F282920

General Info

Members Datasets Scaffolds Average Seq Length
184 143 369 220

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0000004|Ga0395899_0000004_55991_56731
Length 246
Sequence MLAVRDLTKHFLRHGERRVVFEDLNLDLGRRGRLAVLGRNGQGKSTLIKILGGVLPPTSGSIRWDMSCSWPLGFTGAFQGGMTGVDNINFVARIYDRPRRRTVERVQEFAELGDALTIPVKYYSSGMRQRLAFGLSLAIEFDCYLIDEVIAVGDAKFRRKCEEELFERRGDRAFVIASHDLNFLKNTCQSAIIVENGRAKLFDDVSLAVDIYCALCEEETVMALSRRAEGPAKRSSAPVVAAVGGV

Samples

Sample ID Description Type Environment
1 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
5 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
6 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
7 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
8 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
9 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
10 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
11 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
12 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
30 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
31 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
32 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
33 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
34 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
39 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
40 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
48 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
51 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
52 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
77 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
78 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
80 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
81 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
82 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
83 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
84 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
85 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
86 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
87 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
88 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
89 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
90 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
91 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
92 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
93 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
94 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
95 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
96 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
97 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
98 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
99 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
100 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
101 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
102 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
103 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
104 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
105 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
106 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
107 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
108 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
109 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
110 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
111 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
112 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
113 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
114 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
115 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
116 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
117 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
118 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
119 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
120 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
121 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
122 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
123 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
124 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
125 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
126 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
127 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
128 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
129 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
130 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
131 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
132 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
133 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
134 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
135 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
136 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
137 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
138 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
139 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
140 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
141 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
142 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
143 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.37
Metatranscriptomes 0
Isolates 1.63

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.83
Nodule 0
Rhizoplane 0.54
Rhizosphere 67.93
Stem 0
Stem Tuber 0
Unclassified 1.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395899_0000004 3300037312 Bacteria 874267
2 rootH1_10037579 3300003316 Bacteria 3867
3 rootH1_10039938 3300003316 Bacteria 8155
4 rootH1_10096009 3300003316 Bacteria 10355
5 rootH1_10099334 3300003316 Bacteria 2915
6 rootH1_10099334 3300003323 Bacteria 2696
7 rootL2_10020506 3300003322 Bacteria 4850
8 rootL2_10289249 3300003322 Bacteria 4937
9 Ga0055539_1014049 3300003752 Bacteria 979
10 Ga0055532_1000218 3300003758 Bacteria 43505
11 Ga0055527_1000151 3300003760 Bacteria 49117
12 Ga0055535_1000269 3300003761 Bacteria 54490
13 Ga0055542_1000282 3300003762 Bacteria 57045
14 Ga0055529_1000320 3300003763 Bacteria 54572
15 Ga0055540_1024125 3300003792 Bacteria 1516
16 Ga0058692_1006742 3300003856 Bacteria 3116
17 Ga0065704_10091458 3300005289 Bacteria 2716
18 Ga0070676_10199998 3300005328 Bacteria 1309
19 Ga0070670_100202051 3300005331 Bacteria 1727
20 Ga0070666_10059148 3300005335 Bacteria 2592
21 Ga0068868_100071257 3300005338 Bacteria 2772
22 Ga0070660_100456719 3300005339 Bacteria 1060
23 Ga0070675_100140351 3300005354 Bacteria 2065
24 Ga0070678_100516523 3300005456 Bacteria 1056
25 Ga0070662_100005193 3300005457 Bacteria 8309
26 Ga0070707_100658003 3300005468 Bacteria 1010
27 Ga0070699_100667231 3300005518 Bacteria 949
28 Ga0068853_100276204 3300005539 Bacteria 1548
29 Ga0068853_100913820 3300005539 Bacteria 843
30 Ga0070665_100048326 3300005548 Bacteria 4272
31 Ga0068855_100008390 3300005563 Bacteria 12494
32 Ga0068855_100018430 3300005563 Bacteria 8389
33 Ga0068859_100338249 3300005617 Bacteria 1599
34 Ga0068864_101061719 3300005618 Bacteria 805
35 Ga0068858_100268065 3300005842 Bacteria 1624
36 Ga0075364_10348483 3300006051 Bacteria 1009
37 Ga0075362_10005926 3300006177 Bacteria 4516
38 Ga0075367_10013672 3300006178 Bacteria 4372
39 Ga0075367_10428912 3300006178 Bacteria 837
40 Ga0075369_10002417 3300006186 Bacteria 6660
41 Ga0075366_10000430 3300006195 Bacteria 19592
42 Ga0075366_10015017 3300006195 Bacteria 4428
43 Ga0097621_100092433 3300006237 Bacteria 2534
44 Ga0075370_10000064 3300006353 Bacteria 31947
45 Ga0075370_10004507 3300006353 Bacteria 6779
46 Ga0075370_10019356 3300006353 Bacteria 3707
47 Ga0097620_100338248 3300006931 Bacteria 1599
48 Ga0105240_10000447 3300009093 Bacteria 75976
49 Ga0105240_10034834 3300009093 Bacteria 6490
50 Ga0105247_10001255 3300009101 Bacteria 18810
51 Ga0105243_10064100 3300009148 Bacteria 2947
52 Ga0105242_10881067 3300009176 Bacteria 893
53 Ga0105248_10000029 3300009177 Bacteria 223366
54 Ga0105248_10490210 3300009177 Bacteria 1385
55 Ga0105237_10093065 3300009545 Bacteria 3004
56 Ga0105238_10034514 3300009551 Bacteria 5146
57 Ga0105239_10104669 3300010375 Bacteria 3133
58 Ga0105239_10111122 3300010375 Bacteria 3038
59 Ga0157370_10009027 3300013104 Bacteria 10698
60 Ga0157369_10020499 3300013105 Bacteria 7390
61 Ga0157374_10802321 3300013296 Bacteria 957
62 Ga0163162_10075155 3300013306 Bacteria 3439
63 Ga0157375_10118850 3300013308 Bacteria 2750
64 Ga0157375_10363941 3300013308 Bacteria 1612
65 Ga0157380_10496970 3300014326 Bacteria 1184
66 Ga0157380_11046016 3300014326 Bacteria 852
67 Ga0157380_11049159 3300014326 Bacteria 851
68 Ga0163161_10007575 3300017792 Bacteria 7506
69 Ga0163161_10326861 3300017792 Bacteria 1214
70 Ga0209672_100028 3300025228 Bacteria 341962
71 Ga0209147_100117 3300025229 Bacteria 143852
72 Ga0209258_100112 3300025242 Bacteria 192884
73 Ga0209677_101123 3300025253 Bacteria 12539
74 Ga0209148_1000081 3300025254 Bacteria 273676
75 Ga0209455_1000050 3300025272 Bacteria 373239
76 Ga0209051_1000929 3300025303 Bacteria 29025
77 Ga0207705_10449621 3300025909 Bacteria 999
78 Ga0207695_10002379 3300025913 Bacteria 27914
79 Ga0207695_10508995 3300025913 Unclassified 1086
80 Ga0207671_10098787 3300025914 Bacteria 2208
81 Ga0207694_10019613 3300025924 Bacteria 5114
82 Ga0207650_10229130 3300025925 Bacteria 1498
83 Ga0207659_10094148 3300025926 Bacteria 2244
84 Ga0207659_10206498 3300025926 Bacteria 1572
85 Ga0207706_10059130 3300025933 Bacteria 3375
86 Ga0207691_10151092 3300025940 Bacteria 2042
87 Ga0207711_10000004 3300025941 Bacteria 870636
88 Ga0207711_10041798 3300025941 Bacteria 3905
89 Ga0207711_10494720 3300025941 Bacteria 1139
90 Ga0207667_10030879 3300025949 Bacteria 5790
91 Ga0207651_10244743 3300025960 Bacteria 1464
92 Ga0207677_10027150 3300026023 Bacteria 3601
93 Ga0207703_10380737 3300026035 Bacteria 1305
94 Ga0207703_10440195 3300026035 Bacteria 1216
95 Ga0207639_10225111 3300026041 Bacteria 1622
96 Ga0207641_10066017 3300026088 Bacteria 3097
97 Ga0207683_10550178 3300026121 Bacteria 1067
98 Ga0209371_1000090 3300027312 Bacteria 173119
99 Ga0209813_10096846 3300027866 Bacteria 998
100 Ga0265356_1002634 3300028017 Bacteria 2354
101 Ga0268266_10212099 3300028379 Bacteria 1776
102 Ga0265334_10004453 3300028573 Bacteria 6217
103 Ga0265318_10011920 3300028577 Bacteria 3718
104 Ga0265338_10133923 3300028800 Bacteria 1952
105 Ga0265338_10210520 3300028800 Bacteria 1460
106 Ga0265324_10021408 3300029957 Bacteria 2318
107 Ga0268256_1000115 3300030500 Bacteria 116918
108 Ga0307512_10018993 3300030522 Bacteria 6269
109 Ga0265320_10063371 3300031240 Bacteria 1758
110 Ga0265325_10068786 3300031241 Bacteria 1782
111 Ga0265331_10096233 3300031250 Bacteria 1366
112 Ga0265316_10075337 3300031344 Bacteria 2595
113 Ga0307509_10259668 3300031507 Bacteria 1514
114 Ga0265313_10107639 3300031595 Bacteria 1229
115 Ga0307508_10021706 3300031616 Bacteria 5839
116 Ga0265314_10203542 3300031711 Bacteria 1168
117 Ga0307516_10105187 3300031730 Bacteria 2634
118 Ga0307406_10177207 3300031901 Bacteria 1549
119 Ga0307416_100952510 3300032002 Bacteria 960
120 Ga0395899_0000247 3300037312 Bacteria 72104
121 Ga0451577_0029689 3300042876 Bacteria 4942
122 Ga0453683_0461390 3300044673 Unclassified 822
123 Ga0466966_0009330 3300044684 Bacteria 6497
124 Ga0466966_0014285 3300044684 Bacteria 5257
125 Ga0466966_0076634 3300044684 Bacteria 2088
126 Ga0466961_0000591 3300044693 Bacteria 23007
127 Ga0466961_0001356 3300044693 Bacteria 15092
128 Ga0466961_0001745 3300044693 Bacteria 13499
129 Ga0466961_0007095 3300044693 Bacteria 7128
130 Ga0466961_0008125 3300044693 Bacteria 6681
131 Ga0466963_0057495 3300044694 Bacteria 2590
132 Ga0466964_0036876 3300044706 Bacteria 1962
133 Ga0466971_0001896 3300044719 Bacteria 8891
134 Ga0466971_0003265 3300044719 Bacteria 6920
135 Ga0466957_0006152 3300044842 Bacteria 6776
136 Ga0466957_0017593 3300044842 Bacteria 4190
137 Ga0466957_0041807 3300044842 Bacteria 2772
138 Ga0466959_0048958 3300045049 Bacteria 3104
139 Ga0466958_0000362 3300045836 Bacteria 18363
140 Ga0466958_0001838 3300045836 Bacteria 10331
141 Ga0466958_0208628 3300045836 Bacteria 1244
142 Ga0466958_0407583 3300045836 Bacteria 878
143 Ga0466967_0084649 3300045976 Bacteria 2870
144 Ga0495592_0000153 3300046454 Bacteria 60062
145 Ga0495653_0042967 3300046463 Bacteria 3517
146 Ga0495585_0021106 3300046492 Bacteria 3741
147 Ga0495596_0181962 3300046500 Bacteria 817
148 Ga0495628_0046161 3300046516 Bacteria 3461
149 Ga0495630_0005639 3300046517 Bacteria 8843
150 Ga0495643_0223648 3300046522 Bacteria 891
151 Ga0495648_0133687 3300046524 Bacteria 1315
152 Ga0495609_0000839 3300046538 Bacteria 22790
153 Ga0495661_0204784 3300046665 Bacteria 1031
154 Ga0495599_0001854 3300046678 Bacteria 12243
155 Ga0495624_0000148 3300046690 Bacteria 51192
156 Ga0495684_0397813 3300047471 Bacteria 968
157 Ga0495602_0001824 3300048088 Bacteria 21291
158 Ga0496112_0064430 3300048915 Bacteria 3617
159 Ga0496122_0003964 3300048925 Bacteria 18914
160 Ga0496123_0002609 3300048926 Bacteria 21896
161 Ga0496124_0489578 3300048927 Bacteria 828
162 Ga0496126_0000297 3300048929 Bacteria 106129
163 nmdc:mga03683_1064_c1 3300050489 Bacteria 8037
164 nmdc:mga00v17_304572_c1 3300050491 Bacteria 1035
165 nmdc:mga0k408_308_c1 3300050493 Bacteria 26541
166 nmdc:mga0k408_782_c1 3300050493 Bacteria 17518
167 nmdc:mga06z11_3040_c1 3300050494 Bacteria 6453
168 nmdc:mga04h51_114772_c1 3300050495 Bacteria 997
169 nmdc:mga07m45_12506_c1 3300050496 Bacteria 4487
170 nmdc:mga07m45_170_c1 3300050496 Bacteria 26138
171 nmdc:mga07m45_19465_c1 3300050496 Bacteria 3679
172 nmdc:mga0sz30_61567_c1 3300050516 Bacteria 1604
173 Ga0500635_0000005 3300053080 Bacteria 187821
174 Ga0500644_0052088 3300053088 Bacteria 1408
175 Ga0500651_0022136 3300053093 Bacteria 3969
176 Ga0500618_001626 3300053125 Bacteria 9694
177 Ga0500568_0002940 3300053139 Bacteria 9757
178 Ga0500619_085854 3300053154 Bacteria 1060
179 Ga0500622_0031720 3300053156 Bacteria 2773
180 Ga0466962_0000130 3300061719 Bacteria 30871
181 Ga0466962_0000362 3300061719 Bacteria 19534
182 Ga0466962_0033122 3300061719 Bacteria 2472
183 2501414059 2501025504 Bacteria 8008976
184 2511094683 2510917014 Bacteria 8296963
185 8018849016 8018845410 Bacteria 8933938
186 Ga0395899_0000004
187 rootH1_10037579
188 rootH1_10039938
189 rootH1_10096009
190 rootH1_10099334
191 rootL2_10020506
192 rootL2_10289249
193 Ga0055539_1014049
194 Ga0055532_1000218
195 Ga0055527_1000151
196 Ga0055535_1000269
197 Ga0055542_1000282
198 Ga0055529_1000320
199 Ga0055540_1024125
200 Ga0058692_1006742
201 Ga0065704_10091458
202 Ga0070676_10199998
203 Ga0070670_100202051
204 Ga0070666_10059148
205 Ga0068868_100071257
206 Ga0070660_100456719
207 Ga0070675_100140351
208 Ga0070678_100516523
209 Ga0070662_100005193
210 Ga0070707_100658003
211 Ga0070699_100667231
212 Ga0068853_100276204
213 Ga0068853_100913820
214 Ga0070665_100048326
215 Ga0068855_100008390
216 Ga0068855_100018430
217 Ga0068859_100338249
218 Ga0068864_101061719
219 Ga0068858_100268065
220 Ga0075364_10348483
221 Ga0075362_10005926
222 Ga0075367_10013672
223 Ga0075367_10428912
224 Ga0075369_10002417
225 Ga0075366_10000430
226 Ga0075366_10015017
227 Ga0097621_100092433
228 Ga0075370_10000064
229 Ga0075370_10004507
230 Ga0075370_10019356
231 Ga0097620_100338248
232 Ga0105240_10000447
233 Ga0105240_10034834
234 Ga0105247_10001255
235 Ga0105243_10064100
236 Ga0105242_10881067
237 Ga0105248_10000029
238 Ga0105248_10490210
239 Ga0105237_10093065
240 Ga0105238_10034514
241 Ga0105239_10104669
242 Ga0105239_10111122
243 Ga0157370_10009027
244 Ga0157369_10020499
245 Ga0157374_10802321
246 Ga0163162_10075155
247 Ga0157375_10118850
248 Ga0157375_10363941
249 Ga0157380_10496970
250 Ga0157380_11046016
251 Ga0157380_11049159
252 Ga0163161_10007575
253 Ga0163161_10326861
254 Ga0209672_100028
255 Ga0209147_100117
256 Ga0209258_100112
257 Ga0209677_101123
258 Ga0209148_1000081
259 Ga0209455_1000050
260 Ga0209051_1000929
261 Ga0207705_10449621
262 Ga0207695_10002379
263 Ga0207695_10508995
264 Ga0207671_10098787
265 Ga0207694_10019613
266 Ga0207650_10229130
267 Ga0207659_10094148
268 Ga0207659_10206498
269 Ga0207706_10059130
270 Ga0207691_10151092
271 Ga0207711_10000004
272 Ga0207711_10041798
273 Ga0207711_10494720
274 Ga0207667_10030879
275 Ga0207651_10244743
276 Ga0207677_10027150
277 Ga0207703_10380737
278 Ga0207703_10440195
279 Ga0207639_10225111
280 Ga0207641_10066017
281 Ga0207683_10550178
282 Ga0209371_1000090
283 Ga0209813_10096846
284 Ga0265356_1002634
285 Ga0268266_10212099
286 Ga0265334_10004453
287 Ga0265318_10011920
288 Ga0265338_10133923
289 Ga0265338_10210520
290 Ga0265324_10021408
291 Ga0268256_1000115
292 Ga0307512_10018993
293 Ga0265320_10063371
294 Ga0265325_10068786
295 Ga0265331_10096233
296 Ga0265316_10075337
297 Ga0307509_10259668
298 Ga0265313_10107639
299 Ga0307508_10021706
300 Ga0265314_10203542
301 Ga0307516_10105187
302 Ga0307406_10177207
303 Ga0307416_100952510
304 Ga0395899_0000247
305 Ga0451577_0029689
306 Ga0453683_0461390
307 Ga0466966_0009330
308 Ga0466966_0014285
309 Ga0466966_0076634
310 Ga0466961_0000591
311 Ga0466961_0001356
312 Ga0466961_0001745
313 Ga0466961_0007095
314 Ga0466961_0008125
315 Ga0466963_0057495
316 Ga0466964_0036876
317 Ga0466971_0001896
318 Ga0466971_0003265
319 Ga0466957_0006152
320 Ga0466957_0017593
321 Ga0466957_0041807
322 Ga0466959_0048958
323 Ga0466958_0000362
324 Ga0466958_0001838
325 Ga0466958_0208628
326 Ga0466958_0407583
327 Ga0466967_0084649
328 Ga0495592_0000153
329 Ga0495653_0042967
330 Ga0495585_0021106
331 Ga0495596_0181962
332 Ga0495628_0046161
333 Ga0495630_0005639
334 Ga0495643_0223648
335 Ga0495648_0133687
336 Ga0495609_0000839
337 Ga0495661_0204784
338 Ga0495599_0001854
339 Ga0495624_0000148
340 Ga0495684_0397813
341 Ga0495602_0001824
342 Ga0496112_0064430
343 Ga0496122_0003964
344 Ga0496123_0002609
345 Ga0496124_0489578
346 Ga0496126_0000297
347 nmdc:mga03683_1064_c1
348 nmdc:mga00v17_304572_c1
349 nmdc:mga0k408_308_c1
350 nmdc:mga0k408_782_c1
351 nmdc:mga06z11_3040_c1
352 nmdc:mga04h51_114772_c1
353 nmdc:mga07m45_12506_c1
354 nmdc:mga07m45_170_c1
355 nmdc:mga07m45_19465_c1
356 nmdc:mga0sz30_61567_c1
357 Ga0500635_0000005
358 Ga0500644_0052088
359 Ga0500651_0022136
360 Ga0500618_001626
361 Ga0500568_0002940
362 Ga0500619_085854
363 Ga0500622_0031720
364 Ga0466962_0000130
365 Ga0466962_0000362
366 Ga0466962_0033122
367 2501414059
368 2511094683
369 8018849016

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

21

151

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
6m96-assembly1.cif.gz_A-2 atp-bound conformation of the wzmwzt o antigen abc transporter 0.9193 2 214
8dne-assembly1.cif.gz_C cryoem structure of the a.aeolicus wzmwzt transporter bound to atp 0.9125 1 221
7k2t-assembly1.cif.gz_C mg2+/atp-bound structure of the full-length wzmwzt o antigen abc transporter in lipid nanodiscs 0.8993 1 220
7dd0-assembly2.cif.gz_B crystal structure of the n-terminal domain of tagh from bacillus subtilis 0.893 2 217
8dne-assembly1.cif.gz_C cryoem structure of the a.aeolicus wzmwzt transporter bound to atp 0.8899 1 221
ID Description Score Start End Superfamily
af_Q2G2L1_4_262_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9139 1 224 3.40.50.300
af_Q2G2L1_4_262_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9024 1 224 3.40.50.300
af_A0A1D6P1I8_181_285_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8864 2 63 3.40.50.300
af_A0A0R0IY12_408_566_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8842 2 63 3.40.50.300
af_A0A0P0VBQ7_902_1031_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8778 2 63 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7G4RK67-F1-model_v4 ABC transporter domain-containing protein 0.989 1 222 GO:0005524
GO:0016020
GO:0016887
GO:0140359
AF-A0A7X4K8Y7-F1-model_v4 ATP-binding cassette domain-containing protein 0.9857 1 217 GO:0005524
GO:0016020
GO:0016887
GO:0140359
AF-Q93UJ9-F1-model_v4 Wzt2 0.9855 5 217 GO:0005524
GO:0005886
GO:0016887
GO:0140359
AF-A0A2S9QAG2-F1-model_v4 ABC transporter domain-containing protein 0.977 2 214 GO:0005524
GO:0016020
GO:0016887
GO:0140359
AF-A0A2E8JQZ3-F1-model_v4 ATP-binding protein 0.9687 2 214 GO:0005524
GO:0016020
GO:0016887
GO:0140359

Map