F280953

General Info

Members Datasets Scaffolds Average Seq Length
183 133 177 215

Family's Representative Sequence

Representative Sequence 3300025913|Ga0207695_10081828|Ga0207695_100818283
Length 247
Sequence MDRSPGHARDNRRTVDRVIGRHAAFVRDRTMIGEAPLVPEIALHLATEVTPLWQATEADLAIQGLPPPFWAFAWPGGQALARLLLDRPELVRGRTVLDFAAGCGIAAIAAGMSGAAKVTASEIDVFAAAAIRLNAERNEVAIEVVLEDILARPAEPYEIILAGDVCYERPMAERVLGWLGRAIAAGAEVLVADPGRAYLPSAGLARIADYNVPTSLDLESRALMTTPVYRLETVEIPRGPDAAADAR

Samples

Sample ID Description Type Environment
1 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
2 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
3 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
4 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
5 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
6 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
7 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
28 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
33 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
34 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
35 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
36 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
37 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
38 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
39 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
40 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
41 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
57 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
58 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
59 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
60 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
61 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
62 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
63 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
64 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
65 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
66 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
67 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
68 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
69 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
70 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
71 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
72 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
73 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
74 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
75 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
76 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
77 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
78 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
79 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
80 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
81 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
82 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
83 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
84 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
85 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
86 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
87 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
88 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
89 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
90 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
91 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
92 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
93 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
94 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
95 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
96 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
97 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
98 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
99 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
102 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
110 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
111 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
112 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
113 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
114 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
115 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
116 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
117 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
119 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
120 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
121 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
122 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
123 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
124 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
125 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
126 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
127 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
128 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
129 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
130 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
131 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
132 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
133 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.72
Metatranscriptomes 0
Isolates 3.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.29
Nodule 0
Rhizoplane 1.09
Rhizosphere 83.61
Stem 0
Stem Tuber 0
Unclassified 6.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10018081 3300003203 Bacteria 2901
2 JGI25153J46596_10000024 3300003215 Bacteria 238285
3 Ga0055531_10032823 3300003794 Bacteria 1687
4 Ga0070709_10191145 3300005434 Bacteria 1444
5 Ga0070714_100000898 3300005435 Bacteria 21103
6 Ga0070713_100100112 3300005436 Bacteria 2508
7 Ga0070713_100580117 3300005436 Bacteria 1064
8 Ga0070713_100799989 3300005436 Bacteria 904
9 Ga0070711_100083895 3300005439 Bacteria 2278
10 Ga0070708_100069711 3300005445 Bacteria 3162
11 Ga0070678_100038338 3300005456 Bacteria 3373
12 Ga0070681_10055677 3300005458 Bacteria 3937
13 Ga0070681_10197459 3300005458 Bacteria 1930
14 Ga0070706_100007805 3300005467 Bacteria 9999
15 Ga0070706_100121401 3300005467 Bacteria 2435
16 Ga0070706_100209245 3300005467 Bacteria 1821
17 Ga0070707_100005695 3300005468 Bacteria 11629
18 Ga0070707_100008893 3300005468 Bacteria 9316
19 Ga0070707_100123088 3300005468 Bacteria 2518
20 Ga0070698_100012006 3300005471 Bacteria 9184
21 Ga0070698_100165737 3300005471 Bacteria 2153
22 Ga0070699_100105497 3300005518 Bacteria 2472
23 Ga0070699_100134112 3300005518 Bacteria 2184
24 Ga0070679_100638218 3300005530 Bacteria 1008
25 Ga0070697_100159354 3300005536 Bacteria 1906
26 Ga0068853_100131217 3300005539 Bacteria 2243
27 Ga0070696_100890416 3300005546 Bacteria 738
28 Ga0070665_100003538 3300005548 Bacteria 16609
29 Ga0068855_100601503 3300005563 Bacteria 1186
30 Ga0081540_1048298 3300005983 Bacteria 2132
31 Ga0081539_10002395 3300005985 Bacteria 26644
32 Ga0070717_10014126 3300006028 Bacteria 6138
33 Ga0070717_10137920 3300006028 Bacteria 2102
34 Ga0075431_100518852 3300006847 Bacteria 1181
35 Ga0105240_10092177 3300009093 Bacteria 3700
36 Ga0105240_10178630 3300009093 Bacteria 2507
37 Ga0105240_10419016 3300009093 Bacteria 1505
38 Ga0105238_10001148 3300009551 Bacteria 26736
39 Ga0105238_10072532 3300009551 Bacteria 3438
40 Ga0157370_10240013 3300013104 Bacteria 1677
41 Ga0163163_10312933 3300014325 Bacteria 1623
42 Ga0182008_10023777 3300014497 Bacteria 3124
43 Ga0157376_10401553 3300014969 Bacteria 1325
44 Ga0213872_10000278 3300021361 Bacteria 43638
45 Ga0209676_1000097 3300025292 Bacteria 237203
46 Ga0209050_1009132 3300025298 Bacteria 5139
47 Ga0209257_1000443 3300025304 Bacteria 78188
48 Ga0207692_10129386 3300025898 Unclassified 1424
49 Ga0207699_10107244 3300025906 Bacteria 1784
50 Ga0207684_10059556 3300025910 Bacteria 3243
51 Ga0207684_10160012 3300025910 Bacteria 1939
52 Ga0207684_10558792 3300025910 Bacteria 979
53 Ga0207707_10039419 3300025912 Bacteria 4129
54 Ga0207707_10056562 3300025912 Bacteria 3413
55 Ga0207695_10081828 3300025913 Bacteria 3266
56 Ga0207695_10128043 3300025913 Bacteria 2499
57 Ga0207695_10134689 3300025913 Bacteria 2425
58 Ga0207695_10357395 3300025913 Bacteria 1347
59 Ga0207671_10104052 3300025914 Bacteria 2153
60 Ga0207693_10119276 3300025915 Bacteria 2072
61 Ga0207663_10067124 3300025916 Bacteria 2299
62 Ga0207652_10478328 3300025921 Bacteria 1122
63 Ga0207646_10005129 3300025922 Bacteria 13890
64 Ga0207646_10065084 3300025922 Bacteria 3254
65 Ga0207646_10126393 3300025922 Bacteria 2299
66 Ga0207646_10142992 3300025922 Bacteria 2155
67 Ga0207694_10002494 3300025924 Bacteria 14966
68 Ga0207694_10016487 3300025924 Bacteria 5579
69 Ga0207664_10028160 3300025929 Bacteria 4267
70 Ga0207667_10324124 3300025949 Bacteria 1573
71 Ga0207639_10256027 3300026041 Bacteria 1529
72 Ga0268266_10369673 3300028379 Bacteria 1350
73 Ga0265337_1005221 3300028556 Bacteria 5202
74 Ga0265334_10000791 3300028573 Bacteria 15821
75 Ga0265338_10024877 3300028800 Bacteria 6100
76 Ga0265338_10092969 3300028800 Bacteria 2486
77 Ga0307513_10045203 3300031456 Bacteria 4815
78 Ga0307416_100502785 3300032002 Bacteria 1277
79 Ga0307415_100742342 3300032126 Bacteria 890
80 Ga0373926_0000554 3300035083 Bacteria 10056
81 Ga0373945_0222498 3300035116 Bacteria 790
82 Ga0373953_0206858 3300035117 Bacteria 849
83 Ga0373954_0247316 3300035118 Bacteria 878
84 Ga0373946_0011265 3300035171 Bacteria 3332
85 Ga0373955_0024530 3300035172 Bacteria 3085
86 Ga0373924_0037121 3300035410 Bacteria 1982
87 Ga0373935_0007292 3300035692 Bacteria 6610
88 Ga0373935_0047326 3300035692 Bacteria 2719
89 Ga0373927_0151382 3300035695 Bacteria 1519
90 Ga0373933_0047045 3300035724 Bacteria 2564
91 Ga0373947_0000032 3300035725 Bacteria 72445
92 Ga0373947_0057100 3300035725 Bacteria 2361
93 Ga0373947_0090185 3300035725 Bacteria 1910
94 Ga0373937_0005164 3300036401 Bacteria 11135
95 Ga0373925_0033897 3300037068 Bacteria 3762
96 Ga0373925_0755510 3300037068 Bacteria 802
97 Ga0395899_0105473 3300037312 Bacteria 2030
98 Ga0395900_0036344 3300037418 Bacteria 5078
99 Ga0436364_0156602 3300037853 Bacteria 6176
100 Ga0436364_0613574 3300037853 Bacteria 17623
101 Ga0436364_1347150 3300037853 Bacteria 1331
102 Ga0436365_1114459 3300039437 Bacteria 944
103 Ga0436360_1203079 3300039438 Bacteria 825
104 Ga0436360_1354287 3300039438 Bacteria 13202
105 Ga0436361_0778529 3300039447 Bacteria 39434
106 Ga0436361_0808795 3300039447 Bacteria 965
107 Ga0451577_0429961 3300042876 Bacteria 1199
108 Ga0466963_0427294 3300044694 Bacteria 934
109 Ga0453684_0026798 3300044712 Bacteria 8306
110 Ga0451576_0198720 3300045051 Bacteria 2094
111 Ga0495629_0274069 3300046459 Bacteria 1159
112 Ga0495638_0234611 3300046460 Bacteria 1019
113 Ga0495651_0007127 3300046462 Bacteria 8550
114 Ga0495608_0373767 3300046511 Bacteria 874
115 Ga0495628_0046764 3300046516 Bacteria 3436
116 Ga0495665_0012027 3300046531 Bacteria 4685
117 Ga0495645_0069131 3300046543 Bacteria 2549
118 Ga0495667_0076917 3300046559 Bacteria 2171
119 Ga0495680_0028754 3300047322 Bacteria 4556
120 Ga0496105_0283699 3300048908 Bacteria 1335
121 Ga0496115_0382791 3300048918 Bacteria 1144
122 Ga0496124_0432093 3300048927 Bacteria 904
123 Ga0496126_0353539 3300048929 Bacteria 1201
124 Ga0496126_0448966 3300048929 Bacteria 1038
125 Ga0501031_0022479 3300049568 Bacteria 4109
126 Ga0501033_0001942 3300049570 Bacteria 17999
127 Ga0501034_0007614 3300049571 Bacteria 11520
128 Ga0501034_0096168 3300049571 Bacteria 2958
129 Ga0501034_0169243 3300049571 Bacteria 2153
130 Ga0501036_0005943 3300049572 Bacteria 9889
131 Ga0501037_0002119 3300049573 Bacteria 14364
132 Ga0501038_0523487 3300049574 Bacteria 904
133 Ga0501039_0008955 3300049575 Bacteria 7627
134 Ga0501043_0002498 3300049579 Bacteria 15548
135 Ga0501043_0215082 3300049579 Bacteria 1489
136 Ga0501046_0002125 3300049580 Bacteria 18734
137 Ga0501047_0030433 3300049581 Bacteria 5204
138 Ga0501047_0162075 3300049581 Bacteria 2108
139 Ga0501047_0279919 3300049581 Bacteria 1513
140 Ga0501048_0007738 3300049582 Bacteria 8145
141 Ga0501068_0074125 3300049584 Bacteria 2080
142 Ga0501069_0001223 3300049585 Bacteria 12543
143 Ga0501070_0030952 3300049586 Bacteria 4482
144 Ga0501070_0139388 3300049586 Bacteria 2003
145 Ga0501070_0301195 3300049586 Bacteria 1306
146 Ga0501073_0001716 3300049589 Bacteria 16263
147 Ga0501073_0030001 3300049589 Bacteria 3884
148 Ga0501073_0260548 3300049589 Bacteria 1197
149 Ga0501076_0284793 3300049592 Bacteria 1354
150 Ga0501079_0069662 3300049741 Bacteria 2715
151 Ga0501080_0002657 3300049742 Bacteria 15636
152 Ga0501080_0028988 3300049742 Bacteria 5153
153 Ga0501083_0011473 3300049744 Bacteria 6217
154 Ga0501083_0183611 3300049744 Bacteria 1365
155 Ga0501083_0211094 3300049744 Bacteria 1265
156 Ga0501035_0096681 3300049822 Bacteria 2594
157 Ga0501044_0926803 3300049823 Bacteria 745
158 nmdc:mga08x19_331512_c1 3300050514 Bacteria 1060
159 Ga0495601_0615627 3300053077 Bacteria 696
160 Ga0500651_0015625 3300053093 Bacteria 4662
161 Ga0500650_0124752 3300053098 Bacteria 1199
162 Ga0500594_0046455 3300053118 Bacteria 1208
163 Ga0500595_000254 3300053119 Bacteria 35295
164 Ga0500642_0013554 3300053130 Bacteria 3002
165 Ga0500568_0012640 3300053139 Bacteria 3876
166 Ga0500588_0000156 3300053146 Bacteria 9079
167 Ga0500588_0008446 3300053146 Bacteria 2405
168 Ga0500588_0151754 3300053146 Bacteria 838
169 Ga0500604_0005131 3300053151 Bacteria 3459
170 Ga0500645_095500 3300053730 Bacteria 841
171 Ga0500609_008469 3300053731 Bacteria 1388
172 Ga0501084_0133847 3300054114 Bacteria 2087
173 Ga0501084_0300914 3300054114 Bacteria 1355
174 Ga0590077_013031 3300059426 Bacteria 1727
175 Ga0501082_0100566 3300060353 Bacteria 2501
176 Ga0501082_0243606 3300060353 Bacteria 1565
177 Ga0501082_0662462 3300060353 Bacteria 913

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005468 Ga0070707_100005695 Ga0070707_10000569512 184
2 3300025922 Ga0207646_10065084 Ga0207646_100650843 184
3 3300005445 Ga0070708_100069711 Ga0070708_1000697113 194
4 3300005467 Ga0070706_100007805 Ga0070706_1000078056 194
5 3300005468 Ga0070707_100008893 Ga0070707_1000088937 194
6 3300005518 Ga0070699_100134112 Ga0070699_1001341122 194
7 3300005536 Ga0070697_100159354 Ga0070697_1001593541 194
8 3300006028 Ga0070717_10014126 Ga0070717_100141268 194
9 3300025922 Ga0207646_10005129 Ga0207646_1000512910 194
10 3300046531 Ga0495665_0012027 Ga0495665_0012027_1899_2534 195
11 3300005458 Ga0070681_10197459 Ga0070681_101974592 196
12 3300025912 Ga0207707_10039419 Ga0207707_100394194 196
13 3300035083 Ga0373926_0000554 Ga0373926_0000554_9050_9643 196
14 3300035171 Ga0373946_0011265 Ga0373946_0011265_343_936 196
15 3300035692 Ga0373935_0007292 Ga0373935_0007292_1092_1685 196
16 3300035725 Ga0373947_0000032 Ga0373947_0000032_11160_11753 196
17 3300005434 Ga0070709_10191145 Ga0070709_101911452 197
18 3300005435 Ga0070714_100000898 Ga0070714_10000089823 197
19 3300005436 Ga0070713_100100112 Ga0070713_1001001122 197
20 3300005439 Ga0070711_100083895 Ga0070711_1000838952 197
21 3300006028 Ga0070717_10137920 Ga0070717_101379202 197
22 3300025898 Ga0207692_10129386 Ga0207692_101293862 197
23 3300025906 Ga0207699_10107244 Ga0207699_101072442 197
24 3300025915 Ga0207693_10119276 Ga0207693_101192763 197
25 3300025916 Ga0207663_10067124 Ga0207663_100671242 197
26 3300025929 Ga0207664_10028160 Ga0207664_100281601 197
27 3300005471 Ga0070698_100012006 Ga0070698_1000120067 198
28 3300035725 Ga0373947_0057100 Ga0373947_0057100_502_1146 198
29 3300046459 Ga0495629_0274069 Ga0495629_0274069_446_1090 198
30 3300005548 Ga0070665_100003538 Ga0070665_10000353812 199
31 3300045051 Ga0451576_0198720 Ga0451576_0198720_990_1649 201
32 3300053151 Ga0500604_0005131 Ga0500604_0005131_1665_2345 201
33 3300005436 Ga0070713_100799989 Ga0070713_1007999892 202
34 3300039438 Ga0436360_1203079 Ga0436360_1203079_73_720 202
35 3300005983 Ga0081540_1048298 Ga0081540_10482983 203
36 iso_pu_bacteria 2894772417 2894775477 203
37 3300005467 Ga0070706_100121401 Ga0070706_1001214013 206
38 3300005468 Ga0070707_100123088 Ga0070707_1001230883 206
39 3300005539 Ga0068853_100131217 Ga0068853_1001312172 206
40 3300009551 Ga0105238_10072532 Ga0105238_100725323 206
41 3300025910 Ga0207684_10059556 Ga0207684_100595562 206
42 3300025922 Ga0207646_10126393 Ga0207646_101263933 206
43 3300025924 Ga0207694_10016487 Ga0207694_100164875 206
44 3300026041 Ga0207639_10256027 Ga0207639_102560272 206
45 3300037853 Ga0436364_0613574 Ga0436364_0613574_1069_1749 206
46 3300042876 Ga0451577_0429961 Ga0451577_0429961_530_1180 206
47 3300005436 Ga0070713_100580117 Ga0070713_1005801171 207
48 3300005471 Ga0070698_100165737 Ga0070698_1001657372 207
49 3300009093 Ga0105240_10419016 Ga0105240_104190162 207
50 3300014325 Ga0163163_10312933 Ga0163163_103129332 207
51 3300025910 Ga0207684_10558792 Ga0207684_105587921 207
52 3300025914 Ga0207671_10104052 Ga0207671_101040522 207
53 3300025949 Ga0207667_10324124 Ga0207667_103241242 207
54 3300039437 Ga0436365_1114459 Ga0436365_1114459_189_848 207
55 3300053730 Ga0500645_095500 Ga0500645_095500_72_707 207
56 3300048918 Ga0496115_0382791 Ga0496115_0382791_163_810 208
57 3300005563 Ga0068855_100601503 Ga0068855_1006015032 212
58 3300028379 Ga0268266_10369673 Ga0268266_103696732 212
59 3300039438 Ga0436360_1354287 Ga0436360_1354287_5550_6191 212
60 3300044694 Ga0466963_0427294 Ga0466963_0427294_251_892 212
61 3300048927 Ga0496124_0432093 Ga0496124_0432093_177_821 212
62 3300048929 Ga0496126_0353539 Ga0496126_0353539_282_962 212
63 3300059426 Ga0590077_013031 Ga0590077_013031_366_1007 212
64 iso_pu_bacteria 2522572158 2523106679 212
65 3300025913 Ga0207695_10357395 Ga0207695_103573952 213
66 3300037853 Ga0436364_1347150 Ga0436364_1347150_564_1244 213
67 3300005458 Ga0070681_10055677 Ga0070681_100556773 214
68 3300005467 Ga0070706_100209245 Ga0070706_1002092451 214
69 3300006847 Ga0075431_100518852 Ga0075431_1005188521 214
70 3300013104 Ga0157370_10240013 Ga0157370_102400132 214
71 3300025922 Ga0207646_10142992 Ga0207646_101429922 214
72 3300028800 Ga0265338_10092969 Ga0265338_100929692 214
73 3300032002 Ga0307416_100502785 Ga0307416_1005027852 214
74 3300035118 Ga0373954_0247316 Ga0373954_0247316_134_781 214
75 3300037853 Ga0436364_0156602 Ga0436364_0156602_1176_1838 214
76 3300039447 Ga0436361_0808795 Ga0436361_0808795_282_932 214
77 3300005530 Ga0070679_100638218 Ga0070679_1006382182 215
78 3300009093 Ga0105240_10092177 Ga0105240_100921773 215
79 3300009093 Ga0105240_10178630 Ga0105240_101786302 215
80 3300009551 Ga0105238_10001148 Ga0105238_1000114812 215
81 3300025292 Ga0209676_1000097 Ga0209676_100009768 215
82 3300025913 Ga0207695_10128043 Ga0207695_101280432 215
83 3300025913 Ga0207695_10134689 Ga0207695_101346892 215
84 3300025921 Ga0207652_10478328 Ga0207652_104783282 215
85 3300025924 Ga0207694_10002494 Ga0207694_1000249415 215
86 3300037312 Ga0395899_0105473 Ga0395899_0105473_672_1325 215
87 3300037418 Ga0395900_0036344 Ga0395900_0036344_3093_3746 215
88 3300044712 Ga0453684_0026798 Ga0453684_0026798_3467_4117 215
89 3300046460 Ga0495638_0234611 Ga0495638_0234611_171_836 215
90 3300053098 Ga0500650_0124752 Ga0500650_0124752_87_752 215
91 3300053118 Ga0500594_0046455 Ga0500594_0046455_532_1197 215
92 3300053139 Ga0500568_0012640 Ga0500568_0012640_1641_2306 215
93 3300053146 Ga0500588_0000156 Ga0500588_0000156_4607_5272 215
94 3300053146 Ga0500588_0151754 Ga0500588_0151754_67_732 215
95 3300053731 Ga0500609_008469 Ga0500609_008469_44_709 215
96 3300028800 Ga0265338_10024877 Ga0265338_100248775 216
97 3300035116 Ga0373945_0222498 Ga0373945_0222498_90_740 216
98 3300035117 Ga0373953_0206858 Ga0373953_0206858_24_674 216
99 3300035172 Ga0373955_0024530 Ga0373955_0024530_2420_3070 216
100 3300035410 Ga0373924_0037121 Ga0373924_0037121_1105_1755 216
101 3300035692 Ga0373935_0047326 Ga0373935_0047326_1148_1798 216
102 3300035695 Ga0373927_0151382 Ga0373927_0151382_519_1169 216
103 3300035724 Ga0373933_0047045 Ga0373933_0047045_81_731 216
104 3300035725 Ga0373947_0090185 Ga0373947_0090185_418_1068 216
105 3300036401 Ga0373937_0005164 Ga0373937_0005164_4808_5458 216
106 3300037068 Ga0373925_0033897 Ga0373925_0033897_1595_2245 216
107 3300046462 Ga0495651_0007127 Ga0495651_0007127_1961_2611 216
108 3300046511 Ga0495608_0373767 Ga0495608_0373767_30_680 216
109 3300046516 Ga0495628_0046764 Ga0495628_0046764_831_1481 216
110 3300046543 Ga0495645_0069131 Ga0495645_0069131_279_929 216
111 3300046559 Ga0495667_0076917 Ga0495667_0076917_1426_2076 216
112 3300047322 Ga0495680_0028754 Ga0495680_0028754_2723_3373 216
113 3300048929 Ga0496126_0448966 Ga0496126_0448966_213_869 216
114 3300025912 Ga0207707_10056562 Ga0207707_100565622 217
115 3300053119 Ga0500595_000254 Ga0500595_000254_22693_23346 217
116 3300053130 Ga0500642_0013554 Ga0500642_0013554_1902_2618 217
117 iso_pu_bacteria 2883291878 2883292660 217
118 3300049571 Ga0501034_0096168 Ga0501034_0096168_157_846 218
119 3300049581 Ga0501047_0162075 Ga0501047_0162075_1194_1883 218
120 3300049586 Ga0501070_0139388 Ga0501070_0139388_642_1310 218
121 3300049589 Ga0501073_0260548 Ga0501073_0260548_26_694 218
122 3300028556 Ga0265337_1005221 Ga0265337_10052214 219
123 3300028573 Ga0265334_10000791 Ga0265334_100007913 219
124 3300053093 Ga0500651_0015625 Ga0500651_0015625_1731_2390 219
125 iso_pu_bacteria 2524023250 2524612298 219
126 3300014497 Ga0182008_10023777 Ga0182008_100237774 220
127 3300049581 Ga0501047_0279919 Ga0501047_0279919_189_851 220
128 3300049586 Ga0501070_0301195 Ga0501070_0301195_60_722 220
129 3300049589 Ga0501073_0030001 Ga0501073_0030001_924_1586 220
130 3300049742 Ga0501080_0028988 Ga0501080_0028988_37_699 220
131 3300049744 Ga0501083_0183611 Ga0501083_0183611_542_1204 220
132 3300053077 Ga0495601_0615627 Ga0495601_0615627_10_684 220
133 3300054114 Ga0501084_0133847 Ga0501084_0133847_591_1253 220
134 3300060353 Ga0501082_0243606 Ga0501082_0243606_554_1216 220
135 3300003215 JGI25153J46596_10000024 JGI25153J46596_1000002493 221
136 3300003794 Ga0055531_10032823 Ga0055531_100328232 221
137 3300005518 Ga0070699_100105497 Ga0070699_1001054972 221
138 3300005546 Ga0070696_100890416 Ga0070696_1008904161 221
139 3300021361 Ga0213872_10000278 Ga0213872_1000027837 221
140 3300025298 Ga0209050_1009132 Ga0209050_10091326 221
141 3300025304 Ga0209257_1000443 Ga0209257_100044362 221
142 3300031456 Ga0307513_10045203 Ga0307513_100452032 221
143 3300039447 Ga0436361_0778529 Ga0436361_0778529_14235_14912 221
144 3300048908 Ga0496105_0283699 Ga0496105_0283699_98_766 221
145 3300049579 Ga0501043_0215082 Ga0501043_0215082_809_1474 221
146 3300049823 Ga0501044_0926803 Ga0501044_0926803_48_713 221
147 iso_pu_bacteria 2894817345 2894821617 221
148 3300025910 Ga0207684_10160012 Ga0207684_101600122 222
149 3300049568 Ga0501031_0022479 Ga0501031_0022479_1702_2370 222
150 3300049570 Ga0501033_0001942 Ga0501033_0001942_17176_17844 222
151 3300049571 Ga0501034_0007614 Ga0501034_0007614_6864_7532 222
152 3300049572 Ga0501036_0005943 Ga0501036_0005943_4625_5293 222
153 3300049573 Ga0501037_0002119 Ga0501037_0002119_13505_14173 222
154 3300049574 Ga0501038_0523487 Ga0501038_0523487_147_815 222
155 3300049575 Ga0501039_0008955 Ga0501039_0008955_2151_2819 222
156 3300049579 Ga0501043_0002498 Ga0501043_0002498_9511_10179 222
157 3300049580 Ga0501046_0002125 Ga0501046_0002125_14628_15296 222
158 3300049581 Ga0501047_0030433 Ga0501047_0030433_3860_4528 222
159 3300049582 Ga0501048_0007738 Ga0501048_0007738_2268_2936 222
160 3300049584 Ga0501068_0074125 Ga0501068_0074125_531_1199 222
161 3300049585 Ga0501069_0001223 Ga0501069_0001223_10928_11596 222
162 3300049586 Ga0501070_0030952 Ga0501070_0030952_677_1345 222
163 3300049589 Ga0501073_0001716 Ga0501073_0001716_15553_16221 222
164 3300049592 Ga0501076_0284793 Ga0501076_0284793_482_1150 222
165 3300049741 Ga0501079_0069662 Ga0501079_0069662_1281_1949 222
166 3300049742 Ga0501080_0002657 Ga0501080_0002657_5321_5989 222
167 3300049744 Ga0501083_0211094 Ga0501083_0211094_49_717 222
168 3300049822 Ga0501035_0096681 Ga0501035_0096681_549_1217 222
169 3300060353 Ga0501082_0662462 Ga0501082_0662462_156_824 222
170 3300014969 Ga0157376_10401553 Ga0157376_104015531 223
171 iso_pu_bacteria 2883354860 2883355627 223
172 3300037068 Ga0373925_0755510 Ga0373925_0755510_73_750 224
173 3300053146 Ga0500588_0008446 Ga0500588_0008446_843_1523 226
174 3300049571 Ga0501034_0169243 Ga0501034_0169243_555_1241 227
175 3300049744 Ga0501083_0011473 Ga0501083_0011473_4483_5169 227
176 3300054114 Ga0501084_0300914 Ga0501084_0300914_438_1127 227
177 3300060353 Ga0501082_0100566 Ga0501082_0100566_1021_1707 227
178 3300025913 Ga0207695_10081828 Ga0207695_100818283 230
179 3300005456 Ga0070678_100038338 Ga0070678_1000383382 231
180 3300050514 nmdc:mga08x19_331512_c1 nmdc:mga08x19_331512_c1_198_935 233
181 3300032126 Ga0307415_100742342 Ga0307415_1007423421 238
182 3300003203 JGI25406J46586_10018081 JGI25406J46586_100180815 239
183 3300005985 Ga0081539_10002395 Ga0081539_1000239515 239

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06325

PrmA

Ribosomal protein L11 methyltransferase (PrmA)

79

165

0.86

PF05175

MTS

Methyltransferase small domain

72

163

0.85

PF10294

Methyltransf_16

Lysine methyltransferase

71

200

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
6nt2-assembly1.cif.gz_A type 1 prmt in complex with the inhibitor gsk3368715 0.7742 84 183
5lv5-assembly1.cif.gz_A crystal structure of mouse prmt6 in complex with inhibitor lh1458 0.7719 85 184
5lv4-assembly1.cif.gz_A-2 crystal structure of mouse prmt6 in complex with inhibitor lh1236 0.771 85 184
5dpl-assembly1.cif.gz_B the structure of pkmt2 from rickettsia typhi in complex with adohcy 0.7656 100 198
4y30-assembly1.cif.gz_A crystal structure of human protein arginine methyltransferase prmt6 bound to sah and epz020411 0.7625 84 195
ID Description Score Start End Superfamily
af_Q8IXQ9_82_251_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9389 75 227 3.40.50.150
af_A0A1D6EFY7_537_616_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9104 98 156 3.40.50.150
af_O01503_44_226_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9072 72 203 3.40.50.150
af_Q55DL2_114_292_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8748 80 186 3.40.50.150
af_Q5RJL2_20_200_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8587 80 195 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A436IY35-F1-model_v4 deleted 0.991 73 237
AF-A0A536NC55-F1-model_v4 Methyltransferase 0.9792 29 237 GO:0016279
GO:0032259
AF-A0A436IY35-F1-model_v4 deleted 0.9792 73 237
AF-F8JGB8-F1-model_v4 Methyltransferase 0.975 25 236 GO:0016279
GO:0032259
AF-A0A524HSF7-F1-model_v4 Methyltransferase 0.9726 29 237 GO:0016279
GO:0032259

Feature Viewer

pLDDT pTM Quality
88.87 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map