F281639

General Info

Members Datasets Scaffolds Average Seq Length
183 92 180 310

Family's Representative Sequence

Representative Sequence 3300053178|Ga0500637_0175553|Ga0500637_0175553_180_1175
Length 322
Sequence MQIKYIIFIIDPIKLQQFPSMSRKFVLFIACFVMAFAAGAQRVGSSPEYIKTLTADWKGDRFPDGRPKVPDAILERLKKISMEEAWGVLRNKGYQNQFEGDWHVINPDSVMTGRVVTAQYMPSRPDLINVVKDQGVKVEGRNPQGGTNSWPIDVLVDGDVYVATLIGDNLGNAIYARSHRGVIFYGSVRDEAGLSEIKGFNGWVKGVDPSYIQQMMLTSINTPIRVGRAVVLPGDVVLANKFGTVFIPAHLVEELVLTSEVTELRDEFGHQRLREKKYLAGQIDSKWTDEIKKDFLNWINNYPGKLPMTRKELDDYLKERNY

Samples

Sample ID Description Type Environment
1 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
2 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
3 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
6 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
22 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
23 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
24 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
25 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
26 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
28 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
29 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
30 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
31 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
32 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
33 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
34 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
35 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
36 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
37 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
38 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
39 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
40 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
41 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
42 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
59 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
60 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
61 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
62 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
63 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
64 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
65 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
66 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
67 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
68 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
69 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
70 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
71 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
72 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
73 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
74 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
75 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
76 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
77 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
78 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
79 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
80 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
81 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
82 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
83 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
84 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
85 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
86 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
87 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
88 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
89 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
90 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
91 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
92 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.36
Metatranscriptomes 0
Isolates 1.64

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.73
Nodule 0
Rhizoplane 0
Rhizosphere 92.9
Stem 0
Stem Tuber 0
Unclassified 4.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10053878 3300003320 Bacteria 12446
2 Ga0055536_1003398 3300003781 Bacteria 8570
3 Ga0065165_1000929 3300005262 Bacteria 37523
4 Ga0070683_100096623 3300005329 Bacteria 2779
5 Ga0070680_100082651 3300005336 Unclassified 2651
6 Ga0070680_100237239 3300005336 Bacteria 1541
7 Ga0070682_100007734 3300005337 Bacteria 6055
8 Ga0070660_100026410 3300005339 Bacteria 4322
9 Ga0070660_100322572 3300005339 Bacteria 1269
10 Ga0070691_10008819 3300005341 Bacteria 4615
11 Ga0070668_100186225 3300005347 Bacteria 1698
12 Ga0070675_100235746 3300005354 Bacteria 1598
13 Ga0070681_10115347 3300005458 Bacteria 2624
14 Ga0070681_10146685 3300005458 Unclassified 2288
15 Ga0070679_100000473 3300005530 Bacteria 34337
16 Ga0070679_100006332 3300005530 Bacteria 11019
17 Ga0070679_100029968 3300005530 Bacteria 5369
18 Ga0070684_100048356 3300005535 Bacteria 3690
19 Ga0068853_100009045 3300005539 Bacteria 8021
20 Ga0068855_100000556 3300005563 Bacteria 45792
21 Ga0068855_100015631 3300005563 Bacteria 9133
22 Ga0068855_100183472 3300005563 Unclassified 2365
23 Ga0068855_100648161 3300005563 Bacteria 1134
24 Ga0068854_100228696 3300005578 Bacteria 1475
25 Ga0068856_100062653 3300005614 Bacteria 3673
26 Ga0068852_100001611 3300005616 Bacteria 15376
27 Ga0068852_100035470 3300005616 Unclassified 4162
28 Ga0068852_100410432 3300005616 Bacteria 1334
29 Ga0068864_100128279 3300005618 Bacteria 2275
30 Ga0068863_100145664 3300005841 Unclassified 2265
31 Ga0068860_100000111 3300005843 Bacteria 131004
32 Ga0081540_1039164 3300005983 Bacteria 2487
33 Ga0097621_100065417 3300006237 Unclassified 2992
34 Ga0105240_10000033 3300009093 Bacteria 279600
35 Ga0105240_10010427 3300009093 Bacteria 13057
36 Ga0105240_10016556 3300009093 Bacteria 9979
37 Ga0105240_10131940 3300009093 Bacteria 2996
38 Ga0105240_10614500 3300009093 Bacteria 1195
39 Ga0105241_10000972 3300009174 Bacteria 21714
40 Ga0105241_10365401 3300009174 Bacteria 1257
41 Ga0105237_10004030 3300009545 Bacteria 17163
42 Ga0105237_10067908 3300009545 Bacteria 3559
43 Ga0105237_10629680 3300009545 Unclassified 1080
44 Ga0105237_10643816 3300009545 Bacteria 1067
45 Ga0105238_10119739 3300009551 Unclassified 2613
46 Ga0105238_10252357 3300009551 Bacteria 1743
47 Ga0105239_10001545 3300010375 Bacteria 30416
48 Ga0105239_10004782 3300010375 Bacteria 16070
49 Ga0105239_10027097 3300010375 Bacteria 6309
50 Ga0105239_10712992 3300010375 Bacteria 1147
51 Ga0157373_10034641 3300013100 Bacteria 3627
52 Ga0157371_10062585 3300013102 Bacteria 2638
53 Ga0157371_10077956 3300013102 Bacteria 2347
54 Ga0157370_10001122 3300013104 Bacteria 33453
55 Ga0157370_10051360 3300013104 Bacteria 3938
56 Ga0157370_10137929 3300013104 Bacteria 2273
57 Ga0157370_10152312 3300013104 Unclassified 2151
58 Ga0157370_10272222 3300013104 Bacteria 1565
59 Ga0157369_10051658 3300013105 Bacteria 4448
60 Ga0157369_10056629 3300013105 Bacteria 4230
61 Ga0157374_10000002 3300013296 Bacteria 1054226
62 Ga0157378_10043974 3300013297 Bacteria 3965
63 Ga0163162_10000101 3300013306 Bacteria 77114
64 Ga0163162_10015037 3300013306 Bacteria 7560
65 Ga0163162_10399352 3300013306 Bacteria 1507
66 Ga0157372_10006101 3300013307 Bacteria 12803
67 Ga0157372_10046235 3300013307 Bacteria 4832
68 Ga0157372_10114191 3300013307 Bacteria 3096
69 Ga0157376_10002338 3300014969 Bacteria 12798
70 Ga0157376_10483805 3300014969 Bacteria 1213
71 Ga0209676_1000329 3300025292 Bacteria 91571
72 Ga0207705_10027392 3300025909 Bacteria 4064
73 Ga0207654_10001683 3300025911 Bacteria 11544
74 Ga0207707_10004415 3300025912 Bacteria 12408
75 Ga0207707_10397627 3300025912 Unclassified 1183
76 Ga0207695_10000023 3300025913 Bacteria 657903
77 Ga0207695_10000031 3300025913 Bacteria 526801
78 Ga0207695_10000110 3300025913 Bacteria 250079
79 Ga0207695_10046067 3300025913 Bacteria 4624
80 Ga0207695_10053580 3300025913 Unclassified 4219
81 Ga0207695_10133393 3300025913 Bacteria 2439
82 Ga0207671_10002157 3300025914 Bacteria 21431
83 Ga0207671_10020133 3300025914 Bacteria 5086
84 Ga0207660_10027855 3300025917 Unclassified 3860
85 Ga0207657_10293965 3300025919 Bacteria 1288
86 Ga0207652_10001516 3300025921 Bacteria 20500
87 Ga0207652_10003880 3300025921 Bacteria 12232
88 Ga0207694_10151345 3300025924 Bacteria 1869
89 Ga0207667_10000926 3300025949 Bacteria 37457
90 Ga0207667_10032347 3300025949 Bacteria 5638
91 Ga0207667_10069509 3300025949 Unclassified 3665
92 Ga0207640_10147274 3300025981 Bacteria 1725
93 Ga0207703_10248706 3300026035 Bacteria 1601
94 Ga0207639_10005423 3300026041 Bacteria 8619
95 Ga0207639_10038937 3300026041 Bacteria 3540
96 Ga0207639_10061891 3300026041 Bacteria 2892
97 Ga0207639_10336388 3300026041 Bacteria 1345
98 Ga0207702_10041915 3300026078 Bacteria 3839
99 Ga0207698_10238282 3300026142 Bacteria 1656
100 Ga0268264_10000313 3300028381 Bacteria 77820
101 Ga0307515_10213117 3300028794 Bacteria 1770
102 Ga0307511_10000263 3300030521 Bacteria 54309
103 Ga0316176_1181925 3300030732 Bacteria 6869
104 Ga0316183_1154697 3300030742 Bacteria 4645
105 Ga0316181_1038708 3300030744 Bacteria 10810
106 Ga0265327_10020998 3300031251 Bacteria 3956
107 Ga0265316_10011497 3300031344 Bacteria 7977
108 Ga0307509_10024602 3300031507 Bacteria 6739
109 Ga0265342_10047039 3300031712 Bacteria 2591
110 Ga0265342_10063244 3300031712 Bacteria 2176
111 Ga0307516_10029555 3300031730 Bacteria 5540
112 Ga0307405_10038115 3300031731 Bacteria 2894
113 Ga0307414_10000116 3300032004 Bacteria 56780
114 Ga0307414_10017049 3300032004 Bacteria 4435
115 Ga0307414_10134241 3300032004 Bacteria 1927
116 Ga0307414_10165917 3300032004 Bacteria 1760
117 Ga0307510_10002736 3300033180 Bacteria 20178
118 Ga0307510_10003862 3300033180 Bacteria 17569
119 Ga0373935_0158784 3300035692 Bacteria 1540
120 Ga0451577_0001672 3300042876 Bacteria 28652
121 Ga0451577_0003609 3300042876 Bacteria 17018
122 Ga0451577_0008004 3300042876 Bacteria 10318
123 Ga0451577_0027953 3300042876 Bacteria 5102
124 Ga0451577_0028827 3300042876 Bacteria 5021
125 Ga0451577_0041108 3300042876 Bacteria 4151
126 Ga0451577_0077861 3300042876 Bacteria 2957
127 Ga0451577_0089710 3300042876 Bacteria 2743
128 Ga0451577_0331023 3300042876 Bacteria 1381
129 Ga0451577_0349232 3300042876 Bacteria 1342
130 Ga0453683_0000186 3300044673 Bacteria 86082
131 Ga0453683_0003918 3300044673 Bacteria 10783
132 Ga0453683_0005570 3300044673 Bacteria 8762
133 Ga0453683_0066033 3300044673 Bacteria 2261
134 Ga0453683_0146054 3300044673 Bacteria 1493
135 Ga0453684_0000721 3300044712 Bacteria 116843
136 Ga0453684_0001794 3300044712 Bacteria 57029
137 Ga0453684_0006836 3300044712 Bacteria 21433
138 Ga0453684_0040156 3300044712 Bacteria 6362
139 Ga0453684_0065111 3300044712 Bacteria 4650
140 Ga0453684_0069114 3300044712 Bacteria 4481
141 Ga0453684_0071631 3300044712 Bacteria 4381
142 Ga0453684_0080580 3300044712 Bacteria 4064
143 Ga0453684_0088678 3300044712 Unclassified 3829
144 Ga0453684_0097184 3300044712 Unclassified 3615
145 Ga0453684_0132071 3300044712 Bacteria 2995
146 Ga0453684_0176706 3300044712 Bacteria 2510
147 Ga0453684_0191345 3300044712 Bacteria 2393
148 Ga0453684_0325658 3300044712 Bacteria 1739
149 Ga0453684_0432037 3300044712 Bacteria 1469
150 Ga0453684_0503719 3300044712 Bacteria 1340
151 Ga0466971_0037607 3300044719 Unclassified 2170
152 Ga0466959_0034678 3300045049 Unclassified 3733
153 Ga0451576_0000193 3300045051 Bacteria 154108
154 Ga0451576_0000504 3300045051 Bacteria 85668
155 Ga0451576_0001210 3300045051 Bacteria 46059
156 Ga0451576_0002506 3300045051 Bacteria 27244
157 Ga0451576_0016796 3300045051 Bacteria 8068
158 Ga0451576_0034363 3300045051 Bacteria 5385
159 Ga0451576_0036546 3300045051 Bacteria 5205
160 Ga0451576_0074455 3300045051 Bacteria 3534
161 Ga0451576_0217930 3300045051 Bacteria 1993
162 Ga0451576_0322200 3300045051 Bacteria 1617
163 Ga0451576_0481763 3300045051 Bacteria 1303
164 Ga0466967_0246025 3300045976 Bacteria 1707
165 Ga0495638_0117369 3300046460 Bacteria 1575
166 Ga0495606_0002814 3300046507 Bacteria 19350
167 Ga0495606_0006103 3300046507 Bacteria 11250
168 Ga0495667_0240577 3300046559 Bacteria 1153
169 Ga0495611_0000084 3300046648 Bacteria 66870
170 Ga0495649_0019763 3300046694 Unclassified 3783
171 Ga0495600_0185227 3300046809 Bacteria 1341
172 Ga0495686_0000298 3300047472 Bacteria 85528
173 Ga0495686_0004407 3300047472 Bacteria 11597
174 Ga0501034_0239407 3300049571 Unclassified 1761
175 Ga0501073_0172887 3300049589 Unclassified 1495
176 nmdc:mga08y16_242584_c1 3300050511 Bacteria 1863
177 Ga0500556_0057884 3300053104 Unclassified 1420
178 Ga0500637_0175553 3300053178 Unclassified 1230
179 Ga0501082_0160520 3300060353 Unclassified 1953
180 Ga0466962_0069020 3300061719 Unclassified 1688

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009093 Ga0105240_10614500 Ga0105240_106145002 282
2 3300009551 Ga0105238_10119739 Ga0105238_101197392 282
3 3300010375 Ga0105239_10027097 Ga0105239_100270976 282
4 3300045051 Ga0451576_0034363 Ga0451576_0034363_450_1310 286
5 3300044712 Ga0453684_0097184 Ga0453684_0097184_10_876 288
6 3300046460 Ga0495638_0117369 Ga0495638_0117369_617_1513 288
7 3300005843 Ga0068860_100000111 Ga0068860_10000011145 295
8 3300013306 Ga0163162_10000101 Ga0163162_100001016 295
9 3300026035 Ga0207703_10248706 Ga0207703_102487062 295
10 3300028381 Ga0268264_10000313 Ga0268264_1000031355 295
11 3300046507 Ga0495606_0006103 Ga0495606_0006103_8494_9387 295
12 3300031730 Ga0307516_10029555 Ga0307516_100295553 297
13 3300045976 Ga0466967_0246025 Ga0466967_0246025_777_1679 300
14 3300042876 Ga0451577_0003609 Ga0451577_0003609_9906_10838 301
15 3300044712 Ga0453684_0006836 Ga0453684_0006836_5640_6572 301
16 3300045051 Ga0451576_0000193 Ga0451576_0000193_7066_7998 301
17 3300053178 Ga0500637_0175553 Ga0500637_0175553_180_1175 301
18 3300042876 Ga0451577_0001672 Ga0451577_0001672_11493_12410 305
19 3300044712 Ga0453684_0000721 Ga0453684_0000721_78432_79349 305
20 3300045051 Ga0451576_0074455 Ga0451576_0074455_961_1878 305
21 3300013297 Ga0157378_10043974 Ga0157378_100439742 306
22 iso_pu_bacteria 2522125168 2522551095 306
23 iso_pu_bacteria 2842903701 2842908416 306
24 3300005339 Ga0070660_100026410 Ga0070660_1000264103 308
25 3300005354 Ga0070675_100235746 Ga0070675_1002357461 308
26 3300009174 Ga0105241_10365401 Ga0105241_103654011 308
27 3300013306 Ga0163162_10399352 Ga0163162_103993522 308
28 3300005616 Ga0068852_100035470 Ga0068852_1000354702 309
29 3300005618 Ga0068864_100128279 Ga0068864_1001282792 309
30 3300005841 Ga0068863_100145664 Ga0068863_1001456642 309
31 3300009093 Ga0105240_10000033 Ga0105240_1000003353 309
32 3300009545 Ga0105237_10067908 Ga0105237_100679083 309
33 3300010375 Ga0105239_10004782 Ga0105239_100047828 309
34 3300025913 Ga0207695_10000023 Ga0207695_10000023358 309
35 3300025913 Ga0207695_10000031 Ga0207695_10000031211 309
36 3300025913 Ga0207695_10053580 Ga0207695_100535804 309
37 3300026041 Ga0207639_10005423 Ga0207639_100054234 309
38 3300031251 Ga0265327_10020998 Ga0265327_100209983 309
39 3300031507 Ga0307509_10024602 Ga0307509_100246021 309
40 3300033180 Ga0307510_10002736 Ga0307510_100027369 309
41 3300042876 Ga0451577_0041108 Ga0451577_0041108_2468_3397 309
42 3300044673 Ga0453683_0066033 Ga0453683_0066033_417_1346 309
43 3300044712 Ga0453684_0001794 Ga0453684_0001794_45918_46847 309
44 3300045051 Ga0451576_0481763 Ga0451576_0481763_105_1034 309
45 3300046507 Ga0495606_0002814 Ga0495606_0002814_8199_9134 309
46 3300046559 Ga0495667_0240577 Ga0495667_0240577_61_990 309
47 3300046648 Ga0495611_0000084 Ga0495611_0000084_17601_18533 309
48 3300046809 Ga0495600_0185227 Ga0495600_0185227_92_1021 309
49 3300003320 rootH2_10053878 rootH2_100538784 310
50 3300003781 Ga0055536_1003398 Ga0055536_10033984 310
51 3300005262 Ga0065165_1000929 Ga0065165_10009297 310
52 3300005329 Ga0070683_100096623 Ga0070683_1000966233 310
53 3300005336 Ga0070680_100082651 Ga0070680_1000826514 310
54 3300005336 Ga0070680_100237239 Ga0070680_1002372391 310
55 3300005337 Ga0070682_100007734 Ga0070682_1000077343 310
56 3300005339 Ga0070660_100322572 Ga0070660_1003225721 310
57 3300005341 Ga0070691_10008819 Ga0070691_100088194 310
58 3300005347 Ga0070668_100186225 Ga0070668_1001862252 310
59 3300005458 Ga0070681_10115347 Ga0070681_101153474 310
60 3300005458 Ga0070681_10146685 Ga0070681_101466853 310
61 3300005530 Ga0070679_100000473 Ga0070679_1000004738 310
62 3300005530 Ga0070679_100006332 Ga0070679_1000063323 310
63 3300005530 Ga0070679_100029968 Ga0070679_1000299683 310
64 3300005535 Ga0070684_100048356 Ga0070684_1000483563 310
65 3300005539 Ga0068853_100009045 Ga0068853_1000090456 310
66 3300005563 Ga0068855_100000556 Ga0068855_10000055622 310
67 3300005563 Ga0068855_100015631 Ga0068855_1000156316 310
68 3300005563 Ga0068855_100183472 Ga0068855_1001834722 310
69 3300005563 Ga0068855_100648161 Ga0068855_1006481612 310
70 3300005578 Ga0068854_100228696 Ga0068854_1002286962 310
71 3300005614 Ga0068856_100062653 Ga0068856_1000626533 310
72 3300005616 Ga0068852_100001611 Ga0068852_1000016118 310
73 3300005616 Ga0068852_100410432 Ga0068852_1004104322 310
74 3300005983 Ga0081540_1039164 Ga0081540_10391642 310
75 3300006237 Ga0097621_100065417 Ga0097621_1000654173 310
76 3300009093 Ga0105240_10010427 Ga0105240_1001042712 310
77 3300009093 Ga0105240_10016556 Ga0105240_100165563 310
78 3300009093 Ga0105240_10131940 Ga0105240_101319402 310
79 3300009174 Ga0105241_10000972 Ga0105241_1000097210 310
80 3300009545 Ga0105237_10004030 Ga0105237_100040303 310
81 3300009545 Ga0105237_10629680 Ga0105237_106296801 310
82 3300009545 Ga0105237_10643816 Ga0105237_106438161 310
83 3300009551 Ga0105238_10252357 Ga0105238_102523572 310
84 3300010375 Ga0105239_10001545 Ga0105239_100015454 310
85 3300010375 Ga0105239_10712992 Ga0105239_107129922 310
86 3300013100 Ga0157373_10034641 Ga0157373_100346411 310
87 3300013102 Ga0157371_10062585 Ga0157371_100625853 310
88 3300013102 Ga0157371_10077956 Ga0157371_100779564 310
89 3300013104 Ga0157370_10001122 Ga0157370_1000112231 310
90 3300013104 Ga0157370_10051360 Ga0157370_100513603 310
91 3300013104 Ga0157370_10137929 Ga0157370_101379292 310
92 3300013104 Ga0157370_10152312 Ga0157370_101523122 310
93 3300013104 Ga0157370_10272222 Ga0157370_102722221 310
94 3300013105 Ga0157369_10051658 Ga0157369_100516581 310
95 3300013105 Ga0157369_10056629 Ga0157369_100566292 310
96 3300013296 Ga0157374_10000002 Ga0157374_1000000239 310
97 3300013306 Ga0163162_10015037 Ga0163162_100150372 310
98 3300013307 Ga0157372_10006101 Ga0157372_100061013 310
99 3300013307 Ga0157372_10046235 Ga0157372_100462355 310
100 3300013307 Ga0157372_10114191 Ga0157372_101141914 310
101 3300014969 Ga0157376_10002338 Ga0157376_100023386 310
102 3300014969 Ga0157376_10483805 Ga0157376_104838052 310
103 3300025292 Ga0209676_1000329 Ga0209676_10003294 310
104 3300025909 Ga0207705_10027392 Ga0207705_100273921 310
105 3300025911 Ga0207654_10001683 Ga0207654_100016837 310
106 3300025912 Ga0207707_10004415 Ga0207707_100044154 310
107 3300025912 Ga0207707_10397627 Ga0207707_103976271 310
108 3300025913 Ga0207695_10000110 Ga0207695_100001109 310
109 3300025913 Ga0207695_10046067 Ga0207695_100460672 310
110 3300025913 Ga0207695_10133393 Ga0207695_101333932 310
111 3300025914 Ga0207671_10002157 Ga0207671_1000215711 310
112 3300025914 Ga0207671_10020133 Ga0207671_100201333 310
113 3300025917 Ga0207660_10027855 Ga0207660_100278552 310
114 3300025919 Ga0207657_10293965 Ga0207657_102939651 310
115 3300025921 Ga0207652_10001516 Ga0207652_1000151614 310
116 3300025921 Ga0207652_10003880 Ga0207652_100038803 310
117 3300025924 Ga0207694_10151345 Ga0207694_101513452 310
118 3300025949 Ga0207667_10000926 Ga0207667_100009266 310
119 3300025949 Ga0207667_10032347 Ga0207667_100323472 310
120 3300025949 Ga0207667_10069509 Ga0207667_100695093 310
121 3300025981 Ga0207640_10147274 Ga0207640_101472742 310
122 3300026041 Ga0207639_10038937 Ga0207639_100389371 310
123 3300026041 Ga0207639_10061891 Ga0207639_100618912 310
124 3300026041 Ga0207639_10336388 Ga0207639_103363881 310
125 3300026078 Ga0207702_10041915 Ga0207702_100419152 310
126 3300026142 Ga0207698_10238282 Ga0207698_102382822 310
127 3300028794 Ga0307515_10213117 Ga0307515_102131172 310
128 3300030521 Ga0307511_10000263 Ga0307511_1000026311 310
129 3300030732 Ga0316176_1181925 Ga0316176_11819255 310
130 3300030742 Ga0316183_1154697 Ga0316183_11546973 310
131 3300030744 Ga0316181_1038708 Ga0316181_10387087 310
132 3300031344 Ga0265316_10011497 Ga0265316_100114974 310
133 3300031712 Ga0265342_10047039 Ga0265342_100470393 310
134 3300031712 Ga0265342_10063244 Ga0265342_100632442 310
135 3300031731 Ga0307405_10038115 Ga0307405_100381152 310
136 3300032004 Ga0307414_10000116 Ga0307414_1000011620 310
137 3300032004 Ga0307414_10017049 Ga0307414_100170492 310
138 3300032004 Ga0307414_10134241 Ga0307414_101342411 310
139 3300032004 Ga0307414_10165917 Ga0307414_101659172 310
140 3300033180 Ga0307510_10003862 Ga0307510_100038626 310
141 3300035692 Ga0373935_0158784 Ga0373935_0158784_349_1281 310
142 3300042876 Ga0451577_0008004 Ga0451577_0008004_1988_2920 310
143 3300042876 Ga0451577_0027953 Ga0451577_0027953_1649_2581 310
144 3300042876 Ga0451577_0028827 Ga0451577_0028827_638_1570 310
145 3300042876 Ga0451577_0077861 Ga0451577_0077861_184_1116 310
146 3300042876 Ga0451577_0089710 Ga0451577_0089710_245_1177 310
147 3300042876 Ga0451577_0331023 Ga0451577_0331023_364_1296 310
148 3300042876 Ga0451577_0349232 Ga0451577_0349232_140_1072 310
149 3300044673 Ga0453683_0000186 Ga0453683_0000186_19735_20667 310
150 3300044673 Ga0453683_0003918 Ga0453683_0003918_627_1577 310
151 3300044673 Ga0453683_0005570 Ga0453683_0005570_2783_3724 310
152 3300044673 Ga0453683_0146054 Ga0453683_0146054_464_1396 310
153 3300044712 Ga0453684_0040156 Ga0453684_0040156_3134_4066 310
154 3300044712 Ga0453684_0065111 Ga0453684_0065111_703_1635 310
155 3300044712 Ga0453684_0069114 Ga0453684_0069114_1823_2758 310
156 3300044712 Ga0453684_0071631 Ga0453684_0071631_2448_3380 310
157 3300044712 Ga0453684_0080580 Ga0453684_0080580_1353_2285 310
158 3300044712 Ga0453684_0088678 Ga0453684_0088678_694_1626 310
159 3300044712 Ga0453684_0132071 Ga0453684_0132071_178_1110 310
160 3300044712 Ga0453684_0176706 Ga0453684_0176706_1533_2474 310
161 3300044712 Ga0453684_0191345 Ga0453684_0191345_1031_1963 310
162 3300044712 Ga0453684_0325658 Ga0453684_0325658_37_969 310
163 3300044712 Ga0453684_0432037 Ga0453684_0432037_445_1377 310
164 3300044712 Ga0453684_0503719 Ga0453684_0503719_14_964 310
165 3300044719 Ga0466971_0037607 Ga0466971_0037607_500_1432 310
166 3300045049 Ga0466959_0034678 Ga0466959_0034678_1883_2815 310
167 3300045051 Ga0451576_0000504 Ga0451576_0000504_27461_28393 310
168 3300045051 Ga0451576_0001210 Ga0451576_0001210_18588_19520 310
169 3300045051 Ga0451576_0002506 Ga0451576_0002506_8211_9152 310
170 3300045051 Ga0451576_0016796 Ga0451576_0016796_5311_6243 310
171 3300045051 Ga0451576_0036546 Ga0451576_0036546_1660_2592 310
172 3300045051 Ga0451576_0217930 Ga0451576_0217930_443_1378 310
173 3300045051 Ga0451576_0322200 Ga0451576_0322200_242_1192 310
174 3300046694 Ga0495649_0019763 Ga0495649_0019763_1123_2055 310
175 3300047472 Ga0495686_0000298 Ga0495686_0000298_12462_13394 310
176 3300047472 Ga0495686_0004407 Ga0495686_0004407_5924_6856 310
177 3300049571 Ga0501034_0239407 Ga0501034_0239407_448_1380 310
178 3300049589 Ga0501073_0172887 Ga0501073_0172887_394_1326 310
179 3300050511 nmdc:mga08y16_242584_c1 nmdc:mga08y16_242584_c1_465_1397 310
180 3300053104 Ga0500556_0057884 Ga0500556_0057884_332_1264 310
181 3300060353 Ga0501082_0160520 Ga0501082_0160520_334_1266 310
182 3300061719 Ga0466962_0069020 Ga0466962_0069020_210_1142 310
183 iso_pu_bacteria 2919692658 2919697168 310

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03737

RraA-like

Aldolase/RraA

67

246

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
5x15-assembly1.cif.gz_A-2 crystal structure of streptomyces coelicolor rraas2, an unusual member of the rnase es inhibitor rraa protein family 0.8525 48 260
5x15-assembly1.cif.gz_A-2 crystal structure of streptomyces coelicolor rraas2, an unusual member of the rnase es inhibitor rraa protein family 0.8445 48 260
5x15-assembly1.cif.gz_C-2 crystal structure of streptomyces coelicolor rraas2, an unusual member of the rnase es inhibitor rraa protein family 0.8288 46 258
5x15-assembly1.cif.gz_C-2 crystal structure of streptomyces coelicolor rraas2, an unusual member of the rnase es inhibitor rraa protein family 0.8055 46 258
3k4i-assembly1.cif.gz_B crystal structure of uncharacterized protein pspto_3204 from pseudomonas syringae pv. tomato str. dc3000 0.7989 47 273
ID Description Score Start End Superfamily
5ir2A00 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Ribonuclease E inhibitor RraA/RraA-like 0.794 28 255 3.50.30.40
3k4iB01 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Ribonuclease E inhibitor RraA/RraA-like 0.7898 49 236 3.50.30.40
3k4iB01 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Ribonuclease E inhibitor RraA/RraA-like 0.7852 49 236 3.50.30.40
3nojA01 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Ribonuclease E inhibitor RraA/RraA-like 0.783 67 235 3.50.30.40
af_Q58060_12_207_3.50.30.40 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Ribonuclease E inhibitor RraA/RraA-like 0.7605 55 264 3.50.30.40
ID Description Score Start End GO Terms
AF-A0A2E8HM60-F1-model_v4 Dimethylmenaquinone methyltransferase 0.9555 25 186 GO:0008168
GO:0032259
GO:0046872
AF-A0A2N3DYS9-F1-model_v4 Dimethylmenaquinone methyltransferase 0.9335 25 310 GO:0008168
GO:0032259
GO:0046872
AF-A0A369I9P1-F1-model_v4 RraA family protein 0.9328 20 308
AF-A0A350YLK7-F1-model_v4 Dimethylmenaquinone methyltransferase 0.9321 17 282 GO:0008168
GO:0032259
GO:0046872
AF-A0A2N3DYS9-F1-model_v4 Dimethylmenaquinone methyltransferase 0.9304 25 310 GO:0008168
GO:0032259
GO:0046872

Feature Viewer

pLDDT pTM Quality
88.21 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map