F280526

General Info

Members Datasets Scaffolds Average Seq Length
183 143 183 486

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_100000120|Ga0070665_10000012025
Length 548
Sequence MSDALAGLGVLVAACGAAGAILLPAGRLRSMAMLTALVLFPMLILADQWHSHQIVDLRHSTGRLVVLGLAGLALTAALAYVFRRWPLLLPLAIVAALPFRVPLHSGGDTANLLVPLYLVIAGGVLATALRTWRASHPLLPGGGTVGGPAPEDALPAVAGPAGPSAWLPRVLAAVVVLYAVQVLYSEDFSKGLQNVCFFFVPFSLVYGLLREVRWDRRLLTLVLWVIGIEAVCFVLVGSVEFVSKSLFWNDQVIRSNEFHTYFRVNSVFWDPNIYGRYLSLVAVVAMSALLWARERKTLALLTALIAVLWIGLVPTFSQSSFAALLAGLVVLAALRWSLKWTAIAAVGGVVLTMLIVTLAGSFSFDRINIDTSGRANLVSGGVHLFTQRPIYGYGSGSFPKAYRKHVKTRKAPVSVSHTEPITVAAEQGFIGLALYAALVVTALWTMSAGLRPSLSRLAAPRPGGAIGGPAPEDALATGXXXXSPAVTGPARQVARAAVFATFVALVVHTMAYAGFYEDPITWVLLAAGASLAAAQQRRVEPCPDTSAA

Samples

Sample ID Description Type Environment
1 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
24 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
29 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
30 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
31 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
32 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
34 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
35 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
36 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
37 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
38 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
41 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
42 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
43 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
44 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
45 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
46 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
47 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
48 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
72 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
73 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
74 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
75 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
76 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
77 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
78 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
79 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
80 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
81 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
82 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
83 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
84 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
85 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
86 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
87 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
88 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
89 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
90 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
91 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
92 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
93 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
94 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
95 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
96 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
97 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
98 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
99 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
100 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
101 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
102 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
103 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
104 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
105 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
106 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
107 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
108 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
109 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
110 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
111 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
112 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
113 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
126 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
127 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
128 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
129 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
130 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
131 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
132 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
133 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
134 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
137 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
138 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
139 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
140 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
141 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
142 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
143 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.55
Nodule 0
Rhizoplane 9.29
Rhizosphere 85.25
Stem 0
Stem Tuber 0
Unclassified 4.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24034J26672_10000074 3300002239 Bacteria 24671
2 Ga0070683_100020417 3300005329 Bacteria 5896
3 Ga0070683_100024871 3300005329 Bacteria 5370
4 Ga0070677_10000048 3300005333 Bacteria 37331
5 Ga0070666_10023154 3300005335 Bacteria 4040
6 Ga0070682_100000029 3300005337 Bacteria 183516
7 Ga0068868_100000451 3300005338 Bacteria 27446
8 Ga0070691_10001456 3300005341 Bacteria 10139
9 Ga0070668_100180792 3300005347 Bacteria 1723
10 Ga0070674_100000033 3300005356 Bacteria 63982
11 Ga0070674_100000241 3300005356 Bacteria 27097
12 Ga0070673_100000245 3300005364 Bacteria 27379
13 Ga0070688_100000468 3300005365 Bacteria 20469
14 Ga0070714_100041061 3300005435 Bacteria 3902
15 Ga0070711_100003341 3300005439 Bacteria 9338
16 Ga0070678_100115546 3300005456 Unclassified 2107
17 Ga0070662_100000008 3300005457 Bacteria 168754
18 Ga0068867_100001373 3300005459 Bacteria 16810
19 Ga0070685_10000028 3300005466 Bacteria 90128
20 Ga0070679_100000823 3300005530 Bacteria 26958
21 Ga0070684_100049781 3300005535 Bacteria 3638
22 Ga0070684_100054463 3300005535 Bacteria 3486
23 Ga0068853_100055822 3300005539 Bacteria 3405
24 Ga0070665_100000120 3300005548 Bacteria 148340
25 Ga0070665_100061855 3300005548 Bacteria 3754
26 Ga0070665_100109587 3300005548 Bacteria 2763
27 Ga0070665_100192101 3300005548 Bacteria 2042
28 Ga0068856_100029152 3300005614 Bacteria 5391
29 Ga0068864_100000044 3300005618 Bacteria 157919
30 Ga0068866_10000002 3300005718 Bacteria 394090
31 Ga0068863_100000080 3300005841 Bacteria 106670
32 Ga0068858_100000035 3300005842 Bacteria 140466
33 Ga0068858_100000042 3300005842 Bacteria 132482
34 Ga0068860_100028310 3300005843 Bacteria 5393
35 Ga0081455_10014187 3300005937 Bacteria 7823
36 Ga0081455_10032845 3300005937 Bacteria 4670
37 Ga0081538_10001173 3300005981 Bacteria 27665
38 Ga0070715_10000015 3300006163 Bacteria 152816
39 Ga0070716_100053520 3300006173 Bacteria 2302
40 Ga0097621_100099100 3300006237 Bacteria 2449
41 Ga0097621_100208062 3300006237 Bacteria 1701
42 Ga0075433_10000031 3300006852 Bacteria 55735
43 Ga0075433_10009223 3300006852 Bacteria 7887
44 Ga0075434_100082215 3300006871 Bacteria 3218
45 Ga0105245_10000045 3300009098 Bacteria 134057
46 Ga0105245_10000150 3300009098 Bacteria 66121
47 Ga0105242_10010765 3300009176 Bacteria 7021
48 Ga0105242_10011835 3300009176 Bacteria 6714
49 Ga0105238_10000240 3300009551 Bacteria 61138
50 Ga0105249_10000095 3300009553 Bacteria 121300
51 Ga0105239_10013475 3300010375 Bacteria 9080
52 Ga0157370_10014499 3300013104 Bacteria 8056
53 Ga0157369_10000037 3300013105 Bacteria 190395
54 Ga0157374_10000668 3300013296 Bacteria 30198
55 Ga0157375_10000723 3300013308 Bacteria 29095
56 Ga0157375_10006804 3300013308 Bacteria 9953
57 Ga0157380_10000024 3300014326 Bacteria 110947
58 Ga0157380_10000202 3300014326 Bacteria 35113
59 Ga0157379_10032895 3300014968 Bacteria 4624
60 Ga0157376_10009733 3300014969 Bacteria 6999
61 Ga0157376_10127192 3300014969 Bacteria 2268
62 Ga0163161_10000058 3300017792 Bacteria 114035
63 Ga0207682_10000168 3300025893 Bacteria 30073
64 Ga0207642_10000001 3300025899 Bacteria 714030
65 Ga0207642_10000003 3300025899 Bacteria 650651
66 Ga0207642_10000258 3300025899 Bacteria 15861
67 Ga0207680_10027448 3300025903 Bacteria 3170
68 Ga0207685_10000001 3300025905 Bacteria 604473
69 Ga0207663_10011424 3300025916 Bacteria 4769
70 Ga0207652_10001431 3300025921 Bacteria 21145
71 Ga0207694_10000067 3300025924 Bacteria 128108
72 Ga0207687_10000021 3300025927 Bacteria 226396
73 Ga0207687_10000023 3300025927 Bacteria 217098
74 Ga0207687_10000099 3300025927 Bacteria 63345
75 Ga0207706_10000016 3300025933 Bacteria 170697
76 Ga0207686_10003754 3300025934 Bacteria 8151
77 Ga0207686_10005499 3300025934 Bacteria 6798
78 Ga0207669_10000014 3300025937 Bacteria 129145
79 Ga0207669_10000137 3300025937 Bacteria 35016
80 Ga0207661_10013560 3300025944 Bacteria 5953
81 Ga0207712_10000003 3300025961 Bacteria 615314
82 Ga0207677_10000376 3300026023 Bacteria 30827
83 Ga0207703_10000060 3300026035 Bacteria 134334
84 Ga0207703_10000067 3300026035 Bacteria 125623
85 Ga0207639_10015952 3300026041 Bacteria 5306
86 Ga0207702_10009270 3300026078 Bacteria 8271
87 Ga0207641_10000591 3300026088 Bacteria 39932
88 Ga0207648_10000228 3300026089 Bacteria 60032
89 Ga0207676_10000043 3300026095 Bacteria 161948
90 Ga0207683_10209218 3300026121 Unclassified 1775
91 Ga0268266_10000023 3300028379 Bacteria 501899
92 Ga0268266_10042750 3300028379 Bacteria 3871
93 Ga0268264_10007408 3300028381 Bacteria 9161
94 Ga0395900_0076347 3300037418 Bacteria 3444
95 Ga0395900_0206726 3300037418 Unclassified 1984
96 Ga0395898_0046932 3300037466 Bacteria 4241
97 Ga0395901_0031058 3300038443 Bacteria 5507
98 Ga0395901_0225949 3300038443 Bacteria 1955
99 Ga0451853_2960930 3300041512 Bacteria 3835
100 Ga0451853_3713106 3300041512 Bacteria 4139
101 Ga0466967_0039439 3300045976 Bacteria 4061
102 Ga0495641_0000187 3300046461 Bacteria 47961
103 Ga0495653_0080445 3300046463 Unclassified 2411
104 Ga0495662_0000022 3300046476 Bacteria 54342
105 Ga0495608_0000702 3300046511 Bacteria 23274
106 Ga0495618_0000068 3300046514 Bacteria 74614
107 Ga0495620_0000580 3300046515 Bacteria 22923
108 Ga0495628_0002703 3300046516 Bacteria 15872
109 Ga0495628_0029901 3300046516 Bacteria 4414
110 Ga0495587_0015493 3300046536 Bacteria 4760
111 Ga0495598_0002334 3300046537 Bacteria 3907
112 Ga0495645_0027362 3300046543 Bacteria 4143
113 Ga0495645_0037226 3300046543 Bacteria 3546
114 Ga0495656_0009659 3300046615 Unclassified 3478
115 Ga0495635_0072277 3300046663 Unclassified 2364
116 Ga0495647_0003993 3300046681 Bacteria 4762
117 Ga0495669_0000163 3300046684 Bacteria 42549
118 Ga0495613_0000257 3300046689 Bacteria 50000
119 Ga0495624_0000013 3300046690 Bacteria 115278
120 Ga0495649_0000828 3300046694 Bacteria 24830
121 Ga0495600_0000368 3300046809 Bacteria 23654
122 Ga0495604_0000033 3300047317 Bacteria 134810
123 Ga0495676_0000091 3300047321 Bacteria 66575
124 Ga0495680_0000023 3300047322 Bacteria 116444
125 Ga0496100_0000003 3300048903 Bacteria 360802
126 Ga0496101_0000003 3300048904 Bacteria 406565
127 Ga0496103_0014356 3300048906 Bacteria 4705
128 Ga0496104_0000003 3300048907 Bacteria 669219
129 Ga0496104_0001015 3300048907 Bacteria 24067
130 Ga0496105_0000031 3300048908 Bacteria 137220
131 Ga0496105_0000209 3300048908 Bacteria 39293
132 Ga0496105_0013957 3300048908 Bacteria 6387
133 Ga0496106_0000048 3300048909 Bacteria 98233
134 Ga0496106_0000052 3300048909 Bacteria 94849
135 Ga0496107_0000008 3300048910 Bacteria 251874
136 Ga0496107_0067323 3300048910 Unclassified 2598
137 Ga0496108_0000002 3300048911 Bacteria 700890
138 Ga0496109_0000001 3300048912 Bacteria 700852
139 Ga0496109_0000237 3300048912 Bacteria 53743
140 Ga0496110_0031609 3300048913 Bacteria 4568
141 Ga0496114_0017181 3300048917 Bacteria 5835
142 Ga0496116_0000014 3300048919 Bacteria 569049
143 Ga0496118_0030989 3300048921 Bacteria 4447
144 Ga0496119_0000441 3300048922 Bacteria 56986
145 Ga0496119_0005230 3300048922 Bacteria 12516
146 Ga0496119_0040658 3300048922 Bacteria 2971
147 Ga0496121_0169641 3300048924 Bacteria 1587
148 Ga0496126_0020391 3300048929 Bacteria 6500
149 Ga0501031_0000251 3300049568 Bacteria 30080
150 Ga0501032_0004053 3300049569 Bacteria 11106
151 Ga0501033_0001949 3300049570 Bacteria 17968
152 Ga0501034_0050730 3300049571 Bacteria 4184
153 Ga0501036_0000413 3300049572 Bacteria 30169
154 Ga0501037_0003758 3300049573 Bacteria 11011
155 Ga0501038_0001433 3300049574 Bacteria 21875
156 Ga0501042_0055413 3300049578 Bacteria 2829
157 Ga0501043_0004677 3300049579 Bacteria 11096
158 Ga0501046_0005748 3300049580 Bacteria 11068
159 Ga0501047_0002582 3300049581 Bacteria 17235
160 Ga0501048_0000406 3300049582 Bacteria 29993
161 Ga0501068_0033100 3300049584 Bacteria 3077
162 Ga0501069_0001897 3300049585 Bacteria 10434
163 Ga0501070_0000079 3300049586 Bacteria 82054
164 Ga0501070_0007649 3300049586 Bacteria 9174
165 Ga0501071_0053015 3300049587 Bacteria 2925
166 Ga0501073_0004042 3300049589 Bacteria 11026
167 Ga0501074_0009333 3300049590 Bacteria 7127
168 Ga0501079_0013663 3300049741 Bacteria 6192
169 Ga0501080_0008572 3300049742 Bacteria 9273
170 Ga0501083_0003544 3300049744 Bacteria 10940
171 Ga0501035_0000059 3300049822 Bacteria 134506
172 Ga0501044_0000417 3300049823 Bacteria 52579
173 Ga0501045_0026318 3300049824 Bacteria 4184
174 nmdc:mga0n895_90578_c1 3300050512 Bacteria 3060
175 nmdc:mga0a205_9_c1 3300050515 Bacteria 55726
176 Ga0495612_0001747 3300053078 Bacteria 8905
177 Ga0495595_0000109 3300053084 Bacteria 37617
178 Ga0495619_0000129 3300053085 Bacteria 55936
179 Ga0495619_0000909 3300053085 Bacteria 19385
180 Ga0495619_0005218 3300053085 Bacteria 8235
181 Ga0495619_0019135 3300053085 Bacteria 4351
182 Ga0500614_000177 3300053123 Bacteria 16403
183 Ga0501082_0075595 3300060353 Bacteria 2902

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048909 Ga0496106_0000052 Ga0496106_0000052_88684_90210 382
2 3300037418 Ga0395900_0076347 Ga0395900_0076347_1853_3364 391
3 3300046516 Ga0495628_0002703 Ga0495628_0002703_8138_9808 392
4 3300046537 Ga0495598_0002334 Ga0495598_0002334_155_1678 394
5 3300013105 Ga0157369_10000037 Ga0157369_1000003730 395
6 3300047317 Ga0495604_0000033 Ga0495604_0000033_32155_33876 395
7 3300005456 Ga0070678_100115546 Ga0070678_1001155462 396
8 3300026121 Ga0207683_10209218 Ga0207683_102092182 396
9 3300046681 Ga0495647_0003993 Ga0495647_0003993_1301_2875 396
10 3300048907 Ga0496104_0001015 Ga0496104_0001015_12676_14247 400
11 3300048908 Ga0496105_0000209 Ga0496105_0000209_598_2169 400
12 3300053085 Ga0495619_0005218 Ga0495619_0005218_535_2025 403
13 3300005365 Ga0070688_100000468 Ga0070688_1000004685 407
14 3300005459 Ga0068867_100001373 Ga0068867_10000137316 407
15 3300005466 Ga0070685_10000028 Ga0070685_1000002865 407
16 3300009551 Ga0105238_10000240 Ga0105238_1000024032 407
17 3300025924 Ga0207694_10000067 Ga0207694_1000006796 407
18 3300026089 Ga0207648_10000228 Ga0207648_1000022851 407
19 3300037418 Ga0395900_0206726 Ga0395900_0206726_302_1885 407
20 3300046515 Ga0495620_0000580 Ga0495620_0000580_1957_3477 407
21 3300048908 Ga0496105_0013957 Ga0496105_0013957_2857_4353 407
22 3300048919 Ga0496116_0000014 Ga0496116_0000014_468090_469595 407
23 3300048921 Ga0496118_0030989 Ga0496118_0030989_148_1653 407
24 3300048922 Ga0496119_0000441 Ga0496119_0000441_7928_9433 407
25 3300048911 Ga0496108_0000002 Ga0496108_0000002_217074_218594 408
26 3300048912 Ga0496109_0000001 Ga0496109_0000001_217036_218556 408
27 3300014969 Ga0157376_10009733 Ga0157376_100097336 410
28 3300005530 Ga0070679_100000823 Ga0070679_10000082312 411
29 3300025921 Ga0207652_10001431 Ga0207652_1000143122 411
30 3300005439 Ga0070711_100003341 Ga0070711_1000033414 412
31 3300025916 Ga0207663_10011424 Ga0207663_100114244 412
32 3300045976 Ga0466967_0039439 Ga0466967_0039439_1650_3131 412
33 3300005435 Ga0070714_100041061 Ga0070714_1000410614 413
34 3300005843 Ga0068860_100028310 Ga0068860_1000283104 413
35 3300028381 Ga0268264_10007408 Ga0268264_100074085 413
36 3300005548 Ga0070665_100192101 Ga0070665_1001921012 414
37 3300005937 Ga0081455_10032845 Ga0081455_100328454 414
38 3300047322 Ga0495680_0000023 Ga0495680_0000023_57503_58993 414
39 3300014326 Ga0157380_10000024 Ga0157380_10000024111 415
40 3300014968 Ga0157379_10032895 Ga0157379_100328952 416
41 3300046615 Ga0495656_0009659 Ga0495656_0009659_1451_3121 417
42 3300048903 Ga0496100_0000003 Ga0496100_0000003_352885_354411 417
43 3300048904 Ga0496101_0000003 Ga0496101_0000003_352885_354411 417
44 3300048909 Ga0496106_0000048 Ga0496106_0000048_6395_7921 417
45 3300048910 Ga0496107_0000008 Ga0496107_0000008_243945_245471 417
46 3300005981 Ga0081538_10001173 Ga0081538_1000117313 418
47 3300017792 Ga0163161_10000058 Ga0163161_1000005868 418
48 3300046543 Ga0495645_0037226 Ga0495645_0037226_2040_3476 418
49 3300048907 Ga0496104_0000003 Ga0496104_0000003_129306_130895 418
50 3300048908 Ga0496105_0000031 Ga0496105_0000031_6326_7876 418
51 3300046476 Ga0495662_0000022 Ga0495662_0000022_40870_42381 420
52 3300005539 Ga0068853_100055822 Ga0068853_1000558223 421
53 3300026041 Ga0207639_10015952 Ga0207639_100159522 421
54 3300046536 Ga0495587_0015493 Ga0495587_0015493_2299_3921 421
55 3300046694 Ga0495649_0000828 Ga0495649_0000828_2258_3814 421
56 3300005457 Ga0070662_100000008 Ga0070662_100000008109 422
57 3300025933 Ga0207706_10000016 Ga0207706_1000001665 422
58 3300049586 Ga0501070_0007649 Ga0501070_0007649_1898_3403 422
59 3300041512 Ga0451853_2960930 Ga0451853_2960930_22_1560 423
60 3300041512 Ga0451853_3713106 Ga0451853_3713106_1397_2965 423
61 3300005333 Ga0070677_10000048 Ga0070677_1000004811 424
62 3300025893 Ga0207682_10000168 Ga0207682_1000016822 424
63 3300048922 Ga0496119_0040658 Ga0496119_0040658_227_1723 424
64 3300048924 Ga0496121_0169641 Ga0496121_0169641_27_1427 424
65 3300053085 Ga0495619_0019135 Ga0495619_0019135_1449_3032 424
66 3300005356 Ga0070674_100000033 Ga0070674_10000003334 425
67 3300005364 Ga0070673_100000245 Ga0070673_10000024520 425
68 3300005614 Ga0068856_100029152 Ga0068856_1000291522 425
69 3300005718 Ga0068866_10000002 Ga0068866_1000000288 425
70 3300006173 Ga0070716_100053520 Ga0070716_1000535202 425
71 3300014969 Ga0157376_10127192 Ga0157376_101271922 425
72 3300025899 Ga0207642_10000001 Ga0207642_10000001520 425
73 3300025899 Ga0207642_10000003 Ga0207642_10000003520 425
74 3300025937 Ga0207669_10000137 Ga0207669_1000013734 425
75 3300026078 Ga0207702_10009270 Ga0207702_100092705 425
76 3300038443 Ga0395901_0031058 Ga0395901_0031058_93_1685 425
77 3300046463 Ga0495653_0080445 Ga0495653_0080445_37_1620 425
78 3300046514 Ga0495618_0000068 Ga0495618_0000068_43479_45158 425
79 3300046543 Ga0495645_0027362 Ga0495645_0027362_2539_4089 425
80 3300046809 Ga0495600_0000368 Ga0495600_0000368_19500_21179 425
81 3300048929 Ga0496126_0020391 Ga0496126_0020391_774_2288 425
82 3300049578 Ga0501042_0055413 Ga0501042_0055413_25_1491 425
83 3300049584 Ga0501068_0033100 Ga0501068_0033100_888_2483 425
84 3300053084 Ga0495595_0000109 Ga0495595_0000109_846_2429 425
85 3300005937 Ga0081455_10014187 Ga0081455_100141876 426
86 3300009098 Ga0105245_10000045 Ga0105245_1000004525 426
87 3300010375 Ga0105239_10013475 Ga0105239_100134755 426
88 3300014326 Ga0157380_10000202 Ga0157380_1000020226 426
89 3300025927 Ga0207687_10000023 Ga0207687_1000002325 426
90 3300037466 Ga0395898_0046932 Ga0395898_0046932_1872_3422 426
91 3300038443 Ga0395901_0225949 Ga0395901_0225949_169_1719 426
92 3300046689 Ga0495613_0000257 Ga0495613_0000257_12676_14256 426
93 3300048906 Ga0496103_0014356 Ga0496103_0014356_2306_3811 426
94 3300048922 Ga0496119_0005230 Ga0496119_0005230_6952_8457 426
95 3300049568 Ga0501031_0000251 Ga0501031_0000251_21297_22799 426
96 3300049569 Ga0501032_0004053 Ga0501032_0004053_2106_3608 426
97 3300049570 Ga0501033_0001949 Ga0501033_0001949_2134_3636 426
98 3300049571 Ga0501034_0050730 Ga0501034_0050730_1138_2640 426
99 3300049572 Ga0501036_0000413 Ga0501036_0000413_21316_22818 426
100 3300049573 Ga0501037_0003758 Ga0501037_0003758_2117_3619 426
101 3300049574 Ga0501038_0001433 Ga0501038_0001433_12841_14343 426
102 3300049579 Ga0501043_0004677 Ga0501043_0004677_7466_8968 426
103 3300049580 Ga0501046_0005748 Ga0501046_0005748_2132_3634 426
104 3300049581 Ga0501047_0002582 Ga0501047_0002582_13150_14652 426
105 3300049582 Ga0501048_0000406 Ga0501048_0000406_21190_22692 426
106 3300049585 Ga0501069_0001897 Ga0501069_0001897_7281_8783 426
107 3300049586 Ga0501070_0000079 Ga0501070_0000079_58906_60408 426
108 3300049587 Ga0501071_0053015 Ga0501071_0053015_450_1952 426
109 3300049589 Ga0501073_0004042 Ga0501073_0004042_7372_8874 426
110 3300049590 Ga0501074_0009333 Ga0501074_0009333_2120_3622 426
111 3300049741 Ga0501079_0013663 Ga0501079_0013663_2976_4478 426
112 3300049742 Ga0501080_0008572 Ga0501080_0008572_1137_2639 426
113 3300049744 Ga0501083_0003544 Ga0501083_0003544_7316_8818 426
114 3300049822 Ga0501035_0000059 Ga0501035_0000059_69749_71251 426
115 3300049823 Ga0501044_0000417 Ga0501044_0000417_29792_31294 426
116 3300049824 Ga0501045_0026318 Ga0501045_0026318_1645_3147 426
117 3300060353 Ga0501082_0075595 Ga0501082_0075595_1127_2629 426
118 3300005335 Ga0070666_10023154 Ga0070666_100231544 427
119 3300005347 Ga0070668_100180792 Ga0070668_1001807921 427
120 3300005548 Ga0070665_100109587 Ga0070665_1001095872 427
121 3300006871 Ga0075434_100082215 Ga0075434_1000822152 427
122 3300025903 Ga0207680_10027448 Ga0207680_100274483 427
123 3300028379 Ga0268266_10042750 Ga0268266_100427502 427
124 3300048910 Ga0496107_0067323 Ga0496107_0067323_69_1622 427
125 3300050512 nmdc:mga0n895_90578_c1 nmdc:mga0n895_90578_c1_1085_2839 427
126 3300005548 Ga0070665_100061855 Ga0070665_1000618554 428
127 3300025927 Ga0207687_10000021 Ga0207687_1000002120 428
128 3300005338 Ga0068868_100000451 Ga0068868_10000045120 429
129 3300026023 Ga0207677_10000376 Ga0207677_1000037620 429
130 3300046516 Ga0495628_0029901 Ga0495628_0029901_1406_2911 429
131 3300009098 Ga0105245_10000150 Ga0105245_1000015021 430
132 3300025927 Ga0207687_10000099 Ga0207687_1000009920 430
133 3300047321 Ga0495676_0000091 Ga0495676_0000091_9507_11162 430
134 3300006163 Ga0070715_10000015 Ga0070715_1000001580 431
135 3300025905 Ga0207685_10000001 Ga0207685_10000001346 431
136 3300005535 Ga0070684_100049781 Ga0070684_1000497812 432
137 3300048913 Ga0496110_0031609 Ga0496110_0031609_2543_4186 432
138 3300048917 Ga0496114_0017181 Ga0496114_0017181_2578_4116 432
139 3300013308 Ga0157375_10006804 Ga0157375_100068048 434
140 3300046511 Ga0495608_0000702 Ga0495608_0000702_12814_14397 434
141 3300046684 Ga0495669_0000163 Ga0495669_0000163_6414_7931 435
142 3300006852 Ga0075433_10000031 Ga0075433_1000003110 436
143 3300009553 Ga0105249_10000095 Ga0105249_1000009516 436
144 3300025961 Ga0207712_10000003 Ga0207712_10000003510 436
145 3300050515 nmdc:mga0a205_9_c1 nmdc:mga0a205_9_c1_7742_9400 436
146 3300005337 Ga0070682_100000029 Ga0070682_100000029144 438
147 3300046461 Ga0495641_0000187 Ga0495641_0000187_42880_44457 438
148 3300053123 Ga0500614_000177 Ga0500614_000177_12743_14320 438
149 3300013308 Ga0157375_10000723 Ga0157375_100007238 439
150 3300053085 Ga0495619_0000909 Ga0495619_0000909_5909_7492 440
151 3300005841 Ga0068863_100000080 Ga0068863_10000008012 447
152 3300006237 Ga0097621_100099100 Ga0097621_1000991002 447
153 3300026088 Ga0207641_10000591 Ga0207641_1000059133 447
154 3300046690 Ga0495624_0000013 Ga0495624_0000013_96088_97641 447
155 3300005329 Ga0070683_100020417 Ga0070683_1000204174 449
156 3300005356 Ga0070674_100000241 Ga0070674_10000024129 449
157 3300005535 Ga0070684_100054463 Ga0070684_1000544632 449
158 3300009176 Ga0105242_10010765 Ga0105242_100107652 449
159 3300013296 Ga0157374_10000668 Ga0157374_1000066817 449
160 3300025899 Ga0207642_10000258 Ga0207642_100002589 449
161 3300025934 Ga0207686_10003754 Ga0207686_100037546 449
162 3300025937 Ga0207669_10000014 Ga0207669_10000014104 449
163 3300025944 Ga0207661_10013560 Ga0207661_100135603 449
164 3300053078 Ga0495612_0001747 Ga0495612_0001747_5524_7101 450
165 3300005341 Ga0070691_10001456 Ga0070691_100014568 451
166 3300005329 Ga0070683_100024871 Ga0070683_1000248714 453
167 3300005548 Ga0070665_100000120 Ga0070665_10000012025 454
168 3300005842 Ga0068858_100000035 Ga0068858_10000003523 454
169 3300006852 Ga0075433_10009223 Ga0075433_100092237 454
170 3300026035 Ga0207703_10000067 Ga0207703_1000006756 454
171 3300028379 Ga0268266_10000023 Ga0268266_10000023385 454
172 3300006237 Ga0097621_100208062 Ga0097621_1002080622 455
173 3300005842 Ga0068858_100000042 Ga0068858_100000042114 457
174 3300013104 Ga0157370_10014499 Ga0157370_100144998 457
175 3300026035 Ga0207703_10000060 Ga0207703_1000006022 457
176 3300046663 Ga0495635_0072277 Ga0495635_0072277_441_2201 459
177 3300048912 Ga0496109_0000237 Ga0496109_0000237_32043_33644 461
178 3300009176 Ga0105242_10011835 Ga0105242_100118352 463
179 3300025934 Ga0207686_10005499 Ga0207686_100054995 463
180 3300053085 Ga0495619_0000129 Ga0495619_0000129_51494_53188 463
181 3300002239 JGI24034J26672_10000074 JGI24034J26672_1000007423 465
182 3300005618 Ga0068864_100000044 Ga0068864_100000044112 465
183 3300026095 Ga0207676_10000043 Ga0207676_10000043111 465

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04932

Wzy_C

O-Antigen ligase

303

436

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
7tpj-assembly1.cif.gz_B single-particle cryo-em structure of the waal o-antigen ligase in its apo state 0.5793 49 462
7tpj-assembly1.cif.gz_B single-particle cryo-em structure of the waal o-antigen ligase in its apo state 0.5755 49 462
6yo8-assembly2.cif.gz_C binary complex of 14-3-3 zeta with glucocorticoid receptor (gr) pt524 peptide 0.2673 74 290
6v36-assembly1.cif.gz_A k2p2.1(trek-1)i110d apo channel structure 0.2611 224 464
5oma-assembly1.cif.gz_C ch3 chimera of human 14-3-3 sigma with the stard1 peptide including ser57 0.2561 82 289
ID Description Score Start End Superfamily
3aqbC00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.5493 224 316 1.20.120.1450
af_A0A1D6GHI2_826_935_1.20.58.810 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Photosystem II Pbs27 0.5123 238 320 1.20.58.810
af_P0CE94_859_989_1.20.120.230 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.4126 135 288 1.20.120.230
af_A0A1D6GHI2_826_935_1.20.58.810 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Photosystem II Pbs27 0.4016 238 320 1.20.58.810
3aqbC00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.4014 224 316 1.20.120.1450
ID Description Score Start End GO Terms
AF-A0A7K0RAY2-F1-model_v4 O-antigen ligase domain-containing protein 0.8962 1 309 GO:0016020
AF-A0A7V9GUK2-F1-model_v4 Lycopene cyclase domain-containing protein 0.8729 2 269 GO:0016020
AF-A0A538LQ67-F1-model_v4 O-antigen ligase-related domain-containing protein 0.8573 146 463 GO:0016020
AF-A0A6J5Z3N2-F1-model_v4 Unannotated protein 0.8568 1 464 GO:0016020
AF-A0A537ZME6-F1-model_v4 O-antigen ligase-related domain-containing protein 0.8553 166 460 GO:0016020

Feature Viewer

pLDDT pTM Quality
74.48 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map