117 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
118 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
119 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
120 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
121 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
122 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
123 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
124 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
125 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
126 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
127 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
128 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
129 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
130 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
131 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
132 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
133 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
134 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
135 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
136 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
137 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
138 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
139 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
140 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
141 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
142 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
143 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
144 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
145 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
146 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
147 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
148 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
149 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
150 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
151 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
152 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
153 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
154 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
155 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
156 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 54.64
Metatranscriptomes 0
Isolates 45.36

Biome Distribution

Category Percentage (%)
Aerial Root 0.55
Bulb 0
Endosphere 17.49
Nodule 36.07
Rhizoplane 2.73
Rhizosphere 22.95
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1002349 3300002737 Bacteria 7510
2 JGI25159J45721_1000109 3300002987 Bacteria 38930
3 JGI25165J46597_1000950 3300003214 Bacteria 19828
4 JGI25153J46596_10019472 3300003215 Bacteria 2599
5 JGI25160J50197_1000103 3300003354 Bacteria 80968
6 JGI25161J50226_1000090 3300003374 Bacteria 73647
7 Ga0055540_1000794 3300003792 Bacteria 21378
8 Ga0055540_1012482 3300003792 Bacteria 2663
9 Ga0055531_10000880 3300003794 Bacteria 24626
10 Ga0055531_10001083 3300003794 Bacteria 21388
11 Ga0055531_10011905 3300003794 Bacteria 4142
12 Ga0055543_1000087 3300004625 Bacteria 81157
13 Ga0065165_1000900 3300005262 Bacteria 38368
14 Ga0068856_100068080 3300005614 Bacteria 3519
15 Ga0079104_1018705 3300006946 Bacteria 1955
16 Ga0079104_1029953 3300006946 Bacteria 1365
17 Ga0105241_12142947 3300009174 Bacteria 553
18 Ga0105237_10000111 3300009545 Bacteria 114572
19 Ga0105239_10000065 3300010375 Bacteria 151224
20 Ga0105239_10000443 3300010375 Bacteria 60452
21 Ga0157371_10565817 3300013102 Bacteria 843
22 Ga0157370_10000054 3300013104 Bacteria 118718
23 Ga0182008_10255908 3300014497 Bacteria 904
24 Ga0228711_1038880 3300022739 Bacteria 1622
25 Ga0228711_1039413 3300022739 Bacteria 1568
26 Ga0228710_1037464 3300022740 Bacteria 1693
27 Ga0228710_1050611 3300022740 Bacteria 841
28 Ga0209437_100614 3300025233 Bacteria 21837
29 Ga0209437_104804 3300025233 Bacteria 2349
30 Ga0209677_101341 3300025253 Bacteria 10816
31 Ga0209233_1000562 3300025261 Bacteria 19864
32 Ga0209233_1000661 3300025261 Bacteria 16624
33 Ga0209130_1000098 3300025284 Bacteria 142506
34 Ga0209676_1002796 3300025292 Bacteria 11569
35 Ga0209676_1051429 3300025292 Bacteria 1081
36 Ga0209758_1000168 3300025297 Bacteria 150965
37 Ga0209050_1015727 3300025298 Bacteria 3154
38 Ga0207426_1000069 3300025302 Bacteria 334513
39 Ga0209051_1000895 3300025303 Bacteria 29801
40 Ga0209051_1001339 3300025303 Bacteria 21403
41 Ga0209257_1000319 3300025304 Bacteria 100552
42 Ga0209257_1001865 3300025304 Bacteria 22867
43 Ga0209257_1002033 3300025304 Bacteria 21569
44 Ga0207671_10000087 3300025914 Bacteria 141774
45 Ga0207702_10049152 3300026078 Bacteria 3558
46 Ga0209281_1002694 3300027111 Bacteria 6700
47 Ga0209281_1014179 3300027111 Bacteria 1694
48 Ga0209371_1002503 3300027312 Bacteria 10174
49 Ga0209282_1007304 3300027666 Bacteria 6913
50 Ga0209282_1067244 3300027666 Bacteria 1970
51 Ga0268256_1000843 3300030500 Bacteria 21772
52 Ga0307406_10027718 3300031901 Bacteria 3416
53 Ga0307412_10002308 3300031911 Bacteria 10558
54 Ga0315914_1000082 3300031967 Bacteria 78317
55 Ga0315913_1000028 3300033430 Bacteria 78319
56 Ga0315915_1000004 3300033464 Bacteria 403083
57 Ga0451841_0600968 3300041498 Bacteria 2530
58 Ga0495588_0003969 3300046674 Bacteria 6495
59 Ga0495686_0028473 3300047472 Bacteria 3639
60 Ga0496105_0526857 3300048908 Bacteria 925
61 Ga0496106_0000073 3300048909 Bacteria 80498
62 Ga0496116_0007543 3300048919 Bacteria 9623
63 Ga0496116_0168931 3300048919 Bacteria 1188
64 Ga0496117_0039353 3300048920 Bacteria 3491
65 Ga0496117_0497829 3300048920 Bacteria 591
66 Ga0496118_0023451 3300048921 Bacteria 5359
67 Ga0496118_0024716 3300048921 Bacteria 5175
68 Ga0496118_0156296 3300048921 Bacteria 1418
69 Ga0496119_0001142 3300048922 Bacteria 33317
70 Ga0496119_0013780 3300048922 Bacteria 6400
71 Ga0496119_0078986 3300048922 Bacteria 1902
72 Ga0496120_0024418 3300048923 Bacteria 3769
73 Ga0496120_0116181 3300048923 Bacteria 1390
74 Ga0496120_0356018 3300048923 Bacteria 656
75 Ga0496123_0005095 3300048926 Bacteria 13418
76 Ga0496125_0018528 3300048928 Bacteria 6611
77 Ga0496126_0000471 3300048929 Bacteria 80080
78 Ga0496126_0000522 3300048929 Bacteria 74922
79 Ga0496126_0012143 3300048929 Bacteria 8841
80 Ga0496126_1122433 3300048929 Bacteria 583
81 Ga0501031_0008454 3300049568 Bacteria 6698
82 Ga0501032_0010244 3300049569 Bacteria 6764
83 Ga0501033_0000251 3300049570 Bacteria 51944
84 Ga0501034_0392044 3300049571 Bacteria 1312
85 Ga0501037_0000028 3300049573 Bacteria 139838
86 Ga0501039_0280415 3300049575 Bacteria 1310
87 Ga0501043_0000028 3300049579 Bacteria 144125
88 Ga0501069_0000014 3300049585 Bacteria 146321
89 Ga0501070_0000406 3300049586 Bacteria 39138
90 Ga0501071_0002588 3300049587 Bacteria 11049
91 Ga0501073_0237660 3300049589 Bacteria 1258
92 Ga0501074_0000004 3300049590 Bacteria 114255
93 Ga0501080_0001435 3300049742 Bacteria 20038
94 Ga0501083_0000025 3300049744 Bacteria 121349
95 Ga0501035_0002362 3300049822 Bacteria 18563
96 Ga0501044_0000052 3300049823 Bacteria 143626
97 Ga0501045_0068459 3300049824 Bacteria 2608
98 Ga0500618_000649 3300053125 Bacteria 20700
99 Ga0500636_0000121 3300053177 Bacteria 40628
100 Ga0500636_0000231 3300053177 Bacteria 30492
101 2509111269 2508501122 Bacteria 6292184
102 2511388158 2511231027 Bacteria 5013807
103 2512975109 2512875026 Bacteria 6861065
104 2513588777 2513237086 Bacteria 7265287
105 2513600029 2513237088 Bacteria 6927906
106 2513605144 2513237089 Bacteria 6553624
107 2514000746 2513237159 Bacteria 6810126
108 2514007824 2513237160 Bacteria 6650282
109 2515108382 2515075009 Bacteria 7288508
110 2516210577 2516143018 Bacteria 6951533
111 2517567753 2517487022 Bacteria 7227575
112 2524471680 2524023210 Bacteria 9029266
113 2528856475 2528768022 Bacteria 10457665
114 2585169645 2582581283 Bacteria 6030556
115 2585281826 2582581308 Bacteria 7413247
116 2585326985 2582581315 Bacteria 7318924
117 2585336487 2582581316 Bacteria 7774528
118 2585535240 2585427527 Bacteria 7273426
119 2585555287 2585427530 Bacteria 7383882
120 2599336033 2599185156 Bacteria 5403036
121 2599723024 2599185236 Bacteria 6875203
122 2616312202 2615840626 Bacteria 7921970
123 2643815084 2643221558 Bacteria 5460675
124 2671117160 2667528174 Bacteria 6435400
125 2739306960 2738543024 Bacteria 5603683
126 2776268185 2775506902 Bacteria 6208009
127 2776283975 2775506904 Bacteria 5954060
128 2776911663 2775507049 Bacteria 6284736
129 2792642531 2791355094 Bacteria 7011481
130 2802721033 2802428858 Bacteria 6636079
131 2802728121 2802428859 Bacteria 6667919
132 2802733586 2802428860 Bacteria 6525526
133 2802736668 2802428861 Bacteria 6534206
134 2802746736 2802428862 Bacteria 6633353
135 2802749766 2802428863 Bacteria 6410669
136 2819642938 2818991453 Bacteria 7181617
137 2821129818 2821123053 Bacteria 7836056
138 2839998463 2839993093 Bacteria 5512535
139 2841856619 2841851746 Bacteria 7532261
140 2842488559 2842482326 Bacteria 7212537
141 2842526585 2842521101 Bacteria 6569494
142 2857357221 2857349434 Bacteria 7926032
143 2869258696 2869256925 Bacteria 6981691
144 2885391667 2885383462 Bacteria 9473874
145 2888387965 2888378607 Bacteria 9652610
146 2896387910 2896384573 Bacteria 7700774
147 2903777676 2903768456 Bacteria 9749579
148 2915986710 2915980308 Bacteria 6624279
149 2916064167 2916061851 Bacteria 6737736
150 2920762325 2920760137 Bacteria 7427611
151 2921254086 2921250672 Bacteria 6677771
152 2928525611 2928521798 Bacteria 4960112
153 2933599312 2933594066 Bacteria 5594265
154 2935684655 2935675223 Bacteria 9928132
155 2937035496 2937029754 Bacteria 6424026
156 2937039914 2937036028 Bacteria 6846469
157 2937087800 2937084907 Bacteria 6618516
158 2954012367 2954011201 Bacteria 4762601
159 2957376337 2957375807 Bacteria 6425588
160 2957440511 2957437181 Bacteria 6568994
161 2958068800 2958064165 Bacteria 7158582
162 2960597366 2960591022 Bacteria 6622873
163 2960636559 2960631154 Bacteria 6732508
164 2960686071 2960680706 Bacteria 6624464
165 2960695822 2960693952 Bacteria 6749742
166 2967690990 2967686174 Bacteria 6678622
167 2967733688 2967728569 Bacteria 6641507
168 2970029031 2970026789 Bacteria 6785236
169 2970125124 2970122695 Bacteria 6625855
170 2970148080 2970143518 Bacteria 6446480
171 2977533373 2977530762 Bacteria 6951399
172 2977548870 2977544691 Bacteria 6875412
173 2979091959 2979089926 Bacteria 5670289
174 2979100954 2979095461 Bacteria 5669583
175 2984588959 2984587000 Bacteria 5263363
176 2987644612 2987636660 Bacteria 8088555
177 2989781201 2989776772 Bacteria 4843317
178 3004210926 3004203850 Bacteria 7307914
179 8002287554 8002285264 Bacteria 6717907
180 8004005298 8003999396 Bacteria 7063185
181 8005689672 8005688590 Bacteria 6610080
182 8016511965 8016511872 Bacteria 9921665
183 8017066497 8017057580 Bacteria 10023680
184 JGI25162J39368_1002349
185 JGI25159J45721_1000109
186 JGI25165J46597_1000950
187 JGI25153J46596_10019472
188 JGI25160J50197_1000103
189 JGI25161J50226_1000090
190 Ga0055540_1000794
191 Ga0055540_1012482
192 Ga0055531_10000880
193 Ga0055531_10001083
194 Ga0055531_10011905
195 Ga0055543_1000087
196 Ga0065165_1000900
197 Ga0068856_100068080
198 Ga0079104_1018705
199 Ga0079104_1029953
200 Ga0105241_12142947
201 Ga0105237_10000111
202 Ga0105239_10000065
203 Ga0105239_10000443
204 Ga0157371_10565817
205 Ga0157370_10000054
206 Ga0182008_10255908
207 Ga0228711_1038880
208 Ga0228711_1039413
209 Ga0228710_1037464
210 Ga0228710_1050611
211 Ga0209437_100614
212 Ga0209437_104804
213 Ga0209677_101341
214 Ga0209233_1000562
215 Ga0209233_1000661
216 Ga0209130_1000098
217 Ga0209676_1002796
218 Ga0209676_1051429
219 Ga0209758_1000168
220 Ga0209050_1015727
221 Ga0207426_1000069
222 Ga0209051_1000895
223 Ga0209051_1001339
224 Ga0209257_1000319
225 Ga0209257_1001865
226 Ga0209257_1002033
227 Ga0207671_10000087
228 Ga0207702_10049152
229 Ga0209281_1002694
230 Ga0209281_1014179
231 Ga0209371_1002503
232 Ga0209282_1007304
233 Ga0209282_1067244
234 Ga0268256_1000843
235 Ga0307406_10027718
236 Ga0307412_10002308
237 Ga0315914_1000082
238 Ga0315913_1000028
239 Ga0315915_1000004
240 Ga0451841_0600968
241 Ga0495588_0003969
242 Ga0495686_0028473
243 Ga0496105_0526857
244 Ga0496106_0000073
245 Ga0496116_0007543
246 Ga0496116_0168931
247 Ga0496117_0039353
248 Ga0496117_0497829
249 Ga0496118_0023451
250 Ga0496118_0024716
251 Ga0496118_0156296
252 Ga0496119_0001142
253 Ga0496119_0013780
254 Ga0496119_0078986
255 Ga0496120_0024418
256 Ga0496120_0116181
257 Ga0496120_0356018
258 Ga0496123_0005095
259 Ga0496125_0018528
260 Ga0496126_0000471
261 Ga0496126_0000522
262 Ga0496126_0012143
263 Ga0496126_1122433
264 Ga0501031_0008454
265 Ga0501032_0010244
266 Ga0501033_0000251
267 Ga0501034_0392044
268 Ga0501037_0000028
269 Ga0501039_0280415
270 Ga0501043_0000028
271 Ga0501069_0000014
272 Ga0501070_0000406
273 Ga0501071_0002588
274 Ga0501073_0237660
275 Ga0501074_0000004
276 Ga0501080_0001435
277 Ga0501083_0000025
278 Ga0501035_0002362
279 Ga0501044_0000052
280 Ga0501045_0068459
281 Ga0500618_000649
282 Ga0500636_0000121
283 Ga0500636_0000231
284 2509111269
285 2511388158
286 2512975109
287 2513588777
288 2513600029
289 2513605144
290 2514000746
291 2514007824
292 2515108382
293 2516210577
294 2517567753
295 2524471680
296 2528856475
297 2585169645
298 2585281826
299 2585326985
300 2585336487
301 2585535240
302 2585555287
303 2599336033
304 2599723024
305 2616312202
306 2643815084
307 2671117160
308 2739306960
309 2776268185
310 2776283975
311 2776911663
312 2792642531
313 2802721033
314 2802728121
315 2802733586
316 2802736668
317 2802746736
318 2802749766
319 2819642938
320 2821129818
321 2839998463
322 2841856619
323 2842488559
324 2842526585
325 2857357221
326 2869258696
327 2885391667
328 2888387965
329 2896387910
330 2903777676
331 2915986710
332 2916064167
333 2920762325
334 2921254086
335 2928525611
336 2933599312
337 2935684655
338 2937035496
339 2937039914
340 2937087800
341 2954012367
342 2957376337
343 2957440511
344 2958068800
345 2960597366
346 2960636559
347 2960686071
348 2960695822
349 2967690990
350 2967733688
351 2970029031
352 2970125124
353 2970148080
354 2977533373
355 2977548870
356 2979091959
357 2979100954
358 2984588959
359 2987644612
360 2989781201
361 3004210926
362 8002287554
363 8004005298
364 8005689672
365 8016511965
366 8017066497

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2xhn-assembly2.cif.gz_A rhamnogalacturonan lyase from aspergillus aculeatus k150a active site mutant 0.8062 114 139
1nkg-assembly1.cif.gz_A rhamnogalacturonan lyase from aspergillus aculeatus 0.8052 114 139
3njx-assembly1.cif.gz_A rhamnogalacturonan lyase from aspergillus aculeatus mutant h210a 0.8045 114 139
1x87-assembly1.cif.gz_A 2.4a x-ray structure of urocanase protein complexed with nad 0.7804 53 101
3d4o-assembly3.cif.gz_A crystal structure of dipicolinate synthase subunit a (np_243269.1) from bacillus halodurans at 2.10 a resolution 0.7399 53 106
ID Description Score Start End Superfamily
af_O74316_40_249_3.10.280.10 Alpha Beta;Roll;Mitochondrial Matrix Protein; Chain A;Mitochondrial glycoprotein 0.8278 124 157 3.10.280.10
2xhnA01 Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; 0.8061 114 139 2.70.98.10
af_Q2G1M8_18_144_3.30.310.280 Alpha Beta;2-Layer Sandwich;TATA-Binding Protein; 0.7942 114 157 3.30.310.280
af_E7F3A5_103_266_2.40.160.110 Mainly Beta;Beta Barrel;Porin; 0.7902 114 140 2.40.160.110
af_Q9M086_1453_1777_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.781 116 139 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A2Z2Q0L1-F1-model_v4 Conjugal transfer protein TrbH 0.9781 48 159
AF-A0A526XR90-F1-model_v4 Conjugal transfer protein TrbH 0.9749 40 131
AF-A0A2Z2Q0L1-F1-model_v4 Conjugal transfer protein TrbH 0.9696 48 159
AF-A0A526XR90-F1-model_v4 Conjugal transfer protein TrbH 0.9646 40 131
AF-A0A441UPC2-F1-model_v4 Conjugal transfer protein TrbH 0.9573 63 159

Map