F282791

General Info

Members Datasets Scaffolds Average Seq Length
184 152 368 270

Family's Representative Sequence

Representative Sequence 3300031250|Ga0265331_10048988|Ga0265331_100489881
Length 318
Sequence VPDKPNNVFNVGHSVPNLRDIIRQHSLRLETALSLDPGSARIEVQCLLQFVLQQNRAYLLSHPEDVLDAEQQARYAALFERRLNGEPIAYLLGEREFFGLNFKVTQATLIPRQDTELLVELALQRFPSPQPSTAQGGGSLYRVLDLGTGSGAVALSIAHARPDAVVTAADISNQALAVAGENAQRLNIGNVRLLCSDWFAELHHEHYDLIVANPPYIACDDAHLMQGDLRFEPRAALASGVDGLDDIRRIAAQAAAHLNDHGWLLLEHGHDQAARVRDLLRQSGFVDVFSARDLAGIERVSGGQVFSHTVCQHPPFPA

Samples

Sample ID Description Type Environment
1 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
10 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
11 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
12 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
13 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
14 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
15 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
16 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
17 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
18 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
19 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
20 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
21 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
22 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
23 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
24 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
25 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
26 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
27 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
28 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
29 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
30 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
31 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
32 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
33 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
34 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
47 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
48 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
49 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
50 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
51 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
52 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
53 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
54 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
55 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
56 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
57 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
58 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
59 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
60 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
61 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
62 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
63 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
64 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
65 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
66 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
67 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
68 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
69 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
70 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
71 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
72 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
73 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
74 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
75 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
76 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
77 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
78 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
79 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
80 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
81 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
82 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
83 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
84 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
85 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
86 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
87 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
88 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
89 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
90 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
91 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
92 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
93 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
94 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
95 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
96 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
97 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
98 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
99 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
100 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
101 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
102 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
103 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
104 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
105 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
106 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
107 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
108 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
109 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
116 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
117 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
118 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
119 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
120 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
121 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
122 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
123 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
124 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
125 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
126 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
127 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
128 2643221569 Achromobacter sp. Root565 Isolate Unclassified
129 2643221594 Achromobacter sp. Root170 Isolate Unclassified
130 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
131 2643221621 Achromobacter sp. Root83 Isolate Unclassified
132 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
133 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
134 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
135 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
136 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
137 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
138 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
139 2855730933 Achromobacter sp. HZ28 Isolate Nodule
140 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
141 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
142 2858950400 Achromobacter sp. K91 Isolate Unclassified
143 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
144 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
145 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
146 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
147 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
148 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
149 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
150 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
151 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
152 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 83.15
Metatranscriptomes 0
Isolates 16.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.15
Nodule 2.72
Rhizoplane 4.89
Rhizosphere 67.39
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265331_10048988 3300031250 Bacteria 2030
2 Ga0070683_100033332 3300005329 Bacteria 4696
3 Ga0070670_100080078 3300005331 Bacteria 2807
4 Ga0070677_10065831 3300005333 Bacteria 1509
5 Ga0070666_10175286 3300005335 Bacteria 1503
6 Ga0070671_100044036 3300005355 Bacteria 3708
7 Ga0070674_100313711 3300005356 Bacteria 1255
8 Ga0070673_100177741 3300005364 Bacteria 1820
9 Ga0070695_100344102 3300005545 Bacteria 1115
10 Ga0070664_100100202 3300005564 Bacteria 2518
11 Ga0068856_100660294 3300005614 Bacteria 1066
12 Ga0068852_100261239 3300005616 Bacteria 1663
13 Ga0068864_100029319 3300005618 Bacteria 4659
14 Ga0070717_10496333 3300006028 Bacteria 1103
15 Ga0075365_10017891 3300006038 Bacteria 4348
16 Ga0075368_10001429 3300006042 Bacteria 7643
17 Ga0075363_100002663 3300006048 Bacteria 7373
18 Ga0075364_10414517 3300006051 Bacteria 919
19 Ga0070712_100136944 3300006175 Bacteria 1863
20 Ga0075362_10031032 3300006177 Bacteria 2311
21 Ga0075367_10033667 3300006178 Bacteria 2955
22 Ga0068871_100025877 3300006358 Bacteria 4572
23 Ga0105248_10079133 3300009177 Bacteria 3694
24 Ga0157374_10074375 3300013296 Bacteria 3208
25 Ga0157375_10049456 3300013308 Bacteria 4119
26 Ga0182008_10002914 3300014497 Bacteria 10583
27 Ga0182006_1000007 3300015261 Bacteria 452190
28 Ga0182007_10000068 3300015262 Bacteria 82301
29 Ga0182005_1000010 3300015265 Bacteria 434103
30 Ga0163161_10003757 3300017792 Bacteria 10632
31 Ga0163161_10018068 3300017792 Bacteria 4943
32 Ga0209026_1007317 3300025250 Bacteria 2512
33 Ga0209676_1003574 3300025292 Bacteria 9388
34 Ga0209050_1007574 3300025298 Bacteria 6044
35 Ga0207680_10147665 3300025903 Bacteria 1565
36 Ga0207693_10144700 3300025915 Bacteria 1869
37 Ga0207649_10086417 3300025920 Bacteria 2044
38 Ga0207659_10700504 3300025926 Bacteria 867
39 Ga0207691_10005664 3300025940 Bacteria 12076
40 Ga0207679_10075932 3300025945 Bacteria 2551
41 Ga0207651_10043405 3300025960 Bacteria 3001
42 Ga0207658_10402084 3300025986 Bacteria 1204
43 Ga0207677_10017130 3300026023 Bacteria 4312
44 Ga0207648_10104505 3300026089 Bacteria 2484
45 Ga0207683_10001793 3300026121 Bacteria 18998
46 Ga0207698_10291265 3300026142 Bacteria 1515
47 Ga0209371_1005887 3300027312 Bacteria 4716
48 Ga0209371_1006027 3300027312 Bacteria 4623
49 Ga0209813_10006431 3300027866 Bacteria 2902
50 Ga0268256_1006021 3300030500 Bacteria 4614
51 Ga0265330_10002315 3300031235 Bacteria 10458
52 Ga0265331_10008369 3300031250 Bacteria 5889
53 Ga0265331_10013402 3300031250 Bacteria 4410
54 Ga0265327_10000065 3300031251 Bacteria 225004
55 Ga0265316_10234097 3300031344 Bacteria 1352
56 Ga0316575_10000458 3300031665 Bacteria 11696
57 Ga0451577_0000002 3300042876 Bacteria 1731375
58 Ga0451577_0100542 3300042876 Bacteria 2583
59 Ga0466972_0000190 3300044658 Bacteria 47256
60 Ga0453683_0000013 3300044673 Bacteria 371932
61 Ga0466964_0057171 3300044706 Bacteria 1614
62 Ga0453684_0000002 3300044712 Bacteria 1731375
63 Ga0451576_0000006 3300045051 Bacteria 949698
64 Ga0451576_0000037 3300045051 Bacteria 372173
65 Ga0451576_0044799 3300045051 Bacteria 4661
66 Ga0495627_008646 3300046453 Bacteria 3799
67 Ga0495603_0074646 3300046455 Bacteria 1991
68 Ga0495591_028741 3300046458 Bacteria 1697
69 Ga0495584_0005725 3300046491 Bacteria 6559
70 Ga0495585_0040695 3300046492 Bacteria 2608
71 Ga0495607_0000009 3300046501 Bacteria 216674
72 Ga0495607_0046854 3300046501 Bacteria 2535
73 Ga0495583_0016743 3300046506 Bacteria 3925
74 Ga0495606_0027673 3300046507 Bacteria 4014
75 Ga0495616_0009172 3300046513 Bacteria 5804
76 Ga0495631_0078976 3300046518 Bacteria 1420
77 Ga0495637_0039513 3300046520 Bacteria 2036
78 Ga0495644_0003878 3300046523 Bacteria 5886
79 Ga0495644_0038529 3300046523 Bacteria 1802
80 Ga0495644_0045630 3300046523 Bacteria 1648
81 Ga0495648_0020717 3300046524 Bacteria 4576
82 Ga0495654_0015266 3300046530 Bacteria 4081
83 Ga0495587_0063442 3300046536 Bacteria 2161
84 Ga0495597_0006233 3300046542 Bacteria 6186
85 Ga0495622_0070809 3300046557 Bacteria 1609
86 Ga0495633_0000646 3300046558 Bacteria 32408
87 Ga0495633_0021552 3300046558 Bacteria 3221
88 Ga0495611_0034510 3300046648 Bacteria 2236
89 Ga0495625_0064273 3300046660 Bacteria 2589
90 Ga0495625_0339965 3300046660 Bacteria 951
91 Ga0495661_0043564 3300046665 Bacteria 2757
92 Ga0495661_0043806 3300046665 Bacteria 2748
93 Ga0495588_0012348 3300046674 Bacteria 4035
94 Ga0495588_0084213 3300046674 Bacteria 1661
95 Ga0495623_0006154 3300046679 Bacteria 7800
96 Ga0495669_0032584 3300046684 Bacteria 2291
97 Ga0495670_0007507 3300046691 Bacteria 5359
98 Ga0495670_0012398 3300046691 Bacteria 4191
99 Ga0495589_0015718 3300046794 Bacteria 3890
100 Ga0495660_0025120 3300046810 Bacteria 3385
101 Ga0495660_0070505 3300046810 Bacteria 1855
102 Ga0495672_0070316 3300047320 Bacteria 1983
103 Ga0495672_0090727 3300047320 Bacteria 1678
104 Ga0495680_0035118 3300047322 Bacteria 4041
105 Ga0495680_0078781 3300047322 Bacteria 2493
106 Ga0495683_0010279 3300047323 Bacteria 4952
107 Ga0495677_0006397 3300047445 Bacteria 4451
108 Ga0495677_0116130 3300047445 Bacteria 1019
109 Ga0495685_023426 3300047447 Bacteria 2126
110 Ga0495681_0007372 3300047470 Bacteria 7036
111 Ga0495681_0139462 3300047470 Bacteria 1025
112 Ga0495593_0004214 3300047673 Bacteria 8547
113 Ga0495614_0052680 3300048089 Bacteria 1744
114 Ga0496100_0021446 3300048903 Bacteria 3890
115 Ga0496100_0512469 3300048903 Bacteria 925
116 Ga0496101_0220654 3300048904 Bacteria 1471
117 Ga0496102_0229980 3300048905 Bacteria 1748
118 Ga0496103_0004787 3300048906 Bacteria 8181
119 Ga0496108_0295603 3300048911 Bacteria 1410
120 Ga0496111_0008274 3300048914 Bacteria 6878
121 Ga0496117_0000005 3300048920 Bacteria 777468
122 Ga0496118_0000022 3300048921 Bacteria 438602
123 Ga0496118_0002552 3300048921 Bacteria 24370
124 Ga0496121_0017366 3300048924 Bacteria 7356
125 Ga0496121_0036660 3300048924 Bacteria 4367
126 Ga0496121_0171974 3300048924 Bacteria 1572
127 Ga0496122_0013911 3300048925 Bacteria 7827
128 Ga0496123_0004701 3300048926 Bacteria 14136
129 Ga0496124_0038001 3300048927 Bacteria 4182
130 Ga0496124_0121649 3300048927 Bacteria 2085
131 Ga0496124_0152968 3300048927 Bacteria 1807
132 Ga0496124_0386022 3300048927 Bacteria 977
133 Ga0496126_0057456 3300048929 Bacteria 3512
134 Ga0496126_0206779 3300048929 Bacteria 1654
135 Ga0496126_0285638 3300048929 Bacteria 1366
136 Ga0495678_057807 3300049459 Bacteria 1468
137 Ga0495682_0006095 3300049460 Bacteria 4916
138 Ga0495682_0033559 3300049460 Bacteria 1894
139 Ga0501034_0434353 3300049571 Bacteria 1232
140 Ga0501037_0099008 3300049573 Bacteria 2106
141 Ga0501038_0231338 3300049574 Bacteria 1471
142 Ga0501043_0269339 3300049579 Bacteria 1308
143 Ga0501047_0001649 3300049581 Bacteria 21747
144 Ga0501035_0003685 3300049822 Bacteria 14600
145 Ga0501035_0057391 3300049822 Bacteria 3471
146 Ga0501044_0001247 3300049823 Bacteria 30194
147 Ga0501044_0068102 3300049823 Bacteria 3626
148 nmdc:mga03n38_7238_c1 3300050490 Bacteria 3916
149 nmdc:mga0yw44_85830_c1 3300050492 Bacteria 1981
150 nmdc:mga0k408_40047_c1 3300050493 Bacteria 2695
151 nmdc:mga06z11_75108_c1 3300050494 Bacteria 1799
152 nmdc:mga04h51_8022_c1 3300050495 Bacteria 2812
153 Ga0500618_003526 3300053125 Bacteria 5329
154 2511249579 2511231003 Bacteria 5606035
155 2513962698 2513237151 Bacteria 6309801
156 2550695356 2548876994 Bacteria 4904866
157 2553005020 2551306416 Bacteria 6152985
158 2599907735 2599185292 Bacteria 6290804
159 2601671348 2600255292 Bacteria 6300551
160 2643859147 2643221569 Bacteria 6064337
161 2643979840 2643221594 Bacteria 5811388
162 2644027040 2643221603 Bacteria 6147767
163 2644123014 2643221621 Bacteria 6212786
164 2723879566 2721755763 Bacteria 4464185
165 2765571386 2765235838 Bacteria 5445269
166 2808982446 2808606386 Bacteria 4471946
167 2809033734 2808606395 Bacteria 6020352
168 2809129727 2808606415 Bacteria 4576710
169 2809149218 2808606419 Bacteria 4576925
170 2852619359 2852618963 Bacteria 4577824
171 2855735251 2855730933 Bacteria 7047938
172 2857542428 2857537821 Bacteria 5248181
173 2857578075 2857576091 Bacteria 5465855
174 2858954521 2858950400 Bacteria 6783797
175 2881417150 2881412998 Bacteria 6492157
176 2884812074 2884811622 Bacteria 5552861
177 2884838544 2884836552 Bacteria 5219991
178 2884854835 2884852848 Bacteria 5221161
179 2896156496 2896154374 Bacteria 5221518
180 2923513971 2923510766 Bacteria 5926163
181 2928134755 2928130867 Bacteria 5467269
182 2932415489 2932410948 Bacteria 6312192
183 2932421350 2932416698 Bacteria 6315112
184 8055269526 8055266321 Bacteria 7999742
185 Ga0265331_10048988
186 Ga0070683_100033332
187 Ga0070670_100080078
188 Ga0070677_10065831
189 Ga0070666_10175286
190 Ga0070671_100044036
191 Ga0070674_100313711
192 Ga0070673_100177741
193 Ga0070695_100344102
194 Ga0070664_100100202
195 Ga0068856_100660294
196 Ga0068852_100261239
197 Ga0068864_100029319
198 Ga0070717_10496333
199 Ga0075365_10017891
200 Ga0075368_10001429
201 Ga0075363_100002663
202 Ga0075364_10414517
203 Ga0070712_100136944
204 Ga0075362_10031032
205 Ga0075367_10033667
206 Ga0068871_100025877
207 Ga0105248_10079133
208 Ga0157374_10074375
209 Ga0157375_10049456
210 Ga0182008_10002914
211 Ga0182006_1000007
212 Ga0182007_10000068
213 Ga0182005_1000010
214 Ga0163161_10003757
215 Ga0163161_10018068
216 Ga0209026_1007317
217 Ga0209676_1003574
218 Ga0209050_1007574
219 Ga0207680_10147665
220 Ga0207693_10144700
221 Ga0207649_10086417
222 Ga0207659_10700504
223 Ga0207691_10005664
224 Ga0207679_10075932
225 Ga0207651_10043405
226 Ga0207658_10402084
227 Ga0207677_10017130
228 Ga0207648_10104505
229 Ga0207683_10001793
230 Ga0207698_10291265
231 Ga0209371_1005887
232 Ga0209371_1006027
233 Ga0209813_10006431
234 Ga0268256_1006021
235 Ga0265330_10002315
236 Ga0265331_10008369
237 Ga0265331_10013402
238 Ga0265327_10000065
239 Ga0265316_10234097
240 Ga0316575_10000458
241 Ga0451577_0000002
242 Ga0451577_0100542
243 Ga0466972_0000190
244 Ga0453683_0000013
245 Ga0466964_0057171
246 Ga0453684_0000002
247 Ga0451576_0000006
248 Ga0451576_0000037
249 Ga0451576_0044799
250 Ga0495627_008646
251 Ga0495603_0074646
252 Ga0495591_028741
253 Ga0495584_0005725
254 Ga0495585_0040695
255 Ga0495607_0000009
256 Ga0495607_0046854
257 Ga0495583_0016743
258 Ga0495606_0027673
259 Ga0495616_0009172
260 Ga0495631_0078976
261 Ga0495637_0039513
262 Ga0495644_0003878
263 Ga0495644_0038529
264 Ga0495644_0045630
265 Ga0495648_0020717
266 Ga0495654_0015266
267 Ga0495587_0063442
268 Ga0495597_0006233
269 Ga0495622_0070809
270 Ga0495633_0000646
271 Ga0495633_0021552
272 Ga0495611_0034510
273 Ga0495625_0064273
274 Ga0495625_0339965
275 Ga0495661_0043564
276 Ga0495661_0043806
277 Ga0495588_0012348
278 Ga0495588_0084213
279 Ga0495623_0006154
280 Ga0495669_0032584
281 Ga0495670_0007507
282 Ga0495670_0012398
283 Ga0495589_0015718
284 Ga0495660_0025120
285 Ga0495660_0070505
286 Ga0495672_0070316
287 Ga0495672_0090727
288 Ga0495680_0035118
289 Ga0495680_0078781
290 Ga0495683_0010279
291 Ga0495677_0006397
292 Ga0495677_0116130
293 Ga0495685_023426
294 Ga0495681_0007372
295 Ga0495681_0139462
296 Ga0495593_0004214
297 Ga0495614_0052680
298 Ga0496100_0021446
299 Ga0496100_0512469
300 Ga0496101_0220654
301 Ga0496102_0229980
302 Ga0496103_0004787
303 Ga0496108_0295603
304 Ga0496111_0008274
305 Ga0496117_0000005
306 Ga0496118_0000022
307 Ga0496118_0002552
308 Ga0496121_0017366
309 Ga0496121_0036660
310 Ga0496121_0171974
311 Ga0496122_0013911
312 Ga0496123_0004701
313 Ga0496124_0038001
314 Ga0496124_0121649
315 Ga0496124_0152968
316 Ga0496124_0386022
317 Ga0496126_0057456
318 Ga0496126_0206779
319 Ga0496126_0285638
320 Ga0495678_057807
321 Ga0495682_0006095
322 Ga0495682_0033559
323 Ga0501034_0434353
324 Ga0501037_0099008
325 Ga0501038_0231338
326 Ga0501043_0269339
327 Ga0501047_0001649
328 Ga0501035_0003685
329 Ga0501035_0057391
330 Ga0501044_0001247
331 Ga0501044_0068102
332 nmdc:mga03n38_7238_c1
333 nmdc:mga0yw44_85830_c1
334 nmdc:mga0k408_40047_c1
335 nmdc:mga06z11_75108_c1
336 nmdc:mga04h51_8022_c1
337 Ga0500618_003526
338 2511249579
339 2513962698
340 2550695356
341 2553005020
342 2599907735
343 2601671348
344 2643859147
345 2643979840
346 2644027040
347 2644123014
348 2723879566
349 2765571386
350 2808982446
351 2809033734
352 2809129727
353 2809149218
354 2852619359
355 2855735251
356 2857542428
357 2857578075
358 2858954521
359 2881417150
360 2884812074
361 2884838544
362 2884854835
363 2896156496
364 2923513971
365 2928134755
366 2932415489
367 2932421350
368 8055269526

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02390

Methyltransf_4

Putative methyltransferase

141

209

0.94

PF05175

MTS

Methyltransferase small domain

132

228

0.94

PF08241

Methyltransf_11

Methyltransferase domain

144

221

0.94

PF01170

UPF0020

RMKL-like, methyltransferase domain

120

229

0.9

PF13847

Methyltransf_31

Methyltransferase domain

138

267

0.89

PF17827

PrmC_N

PrmC N-terminal domain

20

93

0.89

PF13649

Methyltransf_25

Methyltransferase domain

143

227

0.86

PF06325

PrmA

Ribosomal protein L11 methyltransferase (PrmA)

132

215

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
1t43-assembly1.cif.gz_A crystal structure analysis of e.coli protein (n5)-glutamine methyltransferase (hemk) 0.9407 5 269
1nv9-assembly1.cif.gz_A hemk, apo structure 0.9128 16 268
1t43-assembly1.cif.gz_A crystal structure analysis of e.coli protein (n5)-glutamine methyltransferase (hemk) 0.9042 5 269
1vq1-assembly1.cif.gz_A crystal structure of n5-glutamine methyltransferase, hemk(ec 2.1.1.-) (tm0488) from thermotoga maritima at 2.80 a resolution 0.9019 16 274
1vq1-assembly2.cif.gz_B crystal structure of n5-glutamine methyltransferase, hemk(ec 2.1.1.-) (tm0488) from thermotoga maritima at 2.80 a resolution 0.8953 16 274
ID Description Score Start End Superfamily
1t43A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9677 80 269 3.40.50.150
1t43A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9529 80 269 3.40.50.150
af_Q4E3J0_145_404_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9481 106 159 3.40.50.150
af_P0ACC1_1_83_1.10.8.10 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Ubiquitin-associated (UBA) domain 0.9255 3 77 1.10.8.10
af_A0A1D6EFY7_537_616_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9219 104 163 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A378A736-F1-model_v4 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase (EC 2.1.1.-) 0.9935 106 260 GO:0003676
GO:0032259
GO:0036009
AF-A0A3M2ZX95-F1-model_v4 peptide chain release factor N(5)-glutamine methyltransferase (EC 2.1.1.297) 0.9896 64 271 GO:0003676
GO:0032259
GO:0036009
GO:0102559
AF-A0A7C3NZV2-F1-model_v4 Release factor glutamine methyltransferase (RF MTase) (EC 2.1.1.297) (N5-glutamine methyltransferase PrmC) (Protein-(glutamine-N5) MTase PrmC) (Protein-glutamine N-methyltransferase PrmC) 0.9889 1 270 GO:0003676
GO:0032259
GO:0036009
GO:0102559
AF-A0A1G0JSS6-F1-model_v4 peptide chain release factor N(5)-glutamine methyltransferase (EC 2.1.1.297) 0.9873 56 271 GO:0003676
GO:0032259
GO:0036009
GO:0102559
AF-A0A6S6T7L3-F1-model_v4 Protein-N(5)-glutamine methyltransferase PrmC, methylates polypeptide chain release factors RF1 and RF2 0.9871 178 271 GO:0032259
GO:0036009

Map