F280137

General Info

Members Datasets Scaffolds Average Seq Length
183 141 366 177

Family's Representative Sequence

Representative Sequence 3300003322|rootL2_10158339|rootL2_101583392
Length 181
Sequence VKWIWRLVALALLAWAVGFAIFMFSIGKPLDRAIETDAIVVLTGGTGRIDRGIELMRAHAAKRMLISGAAPDVRPIELAVRYHADPRLFACCIDLGHEAVDTRSNADETADWVREHGFTSVRLVTSDWHMPRATLELRKALNAKVRVQGDGVPTEPGLRTVIREYHKYLVRRLVLMVGAAA

Samples

Sample ID Description Type Environment
1 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
2 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
3 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
4 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
5 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
10 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
11 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
12 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
13 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
14 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
15 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
16 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
17 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
18 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
19 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
30 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
31 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
33 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
34 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
35 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
36 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
37 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
38 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
39 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
40 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
41 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
42 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
43 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
45 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
46 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
47 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
49 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
56 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
59 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
60 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
61 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
62 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
63 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
64 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
65 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
66 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
67 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
68 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
69 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
70 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
71 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
72 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
73 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
74 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
75 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
76 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
77 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
78 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
79 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
80 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
81 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
82 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
83 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
84 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
85 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
86 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
87 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
88 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
89 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
90 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
91 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
92 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
93 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
94 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
95 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
96 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
97 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
98 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
99 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
100 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
101 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
102 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
103 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
104 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
105 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
106 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
107 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
108 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
109 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
110 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
111 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
112 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
113 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
114 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
118 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
119 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
120 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
121 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
122 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
123 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
124 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
125 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
126 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
127 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
128 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
129 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
130 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
131 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
132 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
133 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
134 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
135 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
136 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
137 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
138 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
139 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
140 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
141 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root

Type Distribution

Type Percentage (%)
Metagenomes 94.54
Metatranscriptomes 1.09
Isolates 4.37

Biome Distribution

Category Percentage (%)
Aerial Root 2.73
Bulb 0
Endosphere 35.52
Nodule 0
Rhizoplane 2.73
Rhizosphere 46.99
Stem 0
Stem Tuber 0
Unclassified 1.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10158339 3300003322 Bacteria 1926
2 ARcpr5yngRDRAFT_c001469 3300000043 Bacteria 2596
3 LJQas_1011303 3300000549 Bacteria 1062
4 ARCol0yngRDRAFT_1002066 3300000652 Bacteria 1546
5 JGI25150J39212_1000966 3300002774 Bacteria 9083
6 JGI25150J39212_1014513 3300002774 Bacteria 1337
7 JGI25151J46595_10005487 3300003187 Bacteria 6544
8 JGI25153J46596_10000055 3300003215 Bacteria 135518
9 JGI25153J46596_10026503 3300003215 Bacteria 2049
10 rootH2_10137660 3300003320 Bacteria 1885
11 rootH2_10193027 3300003320 Bacteria 1452
12 rootL2_10038485 3300003322 Bacteria 1801
13 Ga0055526_1004036 3300003771 Bacteria 9020
14 Ga0055537_1002102 3300003773 Bacteria 6999
15 Ga0055537_1010622 3300003773 Bacteria 1928
16 Ga0055524_1000244 3300003775 Bacteria 56875
17 Ga0055536_1022115 3300003781 Bacteria 1907
18 Ga0055528_1037348 3300003790 Bacteria 1144
19 Ga0055530_10000429 3300003791 Bacteria 37251
20 Ga0055530_10005249 3300003791 Bacteria 6251
21 Ga0055540_1001899 3300003792 Bacteria 11712
22 Ga0055531_10000472 3300003794 Bacteria 37251
23 Ga0055531_10009286 3300003794 Bacteria 5048
24 Ga0055543_1010488 3300004625 Bacteria 1941
25 Ga0065165_1005617 3300005262 Bacteria 6945
26 Ga0065165_1007153 3300005262 Bacteria 5584
27 Ga0065165_1016117 3300005262 Bacteria 2814
28 Ga0065165_1068420 3300005262 Bacteria 950
29 Ga0065165_1071403 3300005262 Bacteria 921
30 Ga0065707_10288991 3300005295 Bacteria 1029
31 Ga0070680_100000263 3300005336 Bacteria 34685
32 Ga0070682_100117819 3300005337 Bacteria 1778
33 Ga0070662_100832746 3300005457 Bacteria 785
34 Ga0070679_100672278 3300005530 Bacteria 978
35 Ga0068853_100294253 3300005539 Bacteria 1499
36 Ga0068853_100596324 3300005539 Bacteria 1049
37 Ga0068852_100525552 3300005616 Unclassified 1181
38 Ga0068859_100008543 3300005617 Bacteria 10360
39 Ga0068859_100009113 3300005617 Bacteria 10021
40 Ga0068861_100000188 3300005719 Bacteria 32872
41 Ga0068860_100022370 3300005843 Bacteria 6117
42 Ga0081539_10046257 3300005985 Bacteria 2495
43 Ga0068871_100607380 3300006358 Bacteria 995
44 Ga0097620_100008543 3300006931 Bacteria 10360
45 Ga0097620_100009113 3300006931 Bacteria 10021
46 Ga0105248_10013626 3300009177 Bacteria 8950
47 Ga0105248_10022189 3300009177 Bacteria 7038
48 Ga0157370_10929826 3300013104 Bacteria 789
49 Ga0157372_10518607 3300013307 Bacteria 1389
50 Ga0157372_10777670 3300013307 Bacteria 1113
51 Ga0157372_11858330 3300013307 Bacteria 692
52 Ga0163161_10138568 3300017792 Bacteria 1841
53 Ga0206354_10999519 3300020081 Bacteria 5356
54 Ga0206353_12009786 3300020082 Bacteria 8481
55 Ga0213876_10035137 3300021384 Bacteria 2644
56 Ga0207425_1000005 3300025245 Bacteria 900502
57 Ga0207425_1011667 3300025245 Bacteria 2086
58 Ga0209129_1003496 3300025258 Bacteria 6786
59 Ga0209565_1000029 3300025263 Bacteria 340335
60 Ga0209565_1000251 3300025263 Bacteria 57054
61 Ga0209673_1009829 3300025273 Bacteria 4098
62 Ga0209673_1032919 3300025273 Bacteria 1589
63 Ga0209676_1015042 3300025292 Bacteria 2871
64 Ga0209676_1029845 3300025292 Bacteria 1677
65 Ga0209025_1000993 3300025294 Bacteria 42002
66 Ga0209564_1001873 3300025295 Bacteria 18970
67 Ga0209758_1000002 3300025297 Bacteria 1400310
68 Ga0209758_1010016 3300025297 Bacteria 5756
69 Ga0209050_1000001 3300025298 Bacteria 3563507
70 Ga0209050_1000167 3300025298 Bacteria 151608
71 Ga0209050_1001659 3300025298 Bacteria 22539
72 Ga0209050_1005376 3300025298 Bacteria 8093
73 Ga0209050_1033162 3300025298 Bacteria 1571
74 Ga0209256_1000008 3300025299 Bacteria 975723
75 Ga0209051_1000360 3300025303 Bacteria 67080
76 Ga0209257_1000028 3300025304 Bacteria 699493
77 Ga0209257_1000893 3300025304 Bacteria 41890
78 Ga0209257_1019507 3300025304 Bacteria 2550
79 Ga0209257_1043258 3300025304 Bacteria 1322
80 Ga0207711_10012204 3300025941 Bacteria 7144
81 Ga0207658_10827986 3300025986 Bacteria 841
82 Ga0207675_100000077 3300026118 Bacteria 75568
83 Ga0207698_10312525 3300026142 Bacteria 1468
84 Ga0209974_10042767 3300027876 Bacteria 1508
85 Ga0268266_10259955 3300028379 Bacteria 1609
86 Ga0268264_10033690 3300028381 Bacteria 4211
87 Ga0314311_1259885 3300030733 Bacteria 2670
88 Ga0307513_10007151 3300031456 Bacteria 14509
89 Ga0307408_100014585 3300031548 Bacteria 5222
90 Ga0307405_10141102 3300031731 Bacteria 1680
91 Ga0307413_10320108 3300031824 Bacteria 1184
92 Ga0307410_10236399 3300031852 Bacteria 1414
93 Ga0307406_10011396 3300031901 Bacteria 5045
94 Ga0307406_10426353 3300031901 Bacteria 1058
95 Ga0307412_10267730 3300031911 Bacteria 1335
96 Ga0307409_100579415 3300031995 Bacteria 1106
97 Ga0307416_100071325 3300032002 Bacteria 2885
98 Ga0307414_10142613 3300032004 Bacteria 1878
99 Ga0307414_10250737 3300032004 Bacteria 1471
100 Ga0307414_10760329 3300032004 Bacteria 881
101 Ga0307411_10022855 3300032005 Bacteria 3692
102 Ga0307415_100954419 3300032126 Unclassified 794
103 Ga0307510_10000369 3300033180 Bacteria 42647
104 Ga0237819_00565 3300038705 Bacteria 12459
105 Ga0237816_02899 3300039145 Bacteria 1288
106 Ga0436365_0403468 3300039437 Bacteria 1416
107 Ga0436365_0922968 3300039437 Bacteria 9993
108 Ga0439436_0006762 3300041404 Bacteria 3524
109 Ga0439436_0020833 3300041404 Bacteria 1952
110 Ga0439461_0000005 3300041410 Bacteria 28399
111 Ga0439466_0036975 3300041411 Bacteria 1646
112 Ga0439465_0005156 3300041413 Bacteria 4192
113 Ga0439431_0000066 3300041997 Bacteria 16712
114 Ga0439431_0023153 3300041997 Bacteria 1501
115 Ga0439442_048277 3300042002 Bacteria 897
116 Ga0439445_0003804 3300042004 Bacteria 3392
117 Ga0439432_008221 3300042006 Bacteria 3669
118 Ga0439452_007753 3300042010 Bacteria 3267
119 Ga0439457_008668 3300042014 Bacteria 2389
120 Ga0439462_0007685 3300042015 Bacteria 2704
121 Ga0450920_009013 3300042122 Bacteria 1835
122 Ga0450894_017955 3300042131 Bacteria 945
123 Ga0439446_0011609 3300042156 Bacteria 2394
124 Ga0439434_0005169 3300042435 Bacteria 3816
125 Ga0466961_0101145 3300044693 Bacteria 1816
126 Ga0466968_0004499 3300044735 Bacteria 5214
127 Ga0466968_0060834 3300044735 Bacteria 1628
128 Ga0466970_0205109 3300044765 Bacteria 1097
129 Ga0466967_0682011 3300045976 Bacteria 1017
130 Ga0495583_0014224 3300046506 Bacteria 4400
131 Ga0495668_0037161 3300046616 Bacteria 2726
132 Ga0495611_0232130 3300046648 Bacteria 857
133 Ga0495625_0029470 3300046660 Bacteria 4103
134 Ga0495670_0036441 3300046691 Bacteria 2451
135 Ga0495677_0009238 3300047445 Bacteria 3642
136 Ga0495681_0068853 3300047470 Bacteria 1609
137 Ga0495686_0009998 3300047472 Bacteria 6779
138 Ga0496102_0000010 3300048905 Bacteria 324617
139 Ga0496102_0068254 3300048905 Bacteria 3262
140 Ga0496103_0000029 3300048906 Bacteria 213326
141 Ga0496105_0070015 3300048908 Bacteria 2900
142 Ga0496115_0000665 3300048918 Bacteria 25387
143 Ga0496116_0003035 3300048919 Bacteria 16987
144 Ga0496117_0000037 3300048920 Bacteria 324960
145 Ga0496118_0000034 3300048921 Bacteria 322764
146 Ga0496119_0146201 3300048922 Bacteria 1271
147 Ga0496120_0064008 3300048923 Bacteria 2043
148 Ga0496121_0077527 3300048924 Bacteria 2646
149 Ga0496123_0119414 3300048926 Bacteria 1487
150 Ga0496124_0000033 3300048927 Bacteria 330586
151 Ga0496124_0368527 3300048927 Bacteria 1009
152 Ga0501034_0148997 3300049571 Bacteria 2316
153 Ga0501043_0021740 3300049579 Bacteria 5030
154 Ga0501035_0507504 3300049822 Bacteria 992
155 Ga0501044_0034270 3300049823 Bacteria 5326
156 Ga0501044_0706516 3300049823 Bacteria 893
157 Ga0500643_000044 3300053087 Bacteria 155319
158 Ga0500643_002398 3300053087 Bacteria 9713
159 Ga0500583_0286666 3300053092 Bacteria 808
160 Ga0500566_0004226 3300053094 Bacteria 8564
161 Ga0500641_0294543 3300053096 Bacteria 668
162 Ga0500555_030018 3300053103 Bacteria 1544
163 Ga0500562_015916 3300053108 Bacteria 1932
164 Ga0500595_001321 3300053119 Bacteria 13433
165 Ga0500626_093497 3300053128 Bacteria 1318
166 Ga0500652_222027 3300053131 Bacteria 759
167 Ga0500658_0001159 3300053134 Bacteria 10717
168 Ga0500658_0010532 3300053134 Bacteria 3410
169 Ga0500559_0001036 3300053136 Bacteria 16988
170 Ga0500568_0014837 3300053139 Bacteria 3504
171 Ga0500577_0098782 3300053142 Bacteria 1190
172 Ga0500616_0057722 3300053153 Bacteria 2022
173 Ga0500645_000842 3300053730 Bacteria 18101
174 Ga0500645_067936 3300053730 Bacteria 1025
175 Ga0500661_005075 3300055283 Bacteria 2465
176 2644127341 2643221622 Bacteria 4212502
177 2879163694 2879163058 Bacteria 4223965
178 2928029791 2928027323 Bacteria 4382488
179 2984556650 2984555340 Bacteria 4247089
180 2984565177 2984564862 Bacteria 4339992
181 2990268244 2990265787 Bacteria 3943888
182 2993356253 2993356040 Bacteria 4247105
183 2993696724 2993693658 Bacteria 4040749
184 rootL2_10158339
185 ARcpr5yngRDRAFT_c001469
186 LJQas_1011303
187 ARCol0yngRDRAFT_1002066
188 JGI25150J39212_1000966
189 JGI25150J39212_1014513
190 JGI25151J46595_10005487
191 JGI25153J46596_10000055
192 JGI25153J46596_10026503
193 rootH2_10137660
194 rootH2_10193027
195 rootL2_10038485
196 Ga0055526_1004036
197 Ga0055537_1002102
198 Ga0055537_1010622
199 Ga0055524_1000244
200 Ga0055536_1022115
201 Ga0055528_1037348
202 Ga0055530_10000429
203 Ga0055530_10005249
204 Ga0055540_1001899
205 Ga0055531_10000472
206 Ga0055531_10009286
207 Ga0055543_1010488
208 Ga0065165_1005617
209 Ga0065165_1007153
210 Ga0065165_1016117
211 Ga0065165_1068420
212 Ga0065165_1071403
213 Ga0065707_10288991
214 Ga0070680_100000263
215 Ga0070682_100117819
216 Ga0070662_100832746
217 Ga0070679_100672278
218 Ga0068853_100294253
219 Ga0068853_100596324
220 Ga0068852_100525552
221 Ga0068859_100008543
222 Ga0068859_100009113
223 Ga0068861_100000188
224 Ga0068860_100022370
225 Ga0081539_10046257
226 Ga0068871_100607380
227 Ga0097620_100008543
228 Ga0097620_100009113
229 Ga0105248_10013626
230 Ga0105248_10022189
231 Ga0157370_10929826
232 Ga0157372_10518607
233 Ga0157372_10777670
234 Ga0157372_11858330
235 Ga0163161_10138568
236 Ga0206354_10999519
237 Ga0206353_12009786
238 Ga0213876_10035137
239 Ga0207425_1000005
240 Ga0207425_1011667
241 Ga0209129_1003496
242 Ga0209565_1000029
243 Ga0209565_1000251
244 Ga0209673_1009829
245 Ga0209673_1032919
246 Ga0209676_1015042
247 Ga0209676_1029845
248 Ga0209025_1000993
249 Ga0209564_1001873
250 Ga0209758_1000002
251 Ga0209758_1010016
252 Ga0209050_1000001
253 Ga0209050_1000167
254 Ga0209050_1001659
255 Ga0209050_1005376
256 Ga0209050_1033162
257 Ga0209256_1000008
258 Ga0209051_1000360
259 Ga0209257_1000028
260 Ga0209257_1000893
261 Ga0209257_1019507
262 Ga0209257_1043258
263 Ga0207711_10012204
264 Ga0207658_10827986
265 Ga0207675_100000077
266 Ga0207698_10312525
267 Ga0209974_10042767
268 Ga0268266_10259955
269 Ga0268264_10033690
270 Ga0314311_1259885
271 Ga0307513_10007151
272 Ga0307408_100014585
273 Ga0307405_10141102
274 Ga0307413_10320108
275 Ga0307410_10236399
276 Ga0307406_10011396
277 Ga0307406_10426353
278 Ga0307412_10267730
279 Ga0307409_100579415
280 Ga0307416_100071325
281 Ga0307414_10142613
282 Ga0307414_10250737
283 Ga0307414_10760329
284 Ga0307411_10022855
285 Ga0307415_100954419
286 Ga0307510_10000369
287 Ga0237819_00565
288 Ga0237816_02899
289 Ga0436365_0403468
290 Ga0436365_0922968
291 Ga0439436_0006762
292 Ga0439436_0020833
293 Ga0439461_0000005
294 Ga0439466_0036975
295 Ga0439465_0005156
296 Ga0439431_0000066
297 Ga0439431_0023153
298 Ga0439442_048277
299 Ga0439445_0003804
300 Ga0439432_008221
301 Ga0439452_007753
302 Ga0439457_008668
303 Ga0439462_0007685
304 Ga0450920_009013
305 Ga0450894_017955
306 Ga0439446_0011609
307 Ga0439434_0005169
308 Ga0466961_0101145
309 Ga0466968_0004499
310 Ga0466968_0060834
311 Ga0466970_0205109
312 Ga0466967_0682011
313 Ga0495583_0014224
314 Ga0495668_0037161
315 Ga0495611_0232130
316 Ga0495625_0029470
317 Ga0495670_0036441
318 Ga0495677_0009238
319 Ga0495681_0068853
320 Ga0495686_0009998
321 Ga0496102_0000010
322 Ga0496102_0068254
323 Ga0496103_0000029
324 Ga0496105_0070015
325 Ga0496115_0000665
326 Ga0496116_0003035
327 Ga0496117_0000037
328 Ga0496118_0000034
329 Ga0496119_0146201
330 Ga0496120_0064008
331 Ga0496121_0077527
332 Ga0496123_0119414
333 Ga0496124_0000033
334 Ga0496124_0368527
335 Ga0501034_0148997
336 Ga0501043_0021740
337 Ga0501035_0507504
338 Ga0501044_0034270
339 Ga0501044_0706516
340 Ga0500643_000044
341 Ga0500643_002398
342 Ga0500583_0286666
343 Ga0500566_0004226
344 Ga0500641_0294543
345 Ga0500555_030018
346 Ga0500562_015916
347 Ga0500595_001321
348 Ga0500626_093497
349 Ga0500652_222027
350 Ga0500658_0001159
351 Ga0500658_0010532
352 Ga0500559_0001036
353 Ga0500568_0014837
354 Ga0500577_0098782
355 Ga0500616_0057722
356 Ga0500645_000842
357 Ga0500645_067936
358 Ga0500661_005075
359 2644127341
360 2879163694
361 2928029791
362 2984556650
363 2984565177
364 2990268244
365 2993356253
366 2993696724

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02698

DUF218

DUF218 domain

37

167

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
5c2f-assembly1.cif.gz_A k428a mutant nuclease domain of the large terminase subunit gp2 of bacterial virus sf6 with manganese and beta-thujaplicinol 0.703 94 148
4cvn-assembly3.cif.gz_H structure of the fap7-rps14 complex 0.7016 99 150
5c2d-assembly1.cif.gz_A k428a mutant gp2c of large terminase subunit from bacteriophage sf6 with calcium 0.6802 93 150
4cw7-assembly3.cif.gz_F structure of the fap7-rps14 complex in complex with atp 0.677 99 150
2dfe-assembly1.cif.gz_A crystal structure of tk-rnase hii(1-200)-c 0.6742 99 148
ID Description Score Start End Superfamily
af_P42598_32_210_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.6919 16 174 3.40.50.620
af_Q54FL1_98_236_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.6799 33 145 3.40.50.620
2fi1A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.6479 32 145 3.40.50.1000
af_A0A1D6HR89_2_270_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.6369 29 96 3.50.50.60
3ovkD00 Alpha Beta;3-Layer(aba) Sandwich;Creatine Amidinohydrolase; Chain A, domain 1;Creatinase/prolidase N-terminal domain 0.6348 90 148 3.40.350.10
ID Description Score Start End GO Terms
AF-A0A2E2ZYA6-F1-model_v4 deleted 0.97 23 178
AF-A0A2W5BJK1-F1-model_v4 deleted 0.9669 82 180
AF-A0A0Q4IEB2-F1-model_v4 DUF218 domain-containing protein 0.9664 39 178
AF-A0A0Q4KYJ1-F1-model_v4 DUF218 domain-containing protein 0.9612 23 178
AF-A0A165Q3A6-F1-model_v4 deleted 0.9542 1 174

Map