F282917

General Info

Members Datasets Scaffolds Average Seq Length
184 125 368 177

Family's Representative Sequence

Representative Sequence 3300037068|Ga0373925_0092987|Ga0373925_0092987_1641_2270
Length 200
Sequence MVNRKDVTVPDFYKTYINALEEDTLQEALANNTRRFRKLLKQIPHKKINYAYAEGKWTVKELLQHIIDAERVFIYRALTFARQDPAPLPGFDENNWAITAKAPKRKWHELVDEFKALRSANELFLNSLDDDQLQQTGSANNNAISVAGLAFVCAGHVAHHMRIIRERYLGDQPADRKIETVKIDEKVKKGKARENAKIVR

Samples

Sample ID Description Type Environment
1 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
32 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
36 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
38 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
39 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
44 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
49 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
50 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
51 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
52 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
53 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
79 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
80 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
81 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
82 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
83 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
84 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
85 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
86 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
87 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
88 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
89 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
90 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
91 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
92 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
93 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
94 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
95 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
96 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
97 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
98 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
99 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
100 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
101 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
102 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
103 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
104 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
105 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
106 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
107 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
109 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
110 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
111 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
112 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
113 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
114 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
115 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
116 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
117 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
118 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
119 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
120 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
121 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
122 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
123 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
124 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
125 2738541278 Niastella sp. CF465 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.46
Metatranscriptomes 0
Isolates 0.54

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.15
Nodule 0
Rhizoplane 1.63
Rhizosphere 82.61
Stem 0
Stem Tuber 0
Unclassified 14.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373925_0092987 3300037068 Bacteria 2308
2 rootH2_10025891 3300003320 Bacteria 12464
3 rootH2_10038350 3300003320 Bacteria 1613
4 rootH2_10073961 3300003320 Bacteria 6648
5 rootH2_10073962 3300003320 Bacteria 6663
6 rootH1_10317655 3300003323 Bacteria 1432
7 Ga0065714_10177454 3300005288 Bacteria 977
8 Ga0070683_100007472 3300005329 Bacteria 9233
9 Ga0070683_100344428 3300005329 Bacteria 1419
10 Ga0068869_100008019 3300005334 Bacteria 6783
11 Ga0070689_100155771 3300005340 Bacteria 1844
12 Ga0070691_10035367 3300005341 Unclassified 2352
13 Ga0070691_10085957 3300005341 Bacteria 1545
14 Ga0070661_100008101 3300005344 Bacteria 7250
15 Ga0070675_100023329 3300005354 Bacteria 4947
16 Ga0070673_100134740 3300005364 Bacteria 2077
17 Ga0070688_100165005 3300005365 Bacteria 1524
18 Ga0070667_100502973 3300005367 Unclassified 1111
19 Ga0070667_100699968 3300005367 Unclassified 937
20 Ga0070663_100727186 3300005455 Unclassified 846
21 Ga0070662_100684576 3300005457 Bacteria 867
22 Ga0070681_10011897 3300005458 Bacteria 8629
23 Ga0068867_100493552 3300005459 Unclassified 1051
24 Ga0070698_100475056 3300005471 Unclassified 1187
25 Ga0070684_100010052 3300005535 Bacteria 7479
26 Ga0070684_100123108 3300005535 Bacteria 2334
27 Ga0068853_100080292 3300005539 Unclassified 2853
28 Ga0068853_100357316 3300005539 Bacteria 1360
29 Ga0070665_100549813 3300005548 Bacteria 1167
30 Ga0068855_100009740 3300005563 Bacteria 11590
31 Ga0068855_100020864 3300005563 Bacteria 7857
32 Ga0070664_100034288 3300005564 Bacteria 4257
33 Ga0068857_100058730 3300005577 Bacteria 3417
34 Ga0068857_100300865 3300005577 Bacteria 1479
35 Ga0068857_100396194 3300005577 Bacteria 1284
36 Ga0068857_100463883 3300005577 Bacteria 1185
37 Ga0068856_100034229 3300005614 Bacteria 4977
38 Ga0068859_100359700 3300005617 Bacteria 1550
39 Ga0068859_100447098 3300005617 Bacteria 1388
40 Ga0068864_100006888 3300005618 Bacteria 9315
41 Ga0068860_100270164 3300005843 Bacteria 1659
42 Ga0081539_10061765 3300005985 Bacteria 2051
43 Ga0070717_10485032 3300006028 Bacteria 1116
44 Ga0075367_10522501 3300006178 Unclassified 753
45 Ga0097620_100447084 3300006931 Bacteria 1388
46 Ga0105240_10001362 3300009093 Bacteria 41962
47 Ga0105240_10010681 3300009093 Bacteria 12885
48 Ga0105240_10135779 3300009093 Bacteria 2946
49 Ga0105240_10304167 3300009093 Unclassified 1823
50 Ga0111539_11204081 3300009094 Bacteria 880
51 Ga0111539_11330248 3300009094 Bacteria 834
52 Ga0105247_10000640 3300009101 Bacteria 28018
53 Ga0114129_10004008 3300009147 Bacteria 20804
54 Ga0105237_10002550 3300009545 Bacteria 22531
55 Ga0105237_10020008 3300009545 Bacteria 6910
56 Ga0105237_10150331 3300009545 Unclassified 2325
57 Ga0105237_11966008 3300009545 Bacteria 593
58 Ga0105238_10515875 3300009551 Bacteria 1197
59 Ga0105238_10579716 3300009551 Bacteria 1128
60 Ga0105238_11251606 3300009551 Bacteria 767
61 Ga0105249_10460669 3300009553 Bacteria 1311
62 Ga0105239_10000101 3300010375 Bacteria 119610
63 Ga0105239_10033999 3300010375 Bacteria 5597
64 Ga0105239_10072009 3300010375 Bacteria 3798
65 Ga0105239_10090995 3300010375 Unclassified 3366
66 Ga0157370_10072509 3300013104 Bacteria 3249
67 Ga0157370_10086580 3300013104 Unclassified 2943
68 Ga0157369_10026341 3300013105 Bacteria 6451
69 Ga0157374_10000002 3300013296 Bacteria 1054226
70 Ga0157374_10002944 3300013296 Bacteria 14266
71 Ga0157374_10372195 3300013296 Bacteria 1422
72 Ga0157374_10623836 3300013296 Bacteria 1089
73 Ga0163162_10576061 3300013306 Bacteria 1253
74 Ga0163162_11465217 3300013306 Bacteria 777
75 Ga0157372_10026800 3300013307 Bacteria 6274
76 Ga0157372_10028770 3300013307 Bacteria 6065
77 Ga0157372_10148098 3300013307 Bacteria 2708
78 Ga0157375_10043185 3300013308 Bacteria 4370
79 Ga0163163_10000638 3300014325 Bacteria 30140
80 Ga0163163_10346331 3300014325 Unclassified 1541
81 Ga0157377_10009808 3300014745 Bacteria 4718
82 Ga0157379_10445984 3300014968 Bacteria 1194
83 Ga0157376_10001775 3300014969 Bacteria 14350
84 Ga0157376_10859415 3300014969 Bacteria 923
85 Ga0163161_10211744 3300017792 Bacteria 1497
86 Ga0209646_1000869 3300025246 Bacteria 10077
87 Ga0207710_10020538 3300025900 Bacteria 2824
88 Ga0207647_10020425 3300025904 Bacteria 4442
89 Ga0207707_10521034 3300025912 Bacteria 1012
90 Ga0207695_10000060 3300025913 Bacteria 360217
91 Ga0207695_10000272 3300025913 Bacteria 129871
92 Ga0207695_10097515 3300025913 Bacteria 2941
93 Ga0207695_10146328 3300025913 Bacteria 2307
94 Ga0207671_10001990 3300025914 Bacteria 22531
95 Ga0207671_10013192 3300025914 Bacteria 6594
96 Ga0207671_11204764 3300025914 Bacteria 592
97 Ga0207649_10152974 3300025920 Bacteria 1591
98 Ga0207694_10137017 3300025924 Unclassified 1967
99 Ga0207694_10326608 3300025924 Bacteria 1267
100 Ga0207694_10353329 3300025924 Bacteria 1217
101 Ga0207659_10005451 3300025926 Bacteria 7714
102 Ga0207706_10034232 3300025933 Bacteria 4519
103 Ga0207670_10024231 3300025936 Bacteria 3791
104 Ga0207669_10692214 3300025937 Unclassified 837
105 Ga0207689_10022263 3300025942 Bacteria 5328
106 Ga0207661_10489735 3300025944 Bacteria 1123
107 Ga0207679_10487502 3300025945 Bacteria 1098
108 Ga0207667_10002109 3300025949 Bacteria 24936
109 Ga0207667_10025081 3300025949 Bacteria 6536
110 Ga0207667_10162713 3300025949 Bacteria 2295
111 Ga0207712_10475288 3300025961 Bacteria 1064
112 Ga0207658_10551426 3300025986 Unclassified 1031
113 Ga0207677_10018708 3300026023 Bacteria 4162
114 Ga0207677_11203231 3300026023 Bacteria 694
115 Ga0207639_10005158 3300026041 Bacteria 8808
116 Ga0207639_10207089 3300026041 Bacteria 1686
117 Ga0207702_10032597 3300026078 Unclassified 4348
118 Ga0207648_10572794 3300026089 Bacteria 1039
119 Ga0207676_10011775 3300026095 Bacteria 6257
120 Ga0207676_10039538 3300026095 Bacteria 3609
121 Ga0207676_11613176 3300026095 Bacteria 647
122 Ga0207674_10017465 3300026116 Bacteria 7828
123 Ga0207674_10038300 3300026116 Bacteria 4978
124 Ga0207674_10201766 3300026116 Bacteria 1938
125 Ga0268266_10627907 3300028379 Bacteria 1033
126 Ga0268264_10120360 3300028381 Bacteria 2313
127 Ga0307513_10392515 3300031456 Bacteria 1124
128 Ga0307509_10380759 3300031507 Bacteria 1124
129 Ga0307408_100000054 3300031548 Bacteria 146208
130 Ga0307508_10004548 3300031616 Bacteria 13511
131 Ga0307510_10055647 3300033180 Bacteria 4129
132 Ga0436365_0274296 3300039437 Bacteria 1971
133 Ga0439439_0032110 3300041406 Bacteria 1340
134 Ga0451789_0196882 3300041443 Bacteria 1034
135 Ga0451800_1067277 3300041459 Bacteria 718
136 Ga0451833_0528375 3300041491 Unclassified 986
137 Ga0451849_1485621 3300041505 Bacteria 839
138 Ga0439449_0075077 3300042007 Bacteria 1246
139 Ga0439462_0074416 3300042015 Bacteria 924
140 Ga0439462_0132728 3300042015 Bacteria 696
141 Ga0466969_0001691 3300044656 Bacteria 11789
142 Ga0466972_0000083 3300044658 Bacteria 87204
143 Ga0466972_0024493 3300044658 Bacteria 2995
144 Ga0466966_0000389 3300044684 Bacteria 28532
145 Ga0466961_0034248 3300044693 Bacteria 3261
146 Ga0466964_0239432 3300044706 Unclassified 889
147 Ga0466971_0244399 3300044719 Bacteria 854
148 Ga0466968_0023701 3300044735 Bacteria 2503
149 Ga0466970_0112116 3300044765 Bacteria 1490
150 Ga0466970_0132384 3300044765 Bacteria 1370
151 Ga0466970_0192422 3300044765 Bacteria 1134
152 Ga0466957_0006890 3300044842 Bacteria 6421
153 Ga0466957_0027610 3300044842 Unclassified 3375
154 Ga0466957_0298186 3300044842 Bacteria 1082
155 Ga0466959_0000025 3300045049 Bacteria 120128
156 Ga0466959_0008005 3300045049 Bacteria 7447
157 Ga0495606_0247300 3300046507 Unclassified 991
158 Ga0495608_0205106 3300046511 Unclassified 1241
159 Ga0495632_0239702 3300046519 Unclassified 816
160 Ga0495611_0001291 3300046648 Bacteria 12780
161 Ga0495625_0044698 3300046660 Unclassified 3205
162 Ga0496110_0145336 3300048913 Bacteria 2145
163 Ga0501047_0037567 3300049581 Bacteria 4682
164 Ga0501047_0413221 3300049581 Bacteria 1181
165 Ga0501225_0040400 3300049705 Bacteria 1286
166 Ga0501083_0064598 3300049744 Unclassified 2439
167 Ga0501044_0016696 3300049823 Bacteria 7881
168 nmdc:mga05p37_102863_c1 3300050507 Bacteria 3517
169 Ga0500578_0000066 3300053086 Bacteria 116854
170 Ga0500578_0073441 3300053086 Bacteria 2179
171 Ga0500646_0016478 3300053090 Bacteria 1930
172 Ga0500583_0000002 3300053092 Bacteria 232826
173 Ga0500583_0002659 3300053092 Bacteria 5429
174 Ga0500618_054890 3300053125 Bacteria 899
175 Ga0500652_199719 3300053131 Bacteria 812
176 Ga0500559_0208006 3300053136 Bacteria 923
177 Ga0500588_0013476 3300053146 Unclassified 2052
178 Ga0500589_038583 3300053147 Bacteria 2230
179 Ga0500604_0020243 3300053151 Bacteria 1871
180 Ga0500616_0005279 3300053153 Bacteria 8828
181 Ga0500622_0017860 3300053156 Bacteria 3774
182 Ga0500611_039878 3300053727 Unclassified 1025
183 Ga0466962_0024961 3300061719 Bacteria 2870
184 2738728208 2738541278 Bacteria 9755573
185 Ga0373925_0092987
186 rootH2_10025891
187 rootH2_10038350
188 rootH2_10073961
189 rootH2_10073962
190 rootH1_10317655
191 Ga0065714_10177454
192 Ga0070683_100007472
193 Ga0070683_100344428
194 Ga0068869_100008019
195 Ga0070689_100155771
196 Ga0070691_10035367
197 Ga0070691_10085957
198 Ga0070661_100008101
199 Ga0070675_100023329
200 Ga0070673_100134740
201 Ga0070688_100165005
202 Ga0070667_100502973
203 Ga0070667_100699968
204 Ga0070663_100727186
205 Ga0070662_100684576
206 Ga0070681_10011897
207 Ga0068867_100493552
208 Ga0070698_100475056
209 Ga0070684_100010052
210 Ga0070684_100123108
211 Ga0068853_100080292
212 Ga0068853_100357316
213 Ga0070665_100549813
214 Ga0068855_100009740
215 Ga0068855_100020864
216 Ga0070664_100034288
217 Ga0068857_100058730
218 Ga0068857_100300865
219 Ga0068857_100396194
220 Ga0068857_100463883
221 Ga0068856_100034229
222 Ga0068859_100359700
223 Ga0068859_100447098
224 Ga0068864_100006888
225 Ga0068860_100270164
226 Ga0081539_10061765
227 Ga0070717_10485032
228 Ga0075367_10522501
229 Ga0097620_100447084
230 Ga0105240_10001362
231 Ga0105240_10010681
232 Ga0105240_10135779
233 Ga0105240_10304167
234 Ga0111539_11204081
235 Ga0111539_11330248
236 Ga0105247_10000640
237 Ga0114129_10004008
238 Ga0105237_10002550
239 Ga0105237_10020008
240 Ga0105237_10150331
241 Ga0105237_11966008
242 Ga0105238_10515875
243 Ga0105238_10579716
244 Ga0105238_11251606
245 Ga0105249_10460669
246 Ga0105239_10000101
247 Ga0105239_10033999
248 Ga0105239_10072009
249 Ga0105239_10090995
250 Ga0157370_10072509
251 Ga0157370_10086580
252 Ga0157369_10026341
253 Ga0157374_10000002
254 Ga0157374_10002944
255 Ga0157374_10372195
256 Ga0157374_10623836
257 Ga0163162_10576061
258 Ga0163162_11465217
259 Ga0157372_10026800
260 Ga0157372_10028770
261 Ga0157372_10148098
262 Ga0157375_10043185
263 Ga0163163_10000638
264 Ga0163163_10346331
265 Ga0157377_10009808
266 Ga0157379_10445984
267 Ga0157376_10001775
268 Ga0157376_10859415
269 Ga0163161_10211744
270 Ga0209646_1000869
271 Ga0207710_10020538
272 Ga0207647_10020425
273 Ga0207707_10521034
274 Ga0207695_10000060
275 Ga0207695_10000272
276 Ga0207695_10097515
277 Ga0207695_10146328
278 Ga0207671_10001990
279 Ga0207671_10013192
280 Ga0207671_11204764
281 Ga0207649_10152974
282 Ga0207694_10137017
283 Ga0207694_10326608
284 Ga0207694_10353329
285 Ga0207659_10005451
286 Ga0207706_10034232
287 Ga0207670_10024231
288 Ga0207669_10692214
289 Ga0207689_10022263
290 Ga0207661_10489735
291 Ga0207679_10487502
292 Ga0207667_10002109
293 Ga0207667_10025081
294 Ga0207667_10162713
295 Ga0207712_10475288
296 Ga0207658_10551426
297 Ga0207677_10018708
298 Ga0207677_11203231
299 Ga0207639_10005158
300 Ga0207639_10207089
301 Ga0207702_10032597
302 Ga0207648_10572794
303 Ga0207676_10011775
304 Ga0207676_10039538
305 Ga0207676_11613176
306 Ga0207674_10017465
307 Ga0207674_10038300
308 Ga0207674_10201766
309 Ga0268266_10627907
310 Ga0268264_10120360
311 Ga0307513_10392515
312 Ga0307509_10380759
313 Ga0307408_100000054
314 Ga0307508_10004548
315 Ga0307510_10055647
316 Ga0436365_0274296
317 Ga0439439_0032110
318 Ga0451789_0196882
319 Ga0451800_1067277
320 Ga0451833_0528375
321 Ga0451849_1485621
322 Ga0439449_0075077
323 Ga0439462_0074416
324 Ga0439462_0132728
325 Ga0466969_0001691
326 Ga0466972_0000083
327 Ga0466972_0024493
328 Ga0466966_0000389
329 Ga0466961_0034248
330 Ga0466964_0239432
331 Ga0466971_0244399
332 Ga0466968_0023701
333 Ga0466970_0112116
334 Ga0466970_0132384
335 Ga0466970_0192422
336 Ga0466957_0006890
337 Ga0466957_0027610
338 Ga0466957_0298186
339 Ga0466959_0000025
340 Ga0466959_0008005
341 Ga0495606_0247300
342 Ga0495608_0205106
343 Ga0495632_0239702
344 Ga0495611_0001291
345 Ga0495625_0044698
346 Ga0496110_0145336
347 Ga0501047_0037567
348 Ga0501047_0413221
349 Ga0501225_0040400
350 Ga0501083_0064598
351 Ga0501044_0016696
352 nmdc:mga05p37_102863_c1
353 Ga0500578_0000066
354 Ga0500578_0073441
355 Ga0500646_0016478
356 Ga0500583_0000002
357 Ga0500583_0002659
358 Ga0500618_054890
359 Ga0500652_199719
360 Ga0500559_0208006
361 Ga0500588_0013476
362 Ga0500589_038583
363 Ga0500604_0020243
364 Ga0500616_0005279
365 Ga0500622_0017860
366 Ga0500611_039878
367 Ga0466962_0024961
368 2738728208

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12867

DinB_2

DinB superfamily

28

164

0.97

PF05163

DinB

DinB family

14

162

0.92

PF04978

DUF664

Protein of unknown function (DUF664)

24

170

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2nsf-assembly1.cif.gz_A crystal structure of the mycothiol-dependent maleylpyruvate isomerase 0.8331 25 160
2nsg-assembly1.cif.gz_A crystal structure of the mycothiol-dependent maleylpyruvate isomerase h52a mutant 0.8326 25 160
2rd9-assembly1.cif.gz_A crystal structure of a putative yfit-like metal-dependent hydrolase (bh0186) from bacillus halodurans c-125 at 2.30 a resolution 0.8321 25 168
2yqy-assembly2.cif.gz_B crystal structure of tt2238, a four-helix bundle protein 0.8311 25 165
2rd9-assembly3.cif.gz_B crystal structure of a putative yfit-like metal-dependent hydrolase (bh0186) from bacillus halodurans c-125 at 2.30 a resolution 0.8127 25 168
ID Description Score Start End Superfamily
2nsgA01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.8326 25 160 1.20.120.450
2yqyB00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.8311 25 165 1.20.120.450
3dkaA01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.8004 25 165 1.20.120.450
2yqyB00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7816 25 165 1.20.120.450
af_O53728_4_171_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7586 25 162 1.20.120.450
ID Description Score Start End GO Terms
AF-A0A7W1GYM8-F1-model_v4 DinB family protein 0.9876 56 168
AF-A0A357JEA8-F1-model_v4 DNA damage-inducible protein DinB 0.9873 60 169
AF-A0A7Y3GR22-F1-model_v4 DinB family protein 0.9865 57 169
AF-A0A4V1ZTF5-F1-model_v4 DinB family protein 0.9843 1 169
AF-A0A6N6KCU0-F1-model_v4 DinB family protein 0.9832 10 169

Map