F280136

General Info

Members Datasets Scaffolds Average Seq Length
183 129 366 144

Family's Representative Sequence

Representative Sequence 3300003322|rootL2_10135777|rootL2_101357778
Length 161
Sequence LNNLYAEIHVLTVKRNWIMTKLKYLLLCLALLVLISCKTSQMKQSSLPETGMFKVAILYPNGEDKTFDMDYYEKTHMPMVAGFLGKNLKFYEIDKGIAGRTPNDKVPFVAIGYFYVNDVAEYNKAIAQNRDTIINDIKKYTNIQPTVQISEIRQLGHNSIK

Samples

Sample ID Description Type Environment
1 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
66 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
67 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
68 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
101 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
102 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
103 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
104 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
105 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
106 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
107 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
108 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
109 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
110 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
111 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
112 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
113 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
114 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
116 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
117 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
118 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
119 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
120 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
121 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
122 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
123 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
124 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
125 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
126 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
127 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
128 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
129 2738541278 Niastella sp. CF465 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.45
Metatranscriptomes 0
Isolates 0.55

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.93
Nodule 0
Rhizoplane 1.09
Rhizosphere 82.51
Stem 0
Stem Tuber 0
Unclassified 1.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10135777 3300003322 Bacteria 7046
2 rootH2_10021856 3300003320 Bacteria 4259
3 rootH1_10129387 3300003323 Bacteria 3331
4 JGI25160J50197_1003602 3300003354 Bacteria 6875
5 Ga0070676_10003670 3300005328 Bacteria 8036
6 Ga0070683_100039551 3300005329 Bacteria 4330
7 Ga0070683_100998081 3300005329 Bacteria 804
8 Ga0070690_100039614 3300005330 Bacteria 2977
9 Ga0068869_100233803 3300005334 Bacteria 1461
10 Ga0070666_10040107 3300005335 Bacteria 3124
11 Ga0068868_100005902 3300005338 Bacteria 8640
12 Ga0070660_101261407 3300005339 Bacteria 627
13 Ga0070689_100766246 3300005340 Bacteria 847
14 Ga0070661_100001575 3300005344 Bacteria 15817
15 Ga0070661_100869135 3300005344 Bacteria 743
16 Ga0070668_100592510 3300005347 Bacteria 969
17 Ga0070671_100347986 3300005355 Bacteria 1265
18 Ga0070674_100035830 3300005356 Bacteria 3326
19 Ga0070673_100171318 3300005364 Bacteria 1853
20 Ga0070688_100647195 3300005365 Bacteria 814
21 Ga0070659_100469102 3300005366 Bacteria 1070
22 Ga0070659_102131220 3300005366 Bacteria 504
23 Ga0070667_100030241 3300005367 Bacteria 4516
24 Ga0070663_100848475 3300005455 Bacteria 786
25 Ga0070678_100565708 3300005456 Bacteria 1011
26 Ga0070678_101284151 3300005456 Bacteria 681
27 Ga0070662_100128785 3300005457 Bacteria 1949
28 Ga0070681_10255600 3300005458 Bacteria 1664
29 Ga0070685_10039803 3300005466 Bacteria 2672
30 Ga0070698_100134698 3300005471 Bacteria 2425
31 Ga0070684_100067160 3300005535 Bacteria 3149
32 Ga0068853_100001770 3300005539 Bacteria 15876
33 Ga0068853_100372638 3300005539 Bacteria 1332
34 Ga0070686_100927385 3300005544 Bacteria 710
35 Ga0070664_100004828 3300005564 Bacteria 10798
36 Ga0068857_100029863 3300005577 Bacteria 4810
37 Ga0068857_100032325 3300005577 Bacteria 4626
38 Ga0068857_101963351 3300005577 Bacteria 574
39 Ga0068854_100413292 3300005578 Bacteria 1119
40 Ga0068856_100800757 3300005614 Bacteria 962
41 Ga0068852_100280593 3300005616 Bacteria 1606
42 Ga0068852_100955941 3300005616 Bacteria 875
43 Ga0068859_100052325 3300005617 Bacteria 4105
44 Ga0068859_100157838 3300005617 Bacteria 2347
45 Ga0068864_100065323 3300005618 Bacteria 3157
46 Ga0068864_100154510 3300005618 Bacteria 2082
47 Ga0068864_101024025 3300005618 Bacteria 820
48 Ga0068864_101109281 3300005618 Bacteria 788
49 Ga0068861_100762142 3300005719 Bacteria 905
50 Ga0068851_10053886 3300005834 Bacteria 2048
51 Ga0068863_100012770 3300005841 Bacteria 8099
52 Ga0068863_100417669 3300005841 Bacteria 1314
53 Ga0068858_100039844 3300005842 Bacteria 4355
54 Ga0068858_101522424 3300005842 Bacteria 660
55 Ga0068860_100586033 3300005843 Bacteria 1120
56 Ga0068860_100674428 3300005843 Bacteria 1042
57 Ga0081455_10383119 3300005937 Bacteria 981
58 Ga0075366_10030056 3300006195 Bacteria 3193
59 Ga0075366_10041038 3300006195 Bacteria 2739
60 Ga0075366_10061985 3300006195 Bacteria 2223
61 Ga0075366_10291920 3300006195 Bacteria 997
62 Ga0097621_100002467 3300006237 Bacteria 12668
63 Ga0068871_100013050 3300006358 Bacteria 6159
64 Ga0068871_100227273 3300006358 Bacteria 1619
65 Ga0068871_100252806 3300006358 Bacteria 1535
66 Ga0068871_101560618 3300006358 Bacteria 625
67 Ga0075430_100049579 3300006846 Bacteria 3543
68 Ga0075431_100015538 3300006847 Bacteria 7714
69 Ga0068865_100478282 3300006881 Bacteria 1035
70 Ga0068865_102107887 3300006881 Bacteria 513
71 Ga0097620_100005305 3300006931 Bacteria 13104
72 Ga0097620_100052327 3300006931 Bacteria 4105
73 Ga0097620_100157846 3300006931 Bacteria 2347
74 Ga0105247_10302297 3300009101 Bacteria 1110
75 Ga0114129_10027384 3300009147 Bacteria 8069
76 Ga0105243_11970299 3300009148 Bacteria 618
77 Ga0105242_10071454 3300009176 Bacteria 2880
78 Ga0105248_11543968 3300009177 Bacteria 752
79 Ga0105237_10645875 3300009545 Bacteria 1065
80 Ga0105249_10025140 3300009553 Bacteria 5360
81 Ga0105249_10039844 3300009553 Bacteria 4265
82 Ga0105246_10347141 3300011119 Bacteria 1215
83 Ga0157374_10055402 3300013296 Bacteria 3701
84 Ga0157374_10071745 3300013296 Bacteria 3266
85 Ga0157374_10355876 3300013296 Bacteria 1455
86 Ga0157378_10003713 3300013297 Bacteria 13531
87 Ga0157378_10021038 3300013297 Bacteria 5739
88 Ga0157378_10044038 3300013297 Bacteria 3962
89 Ga0157378_10168388 3300013297 Bacteria 2053
90 Ga0157375_10065345 3300013308 Bacteria 3626
91 Ga0157375_10138788 3300013308 Bacteria 2556
92 Ga0163163_10027478 3300014325 Bacteria 5451
93 Ga0163163_10159722 3300014325 Bacteria 2299
94 Ga0157380_10065809 3300014326 Bacteria 2914
95 Ga0157380_12419139 3300014326 Bacteria 590
96 Ga0157379_10380626 3300014968 Bacteria 1295
97 Ga0157379_10862703 3300014968 Bacteria 857
98 Ga0157376_10003378 3300014969 Bacteria 10982
99 Ga0163161_10119684 3300017792 Bacteria 1977
100 Ga0163161_10234776 3300017792 Bacteria 1424
101 Ga0213876_10006282 3300021384 Bacteria 6472
102 Ga0207426_1000002 3300025302 Bacteria 1249660
103 Ga0207656_10321020 3300025321 Bacteria 769
104 Ga0207682_10051453 3300025893 Bacteria 1706
105 Ga0207680_10095196 3300025903 Bacteria 1902
106 Ga0207654_10310244 3300025911 Bacteria 1075
107 Ga0207707_10217778 3300025912 Bacteria 1662
108 Ga0207671_10702669 3300025914 Bacteria 804
109 Ga0207657_10949683 3300025919 Bacteria 661
110 Ga0207649_10006218 3300025920 Bacteria 6484
111 Ga0207652_11589560 3300025921 Bacteria 558
112 Ga0207650_10252590 3300025925 Unclassified 1428
113 Ga0207690_11620677 3300025932 Bacteria 541
114 Ga0207670_10158454 3300025936 Bacteria 1687
115 Ga0207669_10110335 3300025937 Bacteria 1842
116 Ga0207704_11354745 3300025938 Bacteria 609
117 Ga0207704_11791011 3300025938 Bacteria 528
118 Ga0207691_10515819 3300025940 Bacteria 1014
119 Ga0207711_11062941 3300025941 Bacteria 750
120 Ga0207661_10003677 3300025944 Bacteria 10693
121 Ga0207661_10312739 3300025944 Bacteria 1410
122 Ga0207661_10813298 3300025944 Bacteria 860
123 Ga0207679_10044094 3300025945 Bacteria 3216
124 Ga0207679_11017656 3300025945 Bacteria 759
125 Ga0207679_11307187 3300025945 Bacteria 665
126 Ga0207651_10579702 3300025960 Bacteria 978
127 Ga0207712_10057839 3300025961 Bacteria 2737
128 Ga0207640_12035568 3300025981 Bacteria 520
129 Ga0207658_10101780 3300025986 Bacteria 2252
130 Ga0207658_10481781 3300025986 Unclassified 1102
131 Ga0207658_11256934 3300025986 Bacteria 677
132 Ga0207677_10509387 3300026023 Bacteria 1042
133 Ga0207677_10730028 3300026023 Bacteria 881
134 Ga0207677_10788260 3300026023 Bacteria 850
135 Ga0207703_10236958 3300026035 Bacteria 1639
136 Ga0207703_11518439 3300026035 Bacteria 644
137 Ga0207639_10020930 3300026041 Bacteria 4692
138 Ga0207641_10009501 3300026088 Bacteria 8017
139 Ga0207648_10046857 3300026089 Bacteria 3790
140 Ga0207674_10004912 3300026116 Bacteria 15987
141 Ga0207674_11257158 3300026116 Bacteria 710
142 Ga0207675_102066951 3300026118 Bacteria 586
143 Ga0207698_10182978 3300026142 Bacteria 1858
144 Ga0207698_10302434 3300026142 Bacteria 1490
145 Ga0268266_10912084 3300028379 Bacteria 850
146 Ga0268264_10715498 3300028381 Bacteria 995
147 Ga0268264_11387846 3300028381 Bacteria 713
148 Ga0307515_10000002 3300028794 Bacteria 1231751
149 Ga0307515_10006148 3300028794 Bacteria 24129
150 Ga0307513_10154395 3300031456 Bacteria 2198
151 Ga0307513_10512315 3300031456 Bacteria 916
152 Ga0436365_1057500 3300039437 Bacteria 6490
153 Ga0439431_0028369 3300041997 Bacteria 1379
154 Ga0439442_048623 3300042002 Bacteria 894
155 Ga0439445_0089781 3300042004 Bacteria 865
156 Ga0439460_0279793 3300042461 Bacteria 581
157 Ga0466972_0000479 3300044658 Bacteria 20239
158 Ga0466972_0135854 3300044658 Bacteria 1157
159 Ga0466960_0443849 3300044901 Bacteria 753
160 Ga0451576_1118357 3300045051 Bacteria 824
161 Ga0495670_0557390 3300046691 Bacteria 624
162 Ga0496105_0873791 3300048908 Bacteria 679
163 Ga0496112_0929791 3300048915 Bacteria 791
164 Ga0501257_054517 3300049686 Bacteria 1002
165 Ga0501035_0569143 3300049822 Bacteria 926
166 Ga0501044_0033911 3300049823 Bacteria 5359
167 nmdc:mga0k408_220117_c1 3300050493 Bacteria 1133
168 nmdc:mga0k408_49024_c1 3300050493 Bacteria 2445
169 nmdc:mga0k408_71947_c1 3300050493 Bacteria 2019
170 nmdc:mga05p37_196556_c1 3300050507 Bacteria 2445
171 nmdc:mga05p37_70564_c1 3300050507 Bacteria 4297
172 Ga0500578_0000245 3300053086 Bacteria 67264
173 Ga0500644_0018120 3300053088 Bacteria 2057
174 Ga0500646_0045878 3300053090 Bacteria 1245
175 Ga0500651_0550428 3300053093 Bacteria 631
176 Ga0500650_0107639 3300053098 Bacteria 1302
177 Ga0500572_108805 3300053111 Bacteria 890
178 Ga0500628_103997 3300053129 Bacteria 754
179 Ga0500568_0008284 3300053139 Bacteria 5023
180 Ga0500588_0117963 3300053146 Bacteria 933
181 Ga0500636_0074813 3300053177 Bacteria 1960
182 Ga0500611_000021 3300053727 Bacteria 102395
183 2738730160 2738541278 Bacteria 9755573
184 rootL2_10135777
185 rootH2_10021856
186 rootH1_10129387
187 JGI25160J50197_1003602
188 Ga0070676_10003670
189 Ga0070683_100039551
190 Ga0070683_100998081
191 Ga0070690_100039614
192 Ga0068869_100233803
193 Ga0070666_10040107
194 Ga0068868_100005902
195 Ga0070660_101261407
196 Ga0070689_100766246
197 Ga0070661_100001575
198 Ga0070661_100869135
199 Ga0070668_100592510
200 Ga0070671_100347986
201 Ga0070674_100035830
202 Ga0070673_100171318
203 Ga0070688_100647195
204 Ga0070659_100469102
205 Ga0070659_102131220
206 Ga0070667_100030241
207 Ga0070663_100848475
208 Ga0070678_100565708
209 Ga0070678_101284151
210 Ga0070662_100128785
211 Ga0070681_10255600
212 Ga0070685_10039803
213 Ga0070698_100134698
214 Ga0070684_100067160
215 Ga0068853_100001770
216 Ga0068853_100372638
217 Ga0070686_100927385
218 Ga0070664_100004828
219 Ga0068857_100029863
220 Ga0068857_100032325
221 Ga0068857_101963351
222 Ga0068854_100413292
223 Ga0068856_100800757
224 Ga0068852_100280593
225 Ga0068852_100955941
226 Ga0068859_100052325
227 Ga0068859_100157838
228 Ga0068864_100065323
229 Ga0068864_100154510
230 Ga0068864_101024025
231 Ga0068864_101109281
232 Ga0068861_100762142
233 Ga0068851_10053886
234 Ga0068863_100012770
235 Ga0068863_100417669
236 Ga0068858_100039844
237 Ga0068858_101522424
238 Ga0068860_100586033
239 Ga0068860_100674428
240 Ga0081455_10383119
241 Ga0075366_10030056
242 Ga0075366_10041038
243 Ga0075366_10061985
244 Ga0075366_10291920
245 Ga0097621_100002467
246 Ga0068871_100013050
247 Ga0068871_100227273
248 Ga0068871_100252806
249 Ga0068871_101560618
250 Ga0075430_100049579
251 Ga0075431_100015538
252 Ga0068865_100478282
253 Ga0068865_102107887
254 Ga0097620_100005305
255 Ga0097620_100052327
256 Ga0097620_100157846
257 Ga0105247_10302297
258 Ga0114129_10027384
259 Ga0105243_11970299
260 Ga0105242_10071454
261 Ga0105248_11543968
262 Ga0105237_10645875
263 Ga0105249_10025140
264 Ga0105249_10039844
265 Ga0105246_10347141
266 Ga0157374_10055402
267 Ga0157374_10071745
268 Ga0157374_10355876
269 Ga0157378_10003713
270 Ga0157378_10021038
271 Ga0157378_10044038
272 Ga0157378_10168388
273 Ga0157375_10065345
274 Ga0157375_10138788
275 Ga0163163_10027478
276 Ga0163163_10159722
277 Ga0157380_10065809
278 Ga0157380_12419139
279 Ga0157379_10380626
280 Ga0157379_10862703
281 Ga0157376_10003378
282 Ga0163161_10119684
283 Ga0163161_10234776
284 Ga0213876_10006282
285 Ga0207426_1000002
286 Ga0207656_10321020
287 Ga0207682_10051453
288 Ga0207680_10095196
289 Ga0207654_10310244
290 Ga0207707_10217778
291 Ga0207671_10702669
292 Ga0207657_10949683
293 Ga0207649_10006218
294 Ga0207652_11589560
295 Ga0207650_10252590
296 Ga0207690_11620677
297 Ga0207670_10158454
298 Ga0207669_10110335
299 Ga0207704_11354745
300 Ga0207704_11791011
301 Ga0207691_10515819
302 Ga0207711_11062941
303 Ga0207661_10003677
304 Ga0207661_10312739
305 Ga0207661_10813298
306 Ga0207679_10044094
307 Ga0207679_11017656
308 Ga0207679_11307187
309 Ga0207651_10579702
310 Ga0207712_10057839
311 Ga0207640_12035568
312 Ga0207658_10101780
313 Ga0207658_10481781
314 Ga0207658_11256934
315 Ga0207677_10509387
316 Ga0207677_10730028
317 Ga0207677_10788260
318 Ga0207703_10236958
319 Ga0207703_11518439
320 Ga0207639_10020930
321 Ga0207641_10009501
322 Ga0207648_10046857
323 Ga0207674_10004912
324 Ga0207674_11257158
325 Ga0207675_102066951
326 Ga0207698_10182978
327 Ga0207698_10302434
328 Ga0268266_10912084
329 Ga0268264_10715498
330 Ga0268264_11387846
331 Ga0307515_10000002
332 Ga0307515_10006148
333 Ga0307513_10154395
334 Ga0307513_10512315
335 Ga0436365_1057500
336 Ga0439431_0028369
337 Ga0439442_048623
338 Ga0439445_0089781
339 Ga0439460_0279793
340 Ga0466972_0000479
341 Ga0466972_0135854
342 Ga0466960_0443849
343 Ga0451576_1118357
344 Ga0495670_0557390
345 Ga0496105_0873791
346 Ga0496112_0929791
347 Ga0501257_054517
348 Ga0501035_0569143
349 Ga0501044_0033911
350 nmdc:mga0k408_220117_c1
351 nmdc:mga0k408_49024_c1
352 nmdc:mga0k408_71947_c1
353 nmdc:mga05p37_196556_c1
354 nmdc:mga05p37_70564_c1
355 Ga0500578_0000245
356 Ga0500644_0018120
357 Ga0500646_0045878
358 Ga0500651_0550428
359 Ga0500650_0107639
360 Ga0500572_108805
361 Ga0500628_103997
362 Ga0500568_0008284
363 Ga0500588_0117963
364 Ga0500636_0074813
365 Ga0500611_000021
366 2738730160

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3bf4-assembly1.cif.gz_B crystal structure of an ethd-like protein (reut_b5694) from ralstonia eutropha jmp134 at 2.10 a resolution 0.674 34 144
3bf4-assembly1.cif.gz_B crystal structure of an ethd-like protein (reut_b5694) from ralstonia eutropha jmp134 at 2.10 a resolution 0.6589 34 144
6qmv-assembly1.cif.gz_A e87d sulfur oxygenase reductase 0.6301 31 117
2yaw-assembly1.cif.gz_A hg inhibited sulfur oxygenase reductase 0.6255 31 117
6qpa-assembly1.cif.gz_E halothiobacillus neapolitanus sulfur oxygenase reductase 0.6204 31 122
ID Description Score Start End Superfamily
3bf4B01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.6643 36 134 3.30.70.100
3bf4B01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.6588 36 134 3.30.70.100
af_K7L8B0_46_140_3.30.30.10 Alpha Beta;2-Layer Sandwich;Defensin A-like;Knottin, scorpion toxin-like 0.6358 21 109 3.30.30.10
af_P77338_997_1091_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.6057 30 135 3.30.70.100
af_A0A1D6PLI0_180_283_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.6051 32 136 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A1G5ZVK1-F1-model_v4 EthD domain-containing protein 0.7497 48 135 GO:0016491
AF-A0A7X9EPT6-F1-model_v4 deleted 0.7466 34 135
AF-A0A095SQG0-F1-model_v4 EthD domain-containing protein 0.742 34 135 GO:0016491
AF-A0A0Q5TC86-F1-model_v4 Ethyl tert-butyl ether degradation protein EthD 0.7409 42 135 GO:0016491
AF-A0A2T5RDP1-F1-model_v4 deleted 0.7399 34 135

Map