F282927

General Info

Members Datasets Scaffolds Average Seq Length
184 141 368 387

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_0031566|Ga0395900_0031566_2397_3704
Length 435
Sequence MIAIFLDFKNYLKLNRTLNILLCLIPGPNLLTTIAGFYFKTVENDRGRLTISTMKKKILQKYSELFEGVPLIVRSPGRINVIGEHTDYNEGFVLPAAIDKAAYIAISLRDDEEIHLVAADLNEKFSISIKDLKPVGDISWPNFMLGAVEQYRKRNLFLKGFNAVLLSDVPVGAGLSSSAAIECAVTFALNELLQLNLDNITLVKMAQEAEHEYAGVMCGIMDQFASMMGKKDYVIKLDCRTLDYEYVPFKLDGIKILLLDTNVKHSLASSEYNARRQECEQAVTWIKEHEPKVHSLRDTTETMLDKYVLPKNKLIDKRARFIVQEIGRLQEACEDLKCDNIEAVGKKMYQTHHGLTGMYEVSCKELDFLVDFVTNNNSVIGARMMGGGFGGCTINLVKEEAVDELIEKIKPAYQNETGLKLDHYIVSPENGTKII

Samples

Sample ID Description Type Environment
1 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
6 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
7 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
46 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
47 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
54 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
55 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
56 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
57 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
58 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
59 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
60 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
61 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
91 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
92 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
93 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
94 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
95 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
96 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
97 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
98 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
99 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
100 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
101 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
102 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
103 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
104 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
105 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
106 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
107 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
108 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
109 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
110 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
111 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
112 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
113 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
114 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
115 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
116 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
117 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
118 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
119 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
123 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
124 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
125 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
126 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
127 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
128 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
129 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
130 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
131 2739367656 Pedobacter sp. CF523 Isolate Unclassified
132 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
133 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
134 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
135 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
136 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
137 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
138 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
139 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
140 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
141 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.93
Metatranscriptomes 0.54
Isolates 6.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.89
Nodule 0
Rhizoplane 0
Rhizosphere 84.78
Stem 0
Stem Tuber 0
Unclassified 13.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395900_0031566 3300037418 Bacteria 5445
2 JGI24740J21852_10027056 3300001979 Bacteria 1913
3 rootH2_10124076 3300003320 Bacteria 2238
4 rootH1_10134555 3300003323 Bacteria 7593
5 JGI25160J50197_1001238 3300003354 Bacteria 12967
6 Ga0055531_10000875 3300003794 Bacteria 24688
7 Ga0065714_10002200 3300005288 Bacteria 145275
8 Ga0065704_10071274 3300005289 Bacteria 12073
9 Ga0070658_10161482 3300005327 Bacteria 1880
10 Ga0070658_10182286 3300005327 Bacteria 1767
11 Ga0070676_10008945 3300005328 Bacteria 5416
12 Ga0070683_100014955 3300005329 Bacteria 6805
13 Ga0070683_100029843 3300005329 Bacteria 4943
14 Ga0068869_100059454 3300005334 Unclassified 2798
15 Ga0070682_100151614 3300005337 Bacteria 1591
16 Ga0070660_100001349 3300005339 Bacteria 16684
17 Ga0070660_100133578 3300005339 Bacteria 1987
18 Ga0070689_100167261 3300005340 Bacteria 1780
19 Ga0070661_100058704 3300005344 Bacteria 2820
20 Ga0070668_100240815 3300005347 Unclassified 1498
21 Ga0070675_100093898 3300005354 Unclassified 2516
22 Ga0070671_100101248 3300005355 Bacteria 2417
23 Ga0070674_100056169 3300005356 Unclassified 2729
24 Ga0070673_100005988 3300005364 Bacteria 7867
25 Ga0070659_100139667 3300005366 Bacteria 1972
26 Ga0070667_100050184 3300005367 Unclassified 3516
27 Ga0070667_100105322 3300005367 Unclassified 2441
28 Ga0070678_100024931 3300005456 Bacteria 4013
29 Ga0068867_100050676 3300005459 Bacteria 3061
30 Ga0070679_100002258 3300005530 Bacteria 17402
31 Ga0070679_100083461 3300005530 Bacteria 3184
32 Ga0070679_100345557 3300005530 Bacteria 1436
33 Ga0070684_100022315 3300005535 Bacteria 5278
34 Ga0068853_100024611 3300005539 Bacteria 5050
35 Ga0070672_100026793 3300005543 Unclassified 4295
36 Ga0070664_100004349 3300005564 Bacteria 11390
37 Ga0068852_100006389 3300005616 Bacteria 8514
38 Ga0068852_100039703 3300005616 Bacteria 3964
39 Ga0068852_100245863 3300005616 Bacteria 1712
40 Ga0068859_100058062 3300005617 Unclassified 3898
41 Ga0068861_100050017 3300005719 Bacteria 3168
42 Ga0068863_100035977 3300005841 Bacteria 4716
43 Ga0068860_100073323 3300005843 Bacteria 3254
44 Ga0097621_100014046 3300006237 Bacteria 5983
45 Ga0068865_100125776 3300006881 Unclassified 1913
46 Ga0097620_100058062 3300006931 Unclassified 3898
47 Ga0105240_10061789 3300009093 Bacteria 4667
48 Ga0105243_10000003 3300009148 Bacteria 712931
49 Ga0105241_10010284 3300009174 Bacteria 6872
50 Ga0105241_10078043 3300009174 Bacteria 2587
51 Ga0105241_10079376 3300009174 Unclassified 2566
52 Ga0105242_10024399 3300009176 Unclassified 4775
53 Ga0105242_10042271 3300009176 Unclassified 3679
54 Ga0105237_10017965 3300009545 Bacteria 7327
55 Ga0105239_10095445 3300010375 Bacteria 3285
56 Ga0105239_10266833 3300010375 Bacteria 1925
57 Ga0105246_10144507 3300011119 Unclassified 1793
58 Ga0157373_10009585 3300013100 Bacteria 7147
59 Ga0157371_10098992 3300013102 Bacteria 2068
60 Ga0157370_10002662 3300013104 Bacteria 21430
61 Ga0157369_10015994 3300013105 Bacteria 8443
62 Ga0157369_10180964 3300013105 Bacteria 2218
63 Ga0157374_10070515 3300013296 Bacteria 3294
64 Ga0157378_10023935 3300013297 Bacteria 5371
65 Ga0157372_10005797 3300013307 Bacteria 13153
66 Ga0157372_10013264 3300013307 Bacteria 8795
67 Ga0157372_10021688 3300013307 Bacteria 6943
68 Ga0157372_10078083 3300013307 Bacteria 3740
69 Ga0157372_10128923 3300013307 Bacteria 2909
70 Ga0157372_10172869 3300013307 Bacteria 2500
71 Ga0157376_10120311 3300014969 Unclassified 2326
72 Ga0182006_1000230 3300015261 Bacteria 53105
73 Ga0182005_1000098 3300015265 Bacteria 66185
74 Ga0183373_1001 3300015682 Bacteria 1410374
75 Ga0213876_10006255 3300021384 Bacteria 6494
76 Ga0213875_10009255 3300021388 Bacteria 4997
77 Ga0209436_104192 3300025208 Bacteria 3614
78 Ga0207426_1000026 3300025302 Bacteria 515228
79 Ga0207426_1022902 3300025302 Bacteria 2138
80 Ga0209257_1000001 3300025304 Bacteria 2274655
81 Ga0207647_10000057 3300025904 Bacteria 85211
82 Ga0207645_10001767 3300025907 Bacteria 17508
83 Ga0207654_10005052 3300025911 Bacteria 6658
84 Ga0207695_10003298 3300025913 Bacteria 22912
85 Ga0207657_10050388 3300025919 Bacteria 3624
86 Ga0207657_10100800 3300025919 Bacteria 2397
87 Ga0207652_10061846 3300025921 Bacteria 3234
88 Ga0207652_10099365 3300025921 Bacteria 2567
89 Ga0207650_10045159 3300025925 Bacteria 3241
90 Ga0207659_10089191 3300025926 Unclassified 2299
91 Ga0207644_10126655 3300025931 Bacteria 1950
92 Ga0207690_10010807 3300025932 Bacteria 5439
93 Ga0207706_10159908 3300025933 Unclassified 1980
94 Ga0207686_10146762 3300025934 Bacteria 1637
95 Ga0207709_10000008 3300025935 Bacteria 713099
96 Ga0207691_10021576 3300025940 Bacteria 6080
97 Ga0207689_10002619 3300025942 Bacteria 16651
98 Ga0207689_10009081 3300025942 Bacteria 8606
99 Ga0207689_10025460 3300025942 Bacteria 4958
100 Ga0207661_10006773 3300025944 Bacteria 8114
101 Ga0207661_10077352 3300025944 Bacteria 2736
102 Ga0207661_10246683 3300025944 Unclassified 1586
103 Ga0207679_10004046 3300025945 Bacteria 9107
104 Ga0207679_10045831 3300025945 Bacteria 3165
105 Ga0207667_10006165 3300025949 Bacteria 14561
106 Ga0207651_10013688 3300025960 Bacteria 4653
107 Ga0207658_10115427 3300025986 Unclassified 2131
108 Ga0207658_10116845 3300025986 Unclassified 2119
109 Ga0207639_10015251 3300026041 Bacteria 5416
110 Ga0207639_10030765 3300026041 Bacteria 3939
111 Ga0207641_10025953 3300026088 Bacteria 4834
112 Ga0207648_10005538 3300026089 Bacteria 12716
113 Ga0207648_10037616 3300026089 Bacteria 4264
114 Ga0207676_10127902 3300026095 Bacteria 2155
115 Ga0207675_100019768 3300026118 Bacteria 6287
116 Ga0207683_10003686 3300026121 Bacteria 13312
117 Ga0207698_10016358 3300026142 Bacteria 4996
118 Ga0207698_10110307 3300026142 Bacteria 2304
119 Ga0207698_10213596 3300026142 Bacteria 1737
120 Ga0207698_10357403 3300026142 Bacteria 1382
121 Ga0268266_10079258 3300028379 Unclassified 2859
122 Ga0265323_10032091 3300028653 Unclassified 1950
123 Ga0265323_10044614 3300028653 Bacteria 1596
124 Ga0265330_10003913 3300031235 Bacteria 7660
125 Ga0265316_10021179 3300031344 Bacteria 5515
126 Ga0265316_10042735 3300031344 Bacteria 3620
127 Ga0307509_10242990 3300031507 Bacteria 1591
128 Ga0307508_10000354 3300031616 Bacteria 55733
129 Ga0316576_10065180 3300031727 Bacteria 2677
130 Ga0307516_10151354 3300031730 Bacteria 2080
131 Ga0307405_10071148 3300031731 Bacteria 2237
132 Ga0316577_10004656 3300031733 Bacteria 7115
133 Ga0307414_10016230 3300032004 Bacteria 4522
134 Ga0307414_10017450 3300032004 Bacteria 4392
135 Ga0307414_10047007 3300032004 Bacteria 2967
136 Ga0307414_10190542 3300032004 Bacteria 1659
137 Ga0316583_10000601 3300032133 Bacteria 10934
138 Ga0316584_0004173 3300036712 Bacteria 9540
139 Ga0395900_0211752 3300037418 Bacteria 1957
140 Ga0395900_0302562 3300037418 Unclassified 1585
141 Ga0395898_0009401 3300037466 Bacteria 10267
142 Ga0395905_0005291 3300037471 Bacteria 13198
143 Ga0395905_0016473 3300037471 Bacteria 7026
144 Ga0395905_0038367 3300037471 Bacteria 4495
145 Ga0436364_0592490 3300037853 Bacteria 6608
146 Ga0436365_1747829 3300039437 Bacteria 10905
147 Ga0439449_0003139 3300042007 Bacteria 6428
148 Ga0439449_0022361 3300042007 Bacteria 2368
149 Ga0439457_009160 3300042014 Bacteria 2310
150 Ga0453683_0171745 3300044673 Bacteria 1373
151 Ga0453684_0008748 3300044712 Bacteria 17983
152 Ga0453684_0441239 3300044712 Bacteria 1451
153 Ga0466959_0100993 3300045049 Unclassified 2065
154 Ga0495627_003772 3300046453 Bacteria 6544
155 Ga0495633_0000175 3300046558 Bacteria 83653
156 Ga0495686_0147162 3300047472 Bacteria 1386
157 Ga0496116_0004556 3300048919 Bacteria 13144
158 Ga0496117_0001367 3300048920 Bacteria 35566
159 Ga0496121_0000030 3300048924 Bacteria 412079
160 Ga0496122_0008801 3300048925 Bacteria 10786
161 Ga0496123_0012536 3300048926 Bacteria 7217
162 Ga0501034_0241691 3300049571 Bacteria 1751
163 Ga0501037_0127821 3300049573 Bacteria 1824
164 Ga0501039_0014470 3300049575 Bacteria 6040
165 Ga0501198_007917 3300049649 Bacteria 1535
166 Ga0501225_0006553 3300049705 Bacteria 3400
167 Ga0501241_003684 3300049758 Bacteria 2890
168 Ga0501044_0292819 3300049823 Bacteria 1559
169 nmdc:mga0k408_61095_c1 3300050493 Bacteria 2190
170 Ga0500588_0001534 3300053146 Bacteria 4433
171 Ga0500622_0005392 3300053156 Bacteria 7695
172 Ga0587098_005039 3300059604 Bacteria 1278
173 2722730985 2721755487 Bacteria 6357185
174 2739617733 2739367656 Bacteria 5152243
175 2819573190 2818991442 Bacteria 8318214
176 2821136609 2821136567 Bacteria 8080116
177 2857630674 2857627736 Bacteria 5625397
178 2896321320 2896317667 Bacteria 4606601
179 2896344915 2896344016 Bacteria 3811746
180 2904468646 2904467357 Bacteria 8057758
181 2904783478 2904780799 Bacteria 5840761
182 2910245777 2910245624 Bacteria 6935613
183 2911140476 2911138879 Bacteria 5811561
184 2919181344 2919177583 Bacteria 5641607
185 Ga0395900_0031566
186 JGI24740J21852_10027056
187 rootH2_10124076
188 rootH1_10134555
189 JGI25160J50197_1001238
190 Ga0055531_10000875
191 Ga0065714_10002200
192 Ga0065704_10071274
193 Ga0070658_10161482
194 Ga0070658_10182286
195 Ga0070676_10008945
196 Ga0070683_100014955
197 Ga0070683_100029843
198 Ga0068869_100059454
199 Ga0070682_100151614
200 Ga0070660_100001349
201 Ga0070660_100133578
202 Ga0070689_100167261
203 Ga0070661_100058704
204 Ga0070668_100240815
205 Ga0070675_100093898
206 Ga0070671_100101248
207 Ga0070674_100056169
208 Ga0070673_100005988
209 Ga0070659_100139667
210 Ga0070667_100050184
211 Ga0070667_100105322
212 Ga0070678_100024931
213 Ga0068867_100050676
214 Ga0070679_100002258
215 Ga0070679_100083461
216 Ga0070679_100345557
217 Ga0070684_100022315
218 Ga0068853_100024611
219 Ga0070672_100026793
220 Ga0070664_100004349
221 Ga0068852_100006389
222 Ga0068852_100039703
223 Ga0068852_100245863
224 Ga0068859_100058062
225 Ga0068861_100050017
226 Ga0068863_100035977
227 Ga0068860_100073323
228 Ga0097621_100014046
229 Ga0068865_100125776
230 Ga0097620_100058062
231 Ga0105240_10061789
232 Ga0105243_10000003
233 Ga0105241_10010284
234 Ga0105241_10078043
235 Ga0105241_10079376
236 Ga0105242_10024399
237 Ga0105242_10042271
238 Ga0105237_10017965
239 Ga0105239_10095445
240 Ga0105239_10266833
241 Ga0105246_10144507
242 Ga0157373_10009585
243 Ga0157371_10098992
244 Ga0157370_10002662
245 Ga0157369_10015994
246 Ga0157369_10180964
247 Ga0157374_10070515
248 Ga0157378_10023935
249 Ga0157372_10005797
250 Ga0157372_10013264
251 Ga0157372_10021688
252 Ga0157372_10078083
253 Ga0157372_10128923
254 Ga0157372_10172869
255 Ga0157376_10120311
256 Ga0182006_1000230
257 Ga0182005_1000098
258 Ga0183373_1001
259 Ga0213876_10006255
260 Ga0213875_10009255
261 Ga0209436_104192
262 Ga0207426_1000026
263 Ga0207426_1022902
264 Ga0209257_1000001
265 Ga0207647_10000057
266 Ga0207645_10001767
267 Ga0207654_10005052
268 Ga0207695_10003298
269 Ga0207657_10050388
270 Ga0207657_10100800
271 Ga0207652_10061846
272 Ga0207652_10099365
273 Ga0207650_10045159
274 Ga0207659_10089191
275 Ga0207644_10126655
276 Ga0207690_10010807
277 Ga0207706_10159908
278 Ga0207686_10146762
279 Ga0207709_10000008
280 Ga0207691_10021576
281 Ga0207689_10002619
282 Ga0207689_10009081
283 Ga0207689_10025460
284 Ga0207661_10006773
285 Ga0207661_10077352
286 Ga0207661_10246683
287 Ga0207679_10004046
288 Ga0207679_10045831
289 Ga0207667_10006165
290 Ga0207651_10013688
291 Ga0207658_10115427
292 Ga0207658_10116845
293 Ga0207639_10015251
294 Ga0207639_10030765
295 Ga0207641_10025953
296 Ga0207648_10005538
297 Ga0207648_10037616
298 Ga0207676_10127902
299 Ga0207675_100019768
300 Ga0207683_10003686
301 Ga0207698_10016358
302 Ga0207698_10110307
303 Ga0207698_10213596
304 Ga0207698_10357403
305 Ga0268266_10079258
306 Ga0265323_10032091
307 Ga0265323_10044614
308 Ga0265330_10003913
309 Ga0265316_10021179
310 Ga0265316_10042735
311 Ga0307509_10242990
312 Ga0307508_10000354
313 Ga0316576_10065180
314 Ga0307516_10151354
315 Ga0307405_10071148
316 Ga0316577_10004656
317 Ga0307414_10016230
318 Ga0307414_10017450
319 Ga0307414_10047007
320 Ga0307414_10190542
321 Ga0316583_10000601
322 Ga0316584_0004173
323 Ga0395900_0211752
324 Ga0395900_0302562
325 Ga0395898_0009401
326 Ga0395905_0005291
327 Ga0395905_0016473
328 Ga0395905_0038367
329 Ga0436364_0592490
330 Ga0436365_1747829
331 Ga0439449_0003139
332 Ga0439449_0022361
333 Ga0439457_009160
334 Ga0453683_0171745
335 Ga0453684_0008748
336 Ga0453684_0441239
337 Ga0466959_0100993
338 Ga0495627_003772
339 Ga0495633_0000175
340 Ga0495686_0147162
341 Ga0496116_0004556
342 Ga0496117_0001367
343 Ga0496121_0000030
344 Ga0496122_0008801
345 Ga0496123_0012536
346 Ga0501034_0241691
347 Ga0501037_0127821
348 Ga0501039_0014470
349 Ga0501198_007917
350 Ga0501225_0006553
351 Ga0501241_003684
352 Ga0501044_0292819
353 nmdc:mga0k408_61095_c1
354 Ga0500588_0001534
355 Ga0500622_0005392
356 Ga0587098_005039
357 2722730985
358 2739617733
359 2819573190
360 2821136609
361 2857630674
362 2896321320
363 2896344915
364 2904468646
365 2904783478
366 2910245777
367 2911140476
368 2919181344

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10509

GalKase_gal_bdg

Galactokinase galactose-binding signature

60

108

0.96

PF00288

GHMP_kinases_N

GHMP kinases N terminal domain

142

230

0.94

PF08544

GHMP_kinases_C

GHMP kinases C terminal

329

415

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2dej-assembly1.cif.gz_A crystal structure of galaktokinase from pyrococcus horikoshii with amp-pn and galactose 0.9597 31 392
2dei-assembly1.cif.gz_A crystal structure of galaktokinase from pyrococcus horikoshii with amp-pnp and galactose 0.9595 31 392
1s4e-assembly9.cif.gz_I pyrococcus furiosus galactokinase in complex with galactose, adp and magnesium 0.9583 30 392
1s4e-assembly4.cif.gz_D pyrococcus furiosus galactokinase in complex with galactose, adp and magnesium 0.9567 30 392
1s4e-assembly8.cif.gz_H pyrococcus furiosus galactokinase in complex with galactose, adp and magnesium 0.956 30 390
ID Description Score Start End Superfamily
af_P9WN63_1_186_3.30.230.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.9593 30 211 3.30.230.10
1s4eE01 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.9564 31 207 3.30.230.10
1pieA01 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.9483 28 207 3.30.230.10
1s4eE01 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.9457 31 207 3.30.230.10
af_P9WN63_1_186_3.30.230.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.9343 30 211 3.30.230.10
ID Description Score Start End GO Terms
AF-A0A4Q5WIG5-F1-model_v4 Galactokinase (EC 2.7.1.6) 0.9864 101 394 GO:0004335
GO:0005524
GO:0005829
GO:0006012
AF-A0A6V8NW77-F1-model_v4 Galactokinase 0.9858 30 183 GO:0004335
GO:0005524
GO:0005829
GO:0006012
AF-A0A4Q6BE21-F1-model_v4 Galactokinase 0.9849 130 335 GO:0004335
GO:0005524
GO:0005829
GO:0006012
AF-A0A7X9KQ30-F1-model_v4 Galactokinase 0.9826 252 392 GO:0004335
GO:0005524
GO:0005829
GO:0006012
AF-A0A7X8RQ76-F1-model_v4 Galactokinase (EC 2.7.1.6) 0.98 34 319 GO:0004335
GO:0005524
GO:0005829
GO:0006012

Map