F280741

General Info

Members Datasets Scaffolds Average Seq Length
183 142 366 345

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10000887|Ga0105240_1000088736
Length 386
Sequence VSDPVIVKGALSWCGGGRGDPCWGDLFGHLASITEEATMNYRALGRTGLRVSELCFGTMTFGGDGIYKAIGQTAQQEAERQVNLCLDAGINFFDTADTYSFGMAEEILGKALGARRKQVVVATKVRGRVGKGPNEVGLSRGHIMDGIDNSLRRLGTDYVDLYQIHGFDRHTPWEETLRALDDLVRMGKVRYIGASNLAGWQLMKALGISERDRLARFETLQAYYSVAGRDLERELAPLMESERVGLLVWSPLAGGFLSGKFTRENKQPQDTRRSSFNFPPVDEARGWSALDALAVVAKEQGASVARVALAWLLEQKVTTSVIIGARNEQQLRDNLAAAELKLTPAQLELIGAASALPPEYPGWMVAIQDRDRLEAIPPEKRFAKVS

Samples

Sample ID Description Type Environment
1 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
11 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
12 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
13 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
14 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
15 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
16 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
17 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
18 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
19 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
20 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
21 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
22 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
23 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
24 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
25 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
26 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
27 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
28 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
29 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
30 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
31 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
32 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
33 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
34 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
35 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
36 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
37 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
38 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
55 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
56 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
57 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
58 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
59 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
60 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
61 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
62 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
63 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
64 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
65 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
66 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
67 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
68 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
69 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
70 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
71 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
72 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
73 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
74 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
75 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
76 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
77 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
78 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
79 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
80 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
81 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
82 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
83 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
84 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
85 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
86 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
87 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
88 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
89 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
90 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
91 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
92 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
93 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
94 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
95 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
96 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
97 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
98 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
99 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
100 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
101 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
102 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
103 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
104 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
105 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
106 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
114 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
115 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
116 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
118 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
119 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
120 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
121 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
122 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
123 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
124 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
125 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
126 2738541277 Variovorax sp. GV051 Isolate Unclassified
127 2738541307 Variovorax sp. GV008 Isolate Unclassified
128 2738543019 Variovorax sp. GV040 Isolate Unclassified
129 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
130 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
131 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
132 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
133 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
134 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
135 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
136 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
137 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
138 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
139 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
140 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
141 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
142 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 89.62
Metatranscriptomes 1.09
Isolates 9.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.2
Nodule 0
Rhizoplane 2.19
Rhizosphere 73.77
Stem 0
Stem Tuber 0
Unclassified 1.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105240_10000887 3300009093 Bacteria 53725
2 LJNas_1000086 3300000546 Bacteria 13626
3 rootH2_10001391 3300003320 Bacteria 106251
4 rootH2_10088768 3300003320 Bacteria 10019
5 rootH1_10114450 3300003323 Bacteria 2863
6 rootH1_10153222 3300003323 Bacteria 1457
7 Ga0065165_1004042 3300005262 Bacteria 9532
8 Ga0065165_1016613 3300005262 Bacteria 2747
9 Ga0070658_10000913 3300005327 Bacteria 25306
10 Ga0070658_10175012 3300005327 Bacteria 1804
11 Ga0070658_10303503 3300005327 Bacteria 1361
12 Ga0070683_100002301 3300005329 Bacteria 15144
13 Ga0070682_100262741 3300005337 Bacteria 1250
14 Ga0070660_100001987 3300005339 Bacteria 14113
15 Ga0070679_100002129 3300005530 Bacteria 17839
16 Ga0070679_100017636 3300005530 Bacteria 6911
17 Ga0070679_100051669 3300005530 Bacteria 4094
18 Ga0070665_100033407 3300005548 Bacteria 5176
19 Ga0070704_100258370 3300005549 Bacteria 1434
20 Ga0068855_100099264 3300005563 Bacteria 3354
21 Ga0068855_100113904 3300005563 Bacteria 3101
22 Ga0068855_100185621 3300005563 Bacteria 2349
23 Ga0068855_100189350 3300005563 Bacteria 2322
24 Ga0068857_100020393 3300005577 Bacteria 5829
25 Ga0068856_100046250 3300005614 Bacteria 4287
26 Ga0068856_100368988 3300005614 Bacteria 1454
27 Ga0068852_100077237 3300005616 Bacteria 2943
28 Ga0068864_100031689 3300005618 Bacteria 4487
29 Ga0068851_10073234 3300005834 Bacteria 1776
30 Ga0068863_100053856 3300005841 Bacteria 3814
31 Ga0070717_10093451 3300006028 Bacteria 2543
32 Ga0075366_10040204 3300006195 Bacteria 2766
33 Ga0105240_10000113 3300009093 Bacteria 168192
34 Ga0105240_10006834 3300009093 Bacteria 16685
35 Ga0105245_10110637 3300009098 Bacteria 2554
36 Ga0105245_10289021 3300009098 Bacteria 1605
37 Ga0105237_10000123 3300009545 Bacteria 108048
38 Ga0105237_10001671 3300009545 Bacteria 28711
39 Ga0105237_10122576 3300009545 Bacteria 2594
40 Ga0105237_10268165 3300009545 Bacteria 1710
41 Ga0105238_10017094 3300009551 Bacteria 7362
42 Ga0105239_10000729 3300010375 Bacteria 46745
43 Ga0105239_10098598 3300010375 Bacteria 3230
44 Ga0105239_10191865 3300010375 Bacteria 2287
45 Ga0157370_10113825 3300013104 Bacteria 2528
46 Ga0157369_10012364 3300013105 Bacteria 9691
47 Ga0157369_10037989 3300013105 Bacteria 5268
48 Ga0157369_10130351 3300013105 Bacteria 2665
49 Ga0157374_10584584 3300013296 Bacteria 1126
50 Ga0157378_10165836 3300013297 Bacteria 2069
51 Ga0157372_10226760 3300013307 Bacteria 2166
52 Ga0163163_10168014 3300014325 Bacteria 2240
53 Ga0157376_10083443 3300014969 Bacteria 2749
54 Ga0182005_1000159 3300015265 Bacteria 47132
55 Ga0209436_102064 3300025208 Bacteria 6311
56 Ga0209675_1017921 3300025291 Bacteria 2000
57 Ga0209025_1007331 3300025294 Bacteria 8256
58 Ga0207426_1002496 3300025302 Bacteria 11628
59 Ga0207647_10021813 3300025904 Bacteria 4265
60 Ga0207647_10050411 3300025904 Bacteria 2577
61 Ga0207705_10016138 3300025909 Bacteria 5360
62 Ga0207705_10039762 3300025909 Bacteria 3371
63 Ga0207695_10000816 3300025913 Bacteria 57734
64 Ga0207695_10012843 3300025913 Bacteria 10025
65 Ga0207671_10000158 3300025914 Bacteria 105476
66 Ga0207671_10000236 3300025914 Bacteria 83019
67 Ga0207657_10000483 3300025919 Bacteria 42060
68 Ga0207652_10002186 3300025921 Bacteria 16712
69 Ga0207652_10059967 3300025921 Bacteria 3281
70 Ga0207694_10009763 3300025924 Bacteria 7243
71 Ga0207687_10077494 3300025927 Bacteria 2390
72 Ga0207664_10033623 3300025929 Bacteria 3941
73 Ga0207661_10018993 3300025944 Bacteria 5115
74 Ga0207667_10019323 3300025949 Bacteria 7610
75 Ga0207640_10123011 3300025981 Bacteria 1863
76 Ga0207702_10330472 3300026078 Bacteria 1454
77 Ga0207676_10182685 3300026095 Bacteria 1838
78 Ga0207698_10145425 3300026142 Bacteria 2049
79 Ga0268266_10001256 3300028379 Bacteria 30990
80 Ga0265319_1025741 3300028563 Bacteria 2103
81 Ga0265318_10009235 3300028577 Bacteria 4349
82 Ga0265336_10003249 3300028666 Bacteria 6442
83 Ga0265338_10236684 3300028800 Bacteria 1355
84 Ga0265330_10003176 3300031235 Bacteria 8687
85 Ga0265332_10021458 3300031238 Bacteria 2852
86 Ga0265332_10087902 3300031238 Bacteria 1316
87 Ga0265328_10036505 3300031239 Bacteria 1816
88 Ga0265320_10011293 3300031240 Bacteria 5262
89 Ga0265339_10002692 3300031249 Bacteria 12635
90 Ga0265316_10083679 3300031344 Bacteria 2444
91 Ga0307509_10017181 3300031507 Bacteria 8335
92 Ga0307509_10123652 3300031507 Bacteria 2559
93 Ga0265313_10037994 3300031595 Bacteria 2402
94 Ga0265313_10038856 3300031595 Bacteria 2366
95 Ga0307508_10000256 3300031616 Bacteria 64873
96 Ga0265314_10022807 3300031711 Bacteria 4790
97 Ga0265342_10000349 3300031712 Bacteria 51668
98 Ga0265342_10157233 3300031712 Bacteria 1258
99 Ga0316576_10197815 3300031727 Bacteria 1514
100 Ga0316577_10061784 3300031733 Bacteria 2091
101 Ga0307414_10002804 3300032004 Bacteria 9181
102 Ga0307415_100165510 3300032126 Bacteria 1719
103 Ga0316593_10021868 3300032168 Bacteria 2004
104 Ga0316593_10044806 3300032168 Bacteria 1481
105 Ga0307507_10000015 3300033179 Bacteria 237419
106 Ga0373934_0094682 3300035086 Bacteria 1206
107 Ga0373957_0043747 3300035120 Bacteria 1693
108 Ga0373933_0016472 3300035724 Bacteria 4134
109 Ga0373937_0002282 3300036401 Bacteria 16015
110 Ga0373937_0012054 3300036401 Bacteria 7586
111 Ga0395899_0004151 3300037312 Bacteria 11373
112 Ga0395898_0061135 3300037466 Bacteria 3659
113 Ga0436364_1403973 3300037853 Bacteria 2643
114 Ga0395901_0008521 3300038443 Bacteria 10357
115 Ga0400489_27980 3300039093 Bacteria 4094
116 Ga0439449_0052094 3300042007 Bacteria 1514
117 Ga0439462_0044176 3300042015 Bacteria 1192
118 Ga0439458_0032120 3300042157 Bacteria 1254
119 Ga0466966_0029801 3300044684 Bacteria 3548
120 Ga0466957_0004907 3300044842 Bacteria 7487
121 Ga0466959_0163718 3300045049 Bacteria 1563
122 Ga0495627_009996 3300046453 Bacteria 3468
123 Ga0495630_0299995 3300046517 Bacteria 1228
124 Ga0495604_0023189 3300047317 Bacteria 4954
125 Ga0495680_0104545 3300047322 Bacteria 2106
126 Ga0495686_0000102 3300047472 Bacteria 177525
127 Ga0495686_0014368 3300047472 Bacteria 5451
128 Ga0495686_0023226 3300047472 Unclassified 4092
129 Ga0495686_0069094 3300047472 Bacteria 2178
130 Ga0496100_0075052 3300048903 Bacteria 2267
131 Ga0496102_0231811 3300048905 Bacteria 1741
132 Ga0496105_0139903 3300048908 Bacteria 1993
133 Ga0496114_0156876 3300048917 Bacteria 1977
134 Ga0496116_0056091 3300048919 Bacteria 2584
135 Ga0496119_0146844 3300048922 Bacteria 1268
136 Ga0496121_0000395 3300048924 Bacteria 88604
137 Ga0496121_0235528 3300048924 Bacteria 1279
138 Ga0496122_0089959 3300048925 Bacteria 2097
139 Ga0496123_0068165 3300048926 Bacteria 2242
140 Ga0496125_0009007 3300048928 Bacteria 10341
141 Ga0496126_0010472 3300048929 Bacteria 9714
142 Ga0501032_0037296 3300049569 Bacteria 3315
143 Ga0501033_0097928 3300049570 Bacteria 2142
144 Ga0501034_0042141 3300049571 Bacteria 4621
145 Ga0501038_0132358 3300049574 Bacteria 2046
146 Ga0501038_0146202 3300049574 Bacteria 1930
147 Ga0501043_0071986 3300049579 Bacteria 2715
148 Ga0501046_0156743 3300049580 Bacteria 1714
149 Ga0501047_0085449 3300049581 Bacteria 3031
150 Ga0501070_0133596 3300049586 Bacteria 2049
151 Ga0501080_0180148 3300049742 Bacteria 1945
152 Ga0501241_007819 3300049758 Unclassified 1957
153 Ga0501035_0011233 3300049822 Bacteria 8295
154 Ga0501035_0013983 3300049822 Bacteria 7404
155 Ga0501035_0057175 3300049822 Bacteria 3478
156 Ga0501044_0031596 3300049823 Bacteria 5572
157 Ga0501044_0094744 3300049823 Bacteria 3009
158 nmdc:mga0k408_52218_c2 3300050493 Bacteria 1715
159 nmdc:mga05p37_335482_c1 3300050507 Bacteria 1784
160 Ga0500635_0093158 3300053080 Bacteria 1099
161 Ga0500644_0000077 3300053088 Bacteria 59580
162 Ga0500583_0033176 3300053092 Bacteria 2284
163 Ga0500607_014511 3300053121 Bacteria 4563
164 Ga0500607_112227 3300053121 Bacteria 1333
165 Ga0500616_0018565 3300053153 Bacteria 3930
166 Ga0500636_0130967 3300053177 Bacteria 1397
167 2738717848 2738541277 Bacteria 7458140
168 2738879487 2738541307 Bacteria 8606193
169 2739278534 2738543019 Bacteria 7459457
170 2758639512 2758568016 Bacteria 5645291
171 2784588333 2784132148 Bacteria 8627943
172 2819574634 2818991442 Bacteria 8318214
173 2821140722 2821136567 Bacteria 8080116
174 2890738084 2890737413 Bacteria 4269751
175 2898716416 2898713307 Bacteria 4110805
176 2904471224 2904467357 Bacteria 8057758
177 2929240430 2929239360 Bacteria 7745570
178 2946068316 2946064051 Bacteria 8957905
179 2958515500 2958512119 Bacteria 4528530
180 3003236275 3003233435 Bacteria 4458031
181 8008578443 8008574985 Bacteria 7815457
182 8054002686 8054002106 Bacteria 7987183
183 8055068719 8055066027 Bacteria 9479577
184 Ga0105240_10000887
185 LJNas_1000086
186 rootH2_10001391
187 rootH2_10088768
188 rootH1_10114450
189 rootH1_10153222
190 Ga0065165_1004042
191 Ga0065165_1016613
192 Ga0070658_10000913
193 Ga0070658_10175012
194 Ga0070658_10303503
195 Ga0070683_100002301
196 Ga0070682_100262741
197 Ga0070660_100001987
198 Ga0070679_100002129
199 Ga0070679_100017636
200 Ga0070679_100051669
201 Ga0070665_100033407
202 Ga0070704_100258370
203 Ga0068855_100099264
204 Ga0068855_100113904
205 Ga0068855_100185621
206 Ga0068855_100189350
207 Ga0068857_100020393
208 Ga0068856_100046250
209 Ga0068856_100368988
210 Ga0068852_100077237
211 Ga0068864_100031689
212 Ga0068851_10073234
213 Ga0068863_100053856
214 Ga0070717_10093451
215 Ga0075366_10040204
216 Ga0105240_10000113
217 Ga0105240_10006834
218 Ga0105245_10110637
219 Ga0105245_10289021
220 Ga0105237_10000123
221 Ga0105237_10001671
222 Ga0105237_10122576
223 Ga0105237_10268165
224 Ga0105238_10017094
225 Ga0105239_10000729
226 Ga0105239_10098598
227 Ga0105239_10191865
228 Ga0157370_10113825
229 Ga0157369_10012364
230 Ga0157369_10037989
231 Ga0157369_10130351
232 Ga0157374_10584584
233 Ga0157378_10165836
234 Ga0157372_10226760
235 Ga0163163_10168014
236 Ga0157376_10083443
237 Ga0182005_1000159
238 Ga0209436_102064
239 Ga0209675_1017921
240 Ga0209025_1007331
241 Ga0207426_1002496
242 Ga0207647_10021813
243 Ga0207647_10050411
244 Ga0207705_10016138
245 Ga0207705_10039762
246 Ga0207695_10000816
247 Ga0207695_10012843
248 Ga0207671_10000158
249 Ga0207671_10000236
250 Ga0207657_10000483
251 Ga0207652_10002186
252 Ga0207652_10059967
253 Ga0207694_10009763
254 Ga0207687_10077494
255 Ga0207664_10033623
256 Ga0207661_10018993
257 Ga0207667_10019323
258 Ga0207640_10123011
259 Ga0207702_10330472
260 Ga0207676_10182685
261 Ga0207698_10145425
262 Ga0268266_10001256
263 Ga0265319_1025741
264 Ga0265318_10009235
265 Ga0265336_10003249
266 Ga0265338_10236684
267 Ga0265330_10003176
268 Ga0265332_10021458
269 Ga0265332_10087902
270 Ga0265328_10036505
271 Ga0265320_10011293
272 Ga0265339_10002692
273 Ga0265316_10083679
274 Ga0307509_10017181
275 Ga0307509_10123652
276 Ga0265313_10037994
277 Ga0265313_10038856
278 Ga0307508_10000256
279 Ga0265314_10022807
280 Ga0265342_10000349
281 Ga0265342_10157233
282 Ga0316576_10197815
283 Ga0316577_10061784
284 Ga0307414_10002804
285 Ga0307415_100165510
286 Ga0316593_10021868
287 Ga0316593_10044806
288 Ga0307507_10000015
289 Ga0373934_0094682
290 Ga0373957_0043747
291 Ga0373933_0016472
292 Ga0373937_0002282
293 Ga0373937_0012054
294 Ga0395899_0004151
295 Ga0395898_0061135
296 Ga0436364_1403973
297 Ga0395901_0008521
298 Ga0400489_27980
299 Ga0439449_0052094
300 Ga0439462_0044176
301 Ga0439458_0032120
302 Ga0466966_0029801
303 Ga0466957_0004907
304 Ga0466959_0163718
305 Ga0495627_009996
306 Ga0495630_0299995
307 Ga0495604_0023189
308 Ga0495680_0104545
309 Ga0495686_0000102
310 Ga0495686_0014368
311 Ga0495686_0023226
312 Ga0495686_0069094
313 Ga0496100_0075052
314 Ga0496102_0231811
315 Ga0496105_0139903
316 Ga0496114_0156876
317 Ga0496116_0056091
318 Ga0496119_0146844
319 Ga0496121_0000395
320 Ga0496121_0235528
321 Ga0496122_0089959
322 Ga0496123_0068165
323 Ga0496125_0009007
324 Ga0496126_0010472
325 Ga0501032_0037296
326 Ga0501033_0097928
327 Ga0501034_0042141
328 Ga0501038_0132358
329 Ga0501038_0146202
330 Ga0501043_0071986
331 Ga0501046_0156743
332 Ga0501047_0085449
333 Ga0501070_0133596
334 Ga0501080_0180148
335 Ga0501241_007819
336 Ga0501035_0011233
337 Ga0501035_0013983
338 Ga0501035_0057175
339 Ga0501044_0031596
340 Ga0501044_0094744
341 nmdc:mga0k408_52218_c2
342 nmdc:mga05p37_335482_c1
343 Ga0500635_0093158
344 Ga0500644_0000077
345 Ga0500583_0033176
346 Ga0500607_014511
347 Ga0500607_112227
348 Ga0500616_0018565
349 Ga0500636_0130967
350 2738717848
351 2738879487
352 2739278534
353 2758639512
354 2784588333
355 2819574634
356 2821140722
357 2890738084
358 2898716416
359 2904471224
360 2929240430
361 2946068316
362 2958515500
363 3003236275
364 8008578443
365 8054002686
366 8055068719

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

53

355

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4xk2-assembly2.cif.gz_B crystal structure of aldo-keto reductase from polaromonas sp. js666 0.9682 1 341
4xk2-assembly2.cif.gz_B crystal structure of aldo-keto reductase from polaromonas sp. js666 0.962 1 341
4xk2-assembly1.cif.gz_C crystal structure of aldo-keto reductase from polaromonas sp. js666 0.9595 1 341
4xk2-assembly1.cif.gz_C crystal structure of aldo-keto reductase from polaromonas sp. js666 0.9535 1 341
7utf-assembly1.cif.gz_C structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol 0.9534 1 336
ID Description Score Start End Superfamily
4xk2A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9523 1 341 3.20.20.100
4xk2A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9464 1 341 3.20.20.100
af_P77735_1_322_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9296 1 324 3.20.20.100
af_P77735_1_322_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9213 1 324 3.20.20.100
af_C4J2K0_1_323_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9126 1 319 3.20.20.100
ID Description Score Start End GO Terms
AF-A0A2M8P5I0-F1-model_v4 Aldo/keto reductase 0.9939 113 212 GO:0005829
GO:0016491
AF-A0A846SX31-F1-model_v4 Aldo/keto reductase 0.9904 1 302 GO:0005829
GO:0016491
AF-A0A250IZH7-F1-model_v4 Oxidoreductase 0.9902 1 338 GO:0005829
GO:0016491
AF-A0A529HD53-F1-model_v4 Aldo/keto reductase 0.9871 95 220 GO:0005829
GO:0016491
AF-A0A381ZS10-F1-model_v4 NADP-dependent oxidoreductase domain-containing protein 0.9864 11 181

Map