F282951

General Info

Members Datasets Scaffolds Average Seq Length
184 138 181 330

Family's Representative Sequence

Representative Sequence 3300039110|Ga0400487_26101|Ga0400487_26101_510_1640
Length 376
Sequence MVAAVHVSVADWGGHIPGEGNVRQKKRTGGLTAMANFDRSDRRWVTMPMLFCFMLLFSIPFWIKTVGLYQYLGVEILIWMIYALGFNLLLGYTGLPSFGHGAYFGIGAYAFGLVQHHLVVNVWLGLVGSVLAAAITAGLVALFISHRRGIYFALMTIAFGQVFWFIAIKWHGVTGGEDGLLNIPRPDVLVFSLKSNTALFYFTFLFFCIVVIGLWRLIHSPFGKIIKAIKQNEIRAGFIGYNVRLYKFLVFVISASIAGLAGGLFSMAQESAYPDVMSLHVSGYVVMMTLIGGGFVSFWGPVLGTAVFFLARDILGAITPTWLLWYGLMFMAIVMFKPEGIAGILQDIMARKAKSNASNVAPAAIKEVPHGRSASL

Samples

Sample ID Description Type Environment
1 2738543012 Acidovorax sp. CF301 Isolate Unclassified
2 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
6 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
11 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
12 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
13 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
14 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
15 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
18 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
19 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
20 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
21 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
22 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
23 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
24 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
25 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
26 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
28 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
29 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
30 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
31 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
32 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
33 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
36 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
38 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
39 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
40 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
41 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
42 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
43 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
44 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
64 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
65 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
66 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
67 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
68 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
69 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
70 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
71 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
72 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
73 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
74 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
75 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
76 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
77 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
78 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
79 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
80 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
81 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
82 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
83 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
84 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
85 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
86 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
87 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
88 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
89 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
90 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
91 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
92 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
93 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
94 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
95 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
96 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
97 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
98 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
99 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
100 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
101 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
102 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
106 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
107 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
108 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
109 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
110 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
111 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
112 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
113 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
114 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
115 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
116 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
117 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
118 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
119 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
120 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
121 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
122 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
123 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
124 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
125 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
126 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
127 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
128 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
129 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
130 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
131 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
132 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
133 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
134 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
135 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
136 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
137 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
138 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.37
Metatranscriptomes 0
Isolates 1.63

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.04
Nodule 0
Rhizoplane 0
Rhizosphere 77.17
Stem 0
Stem Tuber 0
Unclassified 9.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10017615 3300003323 Bacteria 1353
2 rootH1_10080484 3300003323 Bacteria 2864
3 Ga0068869_100062103 3300005334 Bacteria 2741
4 Ga0070668_100015534 3300005347 Bacteria 5692
5 Ga0070668_100039079 3300005347 Bacteria 3630
6 Ga0070668_100060357 3300005347 Bacteria 2936
7 Ga0070668_100205804 3300005347 Bacteria 1617
8 Ga0070669_100034514 3300005353 Bacteria 3662
9 Ga0070675_100051513 3300005354 Bacteria 3383
10 Ga0070675_100194917 3300005354 Bacteria 1757
11 Ga0070674_100015653 3300005356 Bacteria 4741
12 Ga0070667_100196350 3300005367 Bacteria 1789
13 Ga0070705_100011760 3300005440 Bacteria 4428
14 Ga0070700_100042112 3300005441 Bacteria 2802
15 Ga0070662_100333167 3300005457 Bacteria 1240
16 Ga0070699_100104591 3300005518 Bacteria 2483
17 Ga0070699_100325586 3300005518 Bacteria 1382
18 Ga0070697_100143211 3300005536 Bacteria 2011
19 Ga0070704_100198296 3300005549 Bacteria 1619
20 Ga0068855_100050764 3300005563 Bacteria 4887
21 Ga0070664_100012425 3300005564 Bacteria 6920
22 Ga0068859_100054449 3300005617 Bacteria 4024
23 Ga0068851_10071500 3300005834 Bacteria 1795
24 Ga0068858_100092973 3300005842 Bacteria 2807
25 Ga0068860_100143343 3300005843 Bacteria 2297
26 Ga0068860_100149727 3300005843 Bacteria 2247
27 Ga0081455_10036575 3300005937 Bacteria 4369
28 Ga0075365_10249931 3300006038 Bacteria 1246
29 Ga0075369_10022341 3300006186 Bacteria 2608
30 Ga0075366_10010044 3300006195 Bacteria 5305
31 Ga0075366_10031393 3300006195 Bacteria 3126
32 Ga0097621_100016730 3300006237 Bacteria 5554
33 Ga0097621_100230490 3300006237 Bacteria 1617
34 Ga0068871_100028485 3300006358 Bacteria 4378
35 Ga0075428_100002053 3300006844 Bacteria 21717
36 Ga0075428_100019480 3300006844 Bacteria 7509
37 Ga0075428_100484576 3300006844 Bacteria 1324
38 Ga0075430_100042207 3300006846 Bacteria 3857
39 Ga0075430_100215869 3300006846 Bacteria 1592
40 Ga0075431_100000249 3300006847 Bacteria 40919
41 Ga0075431_100047873 3300006847 Bacteria 4409
42 Ga0075429_100009814 3300006880 Bacteria 8301
43 Ga0068865_100031187 3300006881 Bacteria 3552
44 Ga0097620_100054448 3300006931 Bacteria 4024
45 Ga0111539_10002707 3300009094 Bacteria 23504
46 Ga0111539_10004781 3300009094 Bacteria 17673
47 Ga0105247_10011217 3300009101 Bacteria 5404
48 Ga0114129_10000242 3300009147 Bacteria 61249
49 Ga0114129_10316047 3300009147 Bacteria 2077
50 Ga0105243_10212421 3300009148 Bacteria 1704
51 Ga0105242_10090714 3300009176 Bacteria 2571
52 Ga0105249_10195448 3300009553 Bacteria 1977
53 Ga0157378_10021422 3300013297 Bacteria 5684
54 Ga0163162_10419938 3300013306 Bacteria 1470
55 Ga0157376_10004106 3300014969 Bacteria 10081
56 Ga0209758_1003227 3300025297 Bacteria 15167
57 Ga0207697_10022029 3300025315 Bacteria 2611
58 Ga0207645_10130063 3300025907 Bacteria 1638
59 Ga0207659_10153939 3300025926 Bacteria 1798
60 Ga0207706_10035698 3300025933 Bacteria 4419
61 Ga0207686_10184449 3300025934 Bacteria 1482
62 Ga0207709_10223616 3300025935 Bacteria 1359
63 Ga0207691_10079360 3300025940 Bacteria 2954
64 Ga0207689_10004867 3300025942 Bacteria 12104
65 Ga0207679_10023063 3300025945 Bacteria 4249
66 Ga0207667_10261762 3300025949 Bacteria 1768
67 Ga0207668_10026810 3300025972 Bacteria 3747
68 Ga0207668_10045219 3300025972 Bacteria 3001
69 Ga0207658_10119544 3300025986 Bacteria 2098
70 Ga0207678_10345072 3300026067 Bacteria 1283
71 Ga0207708_10029174 3300026075 Bacteria 4180
72 Ga0207648_10029313 3300026089 Bacteria 4881
73 Ga0207648_10076458 3300026089 Bacteria 2918
74 Ga0207674_10363000 3300026116 Bacteria 1400
75 Ga0207675_100013332 3300026118 Bacteria 7670
76 Ga0207675_100062085 3300026118 Bacteria 3489
77 Ga0207675_100062764 3300026118 Bacteria 3471
78 Ga0207675_100077680 3300026118 Bacteria 3110
79 Ga0207683_10004270 3300026121 Bacteria 12335
80 Ga0207683_10024079 3300026121 Bacteria 5239
81 Ga0207698_10232371 3300026142 Bacteria 1675
82 Ga0207428_10011441 3300027907 Bacteria 7842
83 Ga0207428_10015385 3300027907 Bacteria 6618
84 Ga0307515_10151935 3300028794 Bacteria 2415
85 Ga0307513_10000219 3300031456 Bacteria 82663
86 Ga0307408_100096542 3300031548 Bacteria 2243
87 Ga0307516_10027890 3300031730 Bacteria 5720
88 Ga0307516_10232834 3300031730 Bacteria 1545
89 Ga0307405_10010757 3300031731 Bacteria 4757
90 Ga0307413_10002653 3300031824 Bacteria 7325
91 Ga0307410_10002687 3300031852 Bacteria 8680
92 Ga0307410_10044227 3300031852 Bacteria 2957
93 Ga0307406_10003314 3300031901 Bacteria 8781
94 Ga0307407_10003272 3300031903 Bacteria 6602
95 Ga0307412_10006167 3300031911 Bacteria 6756
96 Ga0307409_100007159 3300031995 Bacteria 6645
97 Ga0307416_100198664 3300032002 Bacteria 1900
98 Ga0307411_10007248 3300032005 Bacteria 5627
99 Ga0307411_10014150 3300032005 Bacteria 4431
100 Ga0307411_10134746 3300032005 Bacteria 1811
101 Ga0307415_100010383 3300032126 Bacteria 5272
102 Ga0307510_10146449 3300033180 Bacteria 1992
103 Ga0395900_0155355 3300037418 Bacteria 2337
104 Ga0395898_0041730 3300037466 Bacteria 4530
105 Ga0395901_0027533 3300038443 Bacteria 5841
106 Ga0400490_42198 3300038726 Unclassified 1731
107 Ga0400483_039257 3300039062 Bacteria 1470
108 Ga0400487_26101 3300039110 Bacteria 2235
109 Ga0439453_0044401 3300041408 Bacteria 881
110 Ga0439431_0013024 3300041997 Bacteria 1916
111 Ga0450912_000291 3300042116 Bacteria 2274
112 Ga0439459_0004055 3300042438 Bacteria 2344
113 Ga0439460_0034251 3300042461 Bacteria 1463
114 Ga0495638_0000537 3300046460 Bacteria 43749
115 Ga0495638_0018681 3300046460 Bacteria 4600
116 Ga0495594_0077385 3300046499 Bacteria 1856
117 Ga0495606_0122243 3300046507 Bacteria 1557
118 Ga0495616_0039245 3300046513 Bacteria 2426
119 Ga0495654_0093964 3300046530 Bacteria 1388
120 Ga0495621_0037053 3300046539 Bacteria 1695
121 Ga0495625_0081054 3300046660 Bacteria 2259
122 Ga0496117_0045931 3300048920 Bacteria 3148
123 Ga0496117_0064704 3300048920 Bacteria 2491
124 Ga0496121_0003836 3300048924 Bacteria 20915
125 Ga0496121_0010172 3300048924 Bacteria 10651
126 Ga0496125_0003580 3300048928 Bacteria 18698
127 Ga0501036_0165208 3300049572 Bacteria 1866
128 Ga0501039_0150609 3300049575 Bacteria 1828
129 Ga0501039_0183912 3300049575 Bacteria 1643
130 Ga0501040_0121426 3300049576 Bacteria 1833
131 Ga0501040_0123082 3300049576 Bacteria 1821
132 Ga0501041_0154055 3300049577 Bacteria 1436
133 Ga0501042_0129439 3300049578 Bacteria 1819
134 Ga0501067_0100715 3300049583 Bacteria 1605
135 Ga0501072_0071011 3300049588 Bacteria 2751
136 Ga0501072_0082136 3300049588 Bacteria 2555
137 Ga0501072_0211056 3300049588 Bacteria 1547
138 Ga0501075_0025919 3300049591 Bacteria 4310
139 Ga0501075_0035016 3300049591 Bacteria 3743
140 Ga0501076_0094926 3300049592 Bacteria 2402
141 Ga0501077_0155733 3300049593 Bacteria 1450
142 Ga0501222_016089 3300049662 Bacteria 989
143 Ga0501079_0054400 3300049741 Bacteria 3087
144 Ga0501079_0088407 3300049741 Bacteria 2399
145 Ga0501081_0058280 3300049743 Bacteria 2672
146 Ga0501081_0079113 3300049743 Bacteria 2299
147 Ga0501081_0114989 3300049743 Bacteria 1912
148 Ga0501045_0033502 3300049824 Bacteria 3725
149 nmdc:mga03683_28694_c1 3300050489 Bacteria 2214
150 nmdc:mga03683_51648_c1 3300050489 Bacteria 1717
151 nmdc:mga0k408_25775_c1 3300050493 Bacteria 3331
152 nmdc:mga06z11_12544_c1 3300050494 Bacteria 3689
153 nmdc:mga04h51_72529_c1 3300050495 Bacteria 1205
154 nmdc:mga05p37_3058_c1 3300050507 Bacteria 19432
155 nmdc:mga09592_17635_c1 3300050508 Bacteria 5851
156 nmdc:mga09592_30588_c1 3300050508 Bacteria 4481
157 nmdc:mga0qj67_192407_c1 3300050509 Bacteria 1658
158 nmdc:mga06r32_1131_c1 3300050510 Bacteria 23923
159 nmdc:mga06r32_26198_c1 3300050510 Bacteria 5433
160 nmdc:mga08y16_125_c1 3300050511 Bacteria 66606
161 nmdc:mga08y16_22590_c1 3300050511 Bacteria 6642
162 nmdc:mga08y16_249762_c1 3300050511 Bacteria 1833
163 nmdc:mga0sz30_127776_c1 3300050516 Bacteria 1119
164 Ga0500651_0043043 3300053093 Bacteria 2844
165 Ga0500569_019456 3300053109 Bacteria 1767
166 Ga0500592_000863 3300053116 Bacteria 4937
167 Ga0500593_000120 3300053117 Bacteria 30583
168 Ga0500594_0005571 3300053118 Bacteria 2794
169 Ga0500642_0000005 3300053130 Bacteria 422725
170 Ga0500642_0068147 3300053130 Bacteria 1614
171 Ga0500658_0006300 3300053134 Bacteria 4406
172 Ga0500559_0000085 3300053136 Bacteria 73850
173 Ga0500577_0010720 3300053142 Bacteria 2710
174 Ga0500622_0000801 3300053156 Bacteria 27022
175 Ga0500622_0018033 3300053156 Bacteria 3753
176 Ga0500587_002493 3300053739 Bacteria 2616
177 Ga0501084_0023221 3300054114 Bacteria 5178
178 Ga0501082_0290203 3300060353 Bacteria 1424
179 Ga0501082_0368636 3300060353 Bacteria 1253
180 Ga0530510_0057250 3300061734 Bacteria 2816
181 Ga0530510_0128140 3300061734 Bacteria 1866

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026118 Ga0207675_100077680 Ga0207675_1000776803 262
2 3300006195 Ga0075366_10031393 Ga0075366_100313932 271
3 3300038726 Ga0400490_42198 Ga0400490_42198_32_1081 271
4 3300050493 nmdc:mga0k408_25775_c1 nmdc:mga0k408_25775_c1_1165_2100 271
5 3300041408 Ga0439453_0044401 Ga0439453_0044401_10_870 274
6 3300049662 Ga0501222_016089 Ga0501222_016089_101_970 277
7 3300046460 Ga0495638_0018681 Ga0495638_0018681_3684_4583 279
8 3300049583 Ga0501067_0100715 Ga0501067_0100715_544_1512 288
9 3300025907 Ga0207645_10130063 Ga0207645_101300631 289
10 3300050516 nmdc:mga0sz30_127776_c1 nmdc:mga0sz30_127776_c1_105_1094 290
11 3300009148 Ga0105243_10212421 Ga0105243_102124211 295
12 3300025940 Ga0207691_10079360 Ga0207691_100793603 295
13 3300060353 Ga0501082_0290203 Ga0501082_0290203_10_966 298
14 3300042438 Ga0439459_0004055 Ga0439459_0004055_1363_2328 299
15 3300031548 Ga0307408_100096542 Ga0307408_1000965423 301
16 3300005457 Ga0070662_100333167 Ga0070662_1003331671 302
17 3300006844 Ga0075428_100484576 Ga0075428_1004845762 302
18 3300005347 Ga0070668_100039079 Ga0070668_1000390793 303
19 3300006846 Ga0075430_100215869 Ga0075430_1002158691 303
20 3300025972 Ga0207668_10026810 Ga0207668_100268103 303
21 3300005347 Ga0070668_100060357 Ga0070668_1000603572 304
22 3300005354 Ga0070675_100194917 Ga0070675_1001949171 304
23 3300005367 Ga0070667_100196350 Ga0070667_1001963502 304
24 3300005834 Ga0068851_10071500 Ga0068851_100715002 304
25 3300006186 Ga0075369_10022341 Ga0075369_100223412 304
26 3300025926 Ga0207659_10153939 Ga0207659_101539391 304
27 3300025986 Ga0207658_10119544 Ga0207658_101195442 304
28 3300026089 Ga0207648_10076458 Ga0207648_100764583 304
29 3300026142 Ga0207698_10232371 Ga0207698_102323712 304
30 3300053109 Ga0500569_019456 Ga0500569_019456_35_1009 304
31 3300005518 Ga0070699_100325586 Ga0070699_1003255862 305
32 3300009094 Ga0111539_10002707 Ga0111539_1000270711 305
33 3300050511 nmdc:mga08y16_22590_c1 nmdc:mga08y16_22590_c1_2654_3622 305
34 3300005347 Ga0070668_100205804 Ga0070668_1002058042 307
35 3300005354 Ga0070675_100051513 Ga0070675_1000515134 307
36 3300006038 Ga0075365_10249931 Ga0075365_102499312 307
37 3300013306 Ga0163162_10419938 Ga0163162_104199381 307
38 3300025972 Ga0207668_10045219 Ga0207668_100452192 307
39 3300026067 Ga0207678_10345072 Ga0207678_103450721 307
40 3300026089 Ga0207648_10029313 Ga0207648_100293134 307
41 3300026121 Ga0207683_10024079 Ga0207683_100240792 307
42 3300031731 Ga0307405_10010757 Ga0307405_100107573 307
43 3300031824 Ga0307413_10002653 Ga0307413_100026534 307
44 3300031852 Ga0307410_10002687 Ga0307410_100026878 307
45 3300031901 Ga0307406_10003314 Ga0307406_100033147 307
46 3300031903 Ga0307407_10003272 Ga0307407_100032725 307
47 3300031911 Ga0307412_10006167 Ga0307412_100061675 307
48 3300031995 Ga0307409_100007159 Ga0307409_1000071596 307
49 3300032005 Ga0307411_10007248 Ga0307411_100072484 307
50 3300032126 Ga0307415_100010383 Ga0307415_1000103833 307
51 3300050489 nmdc:mga03683_28694_c1 nmdc:mga03683_28694_c1_965_1948 307
52 3300050489 nmdc:mga03683_51648_c1 nmdc:mga03683_51648_c1_651_1634 307
53 3300053117 Ga0500593_000120 Ga0500593_000120_18717_19709 307
54 3300005440 Ga0070705_100011760 Ga0070705_1000117602 308
55 3300005549 Ga0070704_100198296 Ga0070704_1001982962 308
56 3300031730 Ga0307516_10027890 Ga0307516_100278904 308
57 3300049575 Ga0501039_0183912 Ga0501039_0183912_372_1373 308
58 3300049588 Ga0501072_0071011 Ga0501072_0071011_1033_2034 308
59 3300049743 Ga0501081_0079113 Ga0501081_0079113_692_1693 308
60 3300053130 Ga0500642_0068147 Ga0500642_0068147_461_1483 308
61 3300054114 Ga0501084_0023221 Ga0501084_0023221_997_1998 308
62 3300061734 Ga0530510_0128140 Ga0530510_0128140_449_1450 308
63 3300005536 Ga0070697_100143211 Ga0070697_1001432113 310
64 3300005563 Ga0068855_100050764 Ga0068855_1000507642 310
65 3300005617 Ga0068859_100054449 Ga0068859_1000544494 310
66 3300006931 Ga0097620_100054448 Ga0097620_1000544484 310
67 3300025297 Ga0209758_1003227 Ga0209758_10032275 310
68 3300025949 Ga0207667_10261762 Ga0207667_102617622 310
69 3300031456 Ga0307513_10000219 Ga0307513_1000021958 310
70 3300042116 Ga0450912_000291 Ga0450912_000291_1054_2073 310
71 3300032005 Ga0307411_10134746 Ga0307411_101347462 311
72 3300046513 Ga0495616_0039245 Ga0495616_0039245_374_1387 311
73 3300046530 Ga0495654_0093964 Ga0495654_0093964_138_1151 311
74 3300046539 Ga0495621_0037053 Ga0495621_0037053_71_1117 311
75 3300046660 Ga0495625_0081054 Ga0495625_0081054_267_1280 311
76 3300053116 Ga0500592_000863 Ga0500592_000863_2599_3612 311
77 3300053118 Ga0500594_0005571 Ga0500594_0005571_1585_2598 311
78 3300053130 Ga0500642_0000005 Ga0500642_0000005_300883_301896 311
79 3300053134 Ga0500658_0006300 Ga0500658_0006300_1411_2424 311
80 3300053136 Ga0500559_0000085 Ga0500559_0000085_47336_48331 311
81 3300053142 Ga0500577_0010720 Ga0500577_0010720_1403_2416 311
82 3300053156 Ga0500622_0000801 Ga0500622_0000801_10165_11178 311
83 3300031852 Ga0307410_10044227 Ga0307410_100442272 313
84 3300032005 Ga0307411_10014150 Ga0307411_100141503 313
85 3300041997 Ga0439431_0013024 Ga0439431_0013024_656_1681 313
86 3300049572 Ga0501036_0165208 Ga0501036_0165208_592_1593 313
87 3300049576 Ga0501040_0123082 Ga0501040_0123082_526_1527 313
88 3300049578 Ga0501042_0129439 Ga0501042_0129439_584_1585 313
89 3300049591 Ga0501075_0035016 Ga0501075_0035016_973_1974 313
90 3300049741 Ga0501079_0088407 Ga0501079_0088407_488_1489 313
91 iso_pu_bacteria 2919073203 2919077434 313
92 3300006195 Ga0075366_10010044 Ga0075366_100100446 314
93 3300006237 Ga0097621_100230490 Ga0097621_1002304902 314
94 3300009176 Ga0105242_10090714 Ga0105242_100907143 314
95 3300027907 Ga0207428_10015385 Ga0207428_100153855 314
96 iso_pu_bacteria 8054563764 8054567311 314
97 3300005564 Ga0070664_100012425 Ga0070664_1000124254 315
98 3300025945 Ga0207679_10023063 Ga0207679_100230633 315
99 3300048920 Ga0496117_0045931 Ga0496117_0045931_625_1632 315
100 3300048924 Ga0496121_0010172 Ga0496121_0010172_3696_4703 315
101 3300049741 Ga0501079_0054400 Ga0501079_0054400_1834_2850 315
102 3300050494 nmdc:mga06z11_12544_c1 nmdc:mga06z11_12544_c1_68_1075 315
103 3300049588 Ga0501072_0211056 Ga0501072_0211056_131_1141 316
104 3300061734 Ga0530510_0057250 Ga0530510_0057250_1115_2125 316
105 3300006844 Ga0075428_100019480 Ga0075428_1000194803 317
106 3300006847 Ga0075431_100047873 Ga0075431_1000478736 317
107 3300032002 Ga0307416_100198664 Ga0307416_1001986642 317
108 3300046460 Ga0495638_0000537 Ga0495638_0000537_35702_36715 317
109 3300046507 Ga0495606_0122243 Ga0495606_0122243_347_1360 317
110 3300048920 Ga0496117_0064704 Ga0496117_0064704_737_1750 317
111 3300048924 Ga0496121_0003836 Ga0496121_0003836_4664_5677 317
112 3300048928 Ga0496125_0003580 Ga0496125_0003580_15969_16982 317
113 3300049575 Ga0501039_0150609 Ga0501039_0150609_55_1068 317
114 3300049577 Ga0501041_0154055 Ga0501041_0154055_396_1409 317
115 3300049743 Ga0501081_0114989 Ga0501081_0114989_213_1226 317
116 3300050495 nmdc:mga04h51_72529_c1 nmdc:mga04h51_72529_c1_154_1167 317
117 3300050508 nmdc:mga09592_30588_c1 nmdc:mga09592_30588_c1_1370_2386 317
118 3300050509 nmdc:mga0qj67_192407_c1 nmdc:mga0qj67_192407_c1_542_1558 317
119 3300050510 nmdc:mga06r32_26198_c1 nmdc:mga06r32_26198_c1_514_1527 317
120 3300050511 nmdc:mga08y16_249762_c1 nmdc:mga08y16_249762_c1_262_1281 317
121 3300005334 Ga0068869_100062103 Ga0068869_1000621032 318
122 3300005353 Ga0070669_100034514 Ga0070669_1000345142 318
123 3300005356 Ga0070674_100015653 Ga0070674_1000156533 318
124 3300005441 Ga0070700_100042112 Ga0070700_1000421122 318
125 3300005842 Ga0068858_100092973 Ga0068858_1000929732 318
126 3300005843 Ga0068860_100143343 Ga0068860_1001433432 318
127 3300006237 Ga0097621_100016730 Ga0097621_1000167305 318
128 3300006358 Ga0068871_100028485 Ga0068871_1000284854 318
129 3300006881 Ga0068865_100031187 Ga0068865_1000311873 318
130 3300009553 Ga0105249_10195448 Ga0105249_101954482 318
131 3300013297 Ga0157378_10021422 Ga0157378_100214225 318
132 3300014969 Ga0157376_10004106 Ga0157376_100041066 318
133 3300025933 Ga0207706_10035698 Ga0207706_100356983 318
134 3300025934 Ga0207686_10184449 Ga0207686_101844491 318
135 3300025935 Ga0207709_10223616 Ga0207709_102236161 318
136 3300025942 Ga0207689_10004867 Ga0207689_100048679 318
137 3300026075 Ga0207708_10029174 Ga0207708_100291743 318
138 3300026118 Ga0207675_100062085 Ga0207675_1000620852 318
139 3300026118 Ga0207675_100062764 Ga0207675_1000627642 318
140 3300026121 Ga0207683_10004270 Ga0207683_100042709 318
141 3300039062 Ga0400483_039257 Ga0400483_039257_107_1117 318
142 3300049588 Ga0501072_0082136 Ga0501072_0082136_132_1148 318
143 iso_pu_bacteria 2738543012 2739244078 318
144 3300009147 Ga0114129_10316047 Ga0114129_103160472 319
145 3300046499 Ga0495594_0077385 Ga0495594_0077385_601_1620 319
146 3300060353 Ga0501082_0368636 Ga0501082_0368636_70_1092 320
147 3300005843 Ga0068860_100149727 Ga0068860_1001497273 321
148 3300031730 Ga0307516_10232834 Ga0307516_102328342 321
149 3300033180 Ga0307510_10146449 Ga0307510_101464492 321
150 3300053093 Ga0500651_0043043 Ga0500651_0043043_230_1255 321
151 3300053156 Ga0500622_0018033 Ga0500622_0018033_331_1356 321
152 3300053739 Ga0500587_002493 Ga0500587_002493_547_1572 321
153 3300026116 Ga0207674_10363000 Ga0207674_103630002 322
154 3300028794 Ga0307515_10151935 Ga0307515_101519353 322
155 3300006846 Ga0075430_100042207 Ga0075430_1000422074 323
156 3300039110 Ga0400487_26101 Ga0400487_26101_510_1640 323
157 3300049576 Ga0501040_0121426 Ga0501040_0121426_500_1531 323
158 3300049591 Ga0501075_0025919 Ga0501075_0025919_2245_3276 323
159 3300049592 Ga0501076_0094926 Ga0501076_0094926_579_1610 323
160 3300049593 Ga0501077_0155733 Ga0501077_0155733_29_1060 323
161 3300049743 Ga0501081_0058280 Ga0501081_0058280_740_1771 323
162 3300049824 Ga0501045_0033502 Ga0501045_0033502_1048_2079 323
163 3300005518 Ga0070699_100104591 Ga0070699_1001045913 324
164 3300005937 Ga0081455_10036575 Ga0081455_100365754 324
165 3300006844 Ga0075428_100002053 Ga0075428_10000205311 324
166 3300006847 Ga0075431_100000249 Ga0075431_1000002499 324
167 3300006880 Ga0075429_100009814 Ga0075429_1000098145 324
168 3300009094 Ga0111539_10004781 Ga0111539_100047815 324
169 3300009147 Ga0114129_10000242 Ga0114129_1000024211 324
170 3300025315 Ga0207697_10022029 Ga0207697_100220292 324
171 3300027907 Ga0207428_10011441 Ga0207428_100114415 324
172 3300037418 Ga0395900_0155355 Ga0395900_0155355_652_1692 324
173 3300037466 Ga0395898_0041730 Ga0395898_0041730_2866_3906 324
174 3300038443 Ga0395901_0027533 Ga0395901_0027533_2834_3874 324
175 3300050507 nmdc:mga05p37_3058_c1 nmdc:mga05p37_3058_c1_16840_17880 324
176 3300050508 nmdc:mga09592_17635_c1 nmdc:mga09592_17635_c1_1867_2907 324
177 3300050510 nmdc:mga06r32_1131_c1 nmdc:mga06r32_1131_c1_11092_12132 324
178 3300050511 nmdc:mga08y16_125_c1 nmdc:mga08y16_125_c1_4565_5605 324
179 3300042461 Ga0439460_0034251 Ga0439460_0034251_55_1131 332
180 3300009101 Ga0105247_10011217 Ga0105247_100112173 333
181 3300003323 rootH1_10080484 rootH1_100804841 334
182 3300005347 Ga0070668_100015534 Ga0070668_1000155345 334
183 3300026118 Ga0207675_100013332 Ga0207675_1000133323 334
184 3300003323 rootH1_10017615 rootH1_100176152 337

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02653

BPD_transp_2

Branched-chain amino acid transport system / permease component

69

337

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4g1u-assembly1.cif.gz_B x-ray structure of the bacterial heme transporter hmuuv from yersinia pestis 0.5536 26 316
7lb8-assembly1.cif.gz_B structure of a ferrichrome importer fhucdb from e. coli 0.5421 25 283
4g1u-assembly1.cif.gz_B x-ray structure of the bacterial heme transporter hmuuv from yersinia pestis 0.5353 26 316
1l7v-assembly1.cif.gz_B bacterial abc transporter involved in b12 uptake 0.5049 25 297
2nq2-assembly1.cif.gz_B an inward-facing conformation of a putative metal-chelate type abc transporter. 0.4999 25 298
ID Description Score Start End Superfamily
af_Q58666_4_320_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7972 47 297 1.10.3470.10
af_P39328_55_321_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7684 51 294 1.10.3470.10
af_P0AE26_50_315_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7526 47 295 1.10.3470.10
af_Q58665_14_295_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7445 51 296 1.10.3470.10
af_P0AGI1_45_314_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7445 51 297 1.10.3470.10
ID Description Score Start End GO Terms
AF-A0A3N5KBG7-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9204 27 318 GO:0005886
GO:0015658
AF-A0A1I4MFU5-F1-model_v4 Amino acid/amide ABC transporter membrane protein 2, HAAT family 0.9111 14 316 GO:0005886
GO:0015658
AF-A0A1Q2Z154-F1-model_v4 Leucineisoleucinevaline transporter permease subunit 0.908 57 317 GO:0005886
GO:0015658
AF-A0A537LRX3-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9048 53 316 GO:0005886
GO:0015658
AF-A0A212JA85-F1-model_v4 Putative Inner-membrane translocator 0.9028 23 312 GO:0005886
GO:0015658

Feature Viewer

pLDDT pTM Quality
75.47 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map