F283129

General Info

Members Datasets Scaffolds Average Seq Length
184 111 368 296

Family's Representative Sequence

Representative Sequence 3300046512|Ga0495610_0001614|Ga0495610_0001614_12300_13211
Length 303
Sequence MNIDLEIFSPVQQISSPLFDSHGVKVFIKRDDLIHPMISGNKWRKLKYVLKRAQNQWKTHLVTFGGAYSNHLMATAAAAAKFGFKSTGIVRGEEVDNDTLFLCSLHGMKLQFTDRDSYRDKPSLFNQYFGNDDQAFFIDEGGASAEGAKGCSELVDELTEAYDHIFCACGTGTTAAGIINGLKKHQLETKFNAVPVFKNGGFIKEEIDRFLTAPTDYNTYTDYHFGGYGKANNELIGFIKQFVAATGILIEPVYTGKMMYALYDLIAKGHFEPGSRILAIHSGGIWGLLGMKEKFKIALINQH

Samples

Sample ID Description Type Environment
1 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
29 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
31 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
34 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
35 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
36 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
37 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
38 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
39 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
40 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
44 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
45 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
46 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
47 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
48 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
49 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
50 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
51 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
52 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
53 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
54 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
75 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
76 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
77 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
78 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
79 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
80 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
81 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
82 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
83 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
84 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
85 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
86 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
87 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
88 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
89 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
90 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
91 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
92 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
93 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
94 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
95 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
96 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
97 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
98 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
99 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
100 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
101 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
102 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
103 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
104 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
105 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
106 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
107 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
108 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
109 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
110 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
111 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.2
Metatranscriptomes 0
Isolates 3.8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.89
Nodule 0
Rhizoplane 0.54
Rhizosphere 88.59
Stem 0
Stem Tuber 0
Unclassified 1.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495610_0001614 3300046512 Bacteria 19820
2 JGI24736J21556_1001913 3300001904 Bacteria 3708
3 JGI24739J22299_10061439 3300001989 Bacteria 1187
4 JGI24737J22298_10005248 3300001990 Bacteria 4485
5 JGI24735J21928_10000016 3300002067 Bacteria 157028
6 JGI24735J21928_10024966 3300002067 Bacteria 1805
7 JGI24744J21845_10004936 3300002077 Bacteria 2763
8 rootH1_10035699 3300003316 Bacteria 12157
9 rootH2_10075043 3300003320 Bacteria 30977
10 rootL2_10021022 3300003322 Bacteria 5135
11 rootL2_10246660 3300003322 Bacteria 1741
12 rootH1_10164539 3300003323 Bacteria 6508
13 rootH1_10231771 3300003323 Bacteria 2165
14 Ga0070676_10000004 3300005328 Bacteria 82919
15 Ga0068868_100006477 3300005338 Bacteria 8287
16 Ga0070660_100018191 3300005339 Bacteria 5131
17 Ga0070671_100025577 3300005355 Bacteria 4845
18 Ga0070674_100043013 3300005356 Bacteria 3071
19 Ga0070659_100047332 3300005366 Bacteria 3373
20 Ga0070678_100083234 3300005456 Bacteria 2432
21 Ga0070662_100000029 3300005457 Bacteria 82498
22 Ga0070662_100120910 3300005457 Bacteria 2007
23 Ga0068867_100006571 3300005459 Bacteria 8215
24 Ga0070679_100574089 3300005530 Bacteria 1071
25 Ga0070684_100016545 3300005535 Bacteria 6030
26 Ga0068853_100143984 3300005539 Bacteria 2141
27 Ga0070665_100000032 3300005548 Bacteria 333352
28 Ga0068855_100000226 3300005563 Bacteria 72130
29 Ga0068855_100000658 3300005563 Bacteria 42234
30 Ga0068855_100047274 3300005563 Bacteria 5085
31 Ga0068855_100189354 3300005563 Bacteria 2322
32 Ga0068855_100218416 3300005563 Bacteria 2139
33 Ga0068856_100000005 3300005614 Bacteria 225505
34 Ga0068856_100000424 3300005614 Bacteria 46509
35 Ga0068852_100000244 3300005616 Bacteria 37013
36 Ga0068852_100539222 3300005616 Bacteria 1166
37 Ga0068858_100056866 3300005842 Unclassified 3615
38 Ga0075366_10001766 3300006195 Bacteria 10903
39 Ga0097621_100001022 3300006237 Bacteria 19710
40 Ga0068871_100000021 3300006358 Bacteria 83155
41 Ga0068865_100000045 3300006881 Bacteria 70227
42 Ga0105240_10000010 3300009093 Bacteria 537830
43 Ga0105240_10024830 3300009093 Bacteria 7890
44 Ga0105240_10054997 3300009093 Bacteria 4985
45 Ga0105240_10211160 3300009093 Bacteria 2268
46 Ga0105240_10350872 3300009093 Bacteria 1674
47 Ga0105240_10516421 3300009093 Bacteria 1326
48 Ga0105241_10000305 3300009174 Bacteria 36958
49 Ga0105241_10003971 3300009174 Bacteria 10938
50 Ga0105241_10021041 3300009174 Bacteria 4822
51 Ga0105242_10009178 3300009176 Bacteria 7591
52 Ga0105237_10000243 3300009545 Bacteria 77722
53 Ga0105237_10002281 3300009545 Bacteria 23860
54 Ga0105237_10002359 3300009545 Bacteria 23435
55 Ga0105237_10004573 3300009545 Bacteria 15971
56 Ga0105237_10082866 3300009545 Bacteria 3198
57 Ga0105238_10005153 3300009551 Bacteria 12923
58 Ga0105238_10361424 3300009551 Bacteria 1441
59 Ga0105239_10000059 3300010375 Bacteria 155685
60 Ga0105239_10000190 3300010375 Bacteria 89155
61 Ga0105239_10002606 3300010375 Bacteria 22829
62 Ga0105239_10002708 3300010375 Bacteria 22283
63 Ga0105239_10007242 3300010375 Bacteria 12745
64 Ga0105239_10015541 3300010375 Bacteria 8431
65 Ga0105239_10194158 3300010375 Bacteria 2273
66 Ga0105246_10071093 3300011119 Bacteria 2449
67 Ga0157373_10000181 3300013100 Bacteria 51804
68 Ga0157373_10025277 3300013100 Bacteria 4297
69 Ga0157373_10048131 3300013100 Bacteria 3040
70 Ga0157371_10000266 3300013102 Bacteria 71146
71 Ga0157371_10101608 3300013102 Bacteria 2040
72 Ga0157370_10081382 3300013104 Bacteria 3047
73 Ga0157370_10209763 3300013104 Bacteria 1805
74 Ga0157369_10166789 3300013105 Bacteria 2322
75 Ga0157369_10369131 3300013105 Bacteria 1490
76 Ga0157369_10587430 3300013105 Bacteria 1150
77 Ga0157374_10000700 3300013296 Bacteria 29512
78 Ga0157378_10033594 3300013297 Bacteria 4536
79 Ga0157378_10055846 3300013297 Bacteria 3518
80 Ga0163162_10000010 3300013306 Bacteria 302032
81 Ga0163162_10004700 3300013306 Bacteria 13167
82 Ga0163162_10012613 3300013306 Bacteria 8253
83 Ga0157372_10001490 3300013307 Bacteria 25443
84 Ga0157372_10006937 3300013307 Bacteria 12056
85 Ga0157372_10017533 3300013307 Bacteria 7682
86 Ga0157372_10078926 3300013307 Bacteria 3721
87 Ga0157375_10029680 3300013308 Bacteria 5146
88 Ga0157375_10184417 3300013308 Bacteria 2239
89 Ga0157375_10575880 3300013308 Bacteria 1286
90 Ga0157377_10216610 3300014745 Bacteria 1224
91 Ga0157376_10064901 3300014969 Bacteria 3080
92 Ga0182007_10029988 3300015262 Bacteria 1860
93 Ga0213872_10023344 3300021361 Bacteria 2846
94 Ga0209437_100148 3300025233 Bacteria 158795
95 Ga0209233_1000564 3300025261 Bacteria 19855
96 Ga0207647_10000022 3300025904 Bacteria 118094
97 Ga0207647_10000211 3300025904 Bacteria 47375
98 Ga0207647_10035278 3300025904 Bacteria 3188
99 Ga0207645_10000151 3300025907 Bacteria 54588
100 Ga0207654_10002352 3300025911 Bacteria 9698
101 Ga0207695_10000019 3300025913 Bacteria 732137
102 Ga0207695_10216576 3300025913 Bacteria 1824
103 Ga0207695_10344332 3300025913 Unclassified 1378
104 Ga0207671_10000598 3300025914 Bacteria 48008
105 Ga0207671_10002797 3300025914 Bacteria 18193
106 Ga0207671_10003350 3300025914 Bacteria 16080
107 Ga0207671_10029126 3300025914 Bacteria 4125
108 Ga0207657_10028481 3300025919 Bacteria 5095
109 Ga0207657_10059365 3300025919 Bacteria 3287
110 Ga0207652_10506467 3300025921 Bacteria 1087
111 Ga0207694_10019514 3300025924 Bacteria 5125
112 Ga0207644_10030003 3300025931 Bacteria 3776
113 Ga0207690_10031845 3300025932 Bacteria 3379
114 Ga0207706_10000047 3300025933 Bacteria 119022
115 Ga0207706_10167209 3300025933 Bacteria 1933
116 Ga0207686_10008602 3300025934 Bacteria 5513
117 Ga0207704_10000077 3300025938 Bacteria 60841
118 Ga0207667_10000039 3300025949 Bacteria 278843
119 Ga0207667_10001998 3300025949 Bacteria 25593
120 Ga0207667_10023311 3300025949 Bacteria 6817
121 Ga0207667_10110247 3300025949 Bacteria 2839
122 Ga0207703_10023539 3300026035 Bacteria 4840
123 Ga0207702_10000249 3300026078 Bacteria 62542
124 Ga0207702_10067754 3300026078 Bacteria 3064
125 Ga0207702_10433802 3300026078 Bacteria 1272
126 Ga0207648_10002829 3300026089 Bacteria 18417
127 Ga0207683_10019540 3300026121 Bacteria 5786
128 Ga0207698_10003780 3300026142 Bacteria 9151
129 Ga0268266_10000030 3300028379 Bacteria 417120
130 Ga0307515_10000859 3300028794 Bacteria 69963
131 Ga0307515_10081168 3300028794 Bacteria 4216
132 Ga0395899_0000002 3300037312 Bacteria 1324310
133 Ga0395899_0000749 3300037312 Bacteria 32276
134 Ga0395900_0000406 3300037418 Bacteria 62078
135 Ga0395900_0000460 3300037418 Bacteria 58482
136 Ga0395905_0000175 3300037471 Bacteria 104024
137 Ga0395901_0000198 3300038443 Bacteria 76490
138 Ga0395901_0398106 3300038443 Bacteria 1415
139 Ga0436361_0611374 3300039447 Bacteria 11788
140 Ga0439448_0029018 3300042005 Bacteria 1750
141 Ga0466966_0099753 3300044684 Bacteria 1797
142 Ga0466959_0060780 3300045049 Bacteria 2749
143 Ga0495651_0167128 3300046462 Bacteria 1570
144 Ga0495650_0001050 3300046471 Bacteria 30706
145 Ga0495585_0000695 3300046492 Bacteria 30570
146 Ga0495606_0000033 3300046507 Bacteria 247739
147 Ga0495606_0026287 3300046507 Bacteria 4151
148 Ga0495610_0015453 3300046512 Bacteria 4434
149 Ga0495616_0001749 3300046513 Bacteria 14782
150 Ga0495616_0022215 3300046513 Bacteria 3427
151 Ga0495637_0079730 3300046520 Bacteria 1307
152 Ga0495648_0061164 3300046524 Bacteria 2238
153 Ga0495648_0094940 3300046524 Bacteria 1660
154 Ga0495633_0000172 3300046558 Bacteria 84811
155 Ga0495633_0005173 3300046558 Bacteria 8068
156 Ga0495668_0000069 3300046616 Bacteria 174287
157 Ga0495625_0000131 3300046660 Bacteria 117738
158 Ga0495625_0000385 3300046660 Bacteria 67419
159 Ga0495625_0006307 3300046660 Bacteria 10603
160 Ga0495625_0171611 3300046660 Bacteria 1448
161 Ga0495661_0003916 3300046665 Bacteria 10867
162 Ga0495599_0184095 3300046678 Bacteria 1287
163 Ga0495649_0000009 3300046694 Bacteria 451725
164 Ga0495687_000483 3300047443 Bacteria 48330
165 Ga0495687_000882 3300047443 Bacteria 31691
166 Ga0495673_0042209 3300047469 Bacteria 2049
167 Ga0495686_0000299 3300047472 Bacteria 85384
168 Ga0495686_0043664 3300047472 Bacteria 2841
169 Ga0495614_0093279 3300048089 Bacteria 1311
170 Ga0496126_0147313 3300048929 Bacteria 2021
171 Ga0495678_002638 3300049459 Bacteria 11934
172 nmdc:mga0k408_1182_c2 3300050493 Bacteria 11156
173 nmdc:mga0k408_222070_c1 3300050493 Bacteria 1128
174 nmdc:mga0k408_76777_c1 3300050493 Bacteria 1953
175 Ga0500608_029088 3300053122 Bacteria 2612
176 Ga0500608_058398 3300053122 Bacteria 1847
177 Ga0500634_0128375 3300053161 Bacteria 1221
178 2599478980 2599185184 Bacteria 6430550
179 2852624756 2852623160 Bacteria 4376875
180 2884936355 2884933994 Bacteria 4535041
181 2919438346 2919437846 Bacteria 6199444
182 2928082705 2928078545 Bacteria 6534839
183 2928153014 2928147474 Bacteria 6512076
184 2932086072 2932082852 Bacteria 6563563
185 Ga0495610_0001614
186 JGI24736J21556_1001913
187 JGI24739J22299_10061439
188 JGI24737J22298_10005248
189 JGI24735J21928_10000016
190 JGI24735J21928_10024966
191 JGI24744J21845_10004936
192 rootH1_10035699
193 rootH2_10075043
194 rootL2_10021022
195 rootL2_10246660
196 rootH1_10164539
197 rootH1_10231771
198 Ga0070676_10000004
199 Ga0068868_100006477
200 Ga0070660_100018191
201 Ga0070671_100025577
202 Ga0070674_100043013
203 Ga0070659_100047332
204 Ga0070678_100083234
205 Ga0070662_100000029
206 Ga0070662_100120910
207 Ga0068867_100006571
208 Ga0070679_100574089
209 Ga0070684_100016545
210 Ga0068853_100143984
211 Ga0070665_100000032
212 Ga0068855_100000226
213 Ga0068855_100000658
214 Ga0068855_100047274
215 Ga0068855_100189354
216 Ga0068855_100218416
217 Ga0068856_100000005
218 Ga0068856_100000424
219 Ga0068852_100000244
220 Ga0068852_100539222
221 Ga0068858_100056866
222 Ga0075366_10001766
223 Ga0097621_100001022
224 Ga0068871_100000021
225 Ga0068865_100000045
226 Ga0105240_10000010
227 Ga0105240_10024830
228 Ga0105240_10054997
229 Ga0105240_10211160
230 Ga0105240_10350872
231 Ga0105240_10516421
232 Ga0105241_10000305
233 Ga0105241_10003971
234 Ga0105241_10021041
235 Ga0105242_10009178
236 Ga0105237_10000243
237 Ga0105237_10002281
238 Ga0105237_10002359
239 Ga0105237_10004573
240 Ga0105237_10082866
241 Ga0105238_10005153
242 Ga0105238_10361424
243 Ga0105239_10000059
244 Ga0105239_10000190
245 Ga0105239_10002606
246 Ga0105239_10002708
247 Ga0105239_10007242
248 Ga0105239_10015541
249 Ga0105239_10194158
250 Ga0105246_10071093
251 Ga0157373_10000181
252 Ga0157373_10025277
253 Ga0157373_10048131
254 Ga0157371_10000266
255 Ga0157371_10101608
256 Ga0157370_10081382
257 Ga0157370_10209763
258 Ga0157369_10166789
259 Ga0157369_10369131
260 Ga0157369_10587430
261 Ga0157374_10000700
262 Ga0157378_10033594
263 Ga0157378_10055846
264 Ga0163162_10000010
265 Ga0163162_10004700
266 Ga0163162_10012613
267 Ga0157372_10001490
268 Ga0157372_10006937
269 Ga0157372_10017533
270 Ga0157372_10078926
271 Ga0157375_10029680
272 Ga0157375_10184417
273 Ga0157375_10575880
274 Ga0157377_10216610
275 Ga0157376_10064901
276 Ga0182007_10029988
277 Ga0213872_10023344
278 Ga0209437_100148
279 Ga0209233_1000564
280 Ga0207647_10000022
281 Ga0207647_10000211
282 Ga0207647_10035278
283 Ga0207645_10000151
284 Ga0207654_10002352
285 Ga0207695_10000019
286 Ga0207695_10216576
287 Ga0207695_10344332
288 Ga0207671_10000598
289 Ga0207671_10002797
290 Ga0207671_10003350
291 Ga0207671_10029126
292 Ga0207657_10028481
293 Ga0207657_10059365
294 Ga0207652_10506467
295 Ga0207694_10019514
296 Ga0207644_10030003
297 Ga0207690_10031845
298 Ga0207706_10000047
299 Ga0207706_10167209
300 Ga0207686_10008602
301 Ga0207704_10000077
302 Ga0207667_10000039
303 Ga0207667_10001998
304 Ga0207667_10023311
305 Ga0207667_10110247
306 Ga0207703_10023539
307 Ga0207702_10000249
308 Ga0207702_10067754
309 Ga0207702_10433802
310 Ga0207648_10002829
311 Ga0207683_10019540
312 Ga0207698_10003780
313 Ga0268266_10000030
314 Ga0307515_10000859
315 Ga0307515_10081168
316 Ga0395899_0000002
317 Ga0395899_0000749
318 Ga0395900_0000406
319 Ga0395900_0000460
320 Ga0395905_0000175
321 Ga0395901_0000198
322 Ga0395901_0398106
323 Ga0436361_0611374
324 Ga0439448_0029018
325 Ga0466966_0099753
326 Ga0466959_0060780
327 Ga0495651_0167128
328 Ga0495650_0001050
329 Ga0495585_0000695
330 Ga0495606_0000033
331 Ga0495606_0026287
332 Ga0495610_0015453
333 Ga0495616_0001749
334 Ga0495616_0022215
335 Ga0495637_0079730
336 Ga0495648_0061164
337 Ga0495648_0094940
338 Ga0495633_0000172
339 Ga0495633_0005173
340 Ga0495668_0000069
341 Ga0495625_0000131
342 Ga0495625_0000385
343 Ga0495625_0006307
344 Ga0495625_0171611
345 Ga0495661_0003916
346 Ga0495599_0184095
347 Ga0495649_0000009
348 Ga0495687_000483
349 Ga0495687_000882
350 Ga0495673_0042209
351 Ga0495686_0000299
352 Ga0495686_0043664
353 Ga0495614_0093279
354 Ga0496126_0147313
355 Ga0495678_002638
356 nmdc:mga0k408_1182_c2
357 nmdc:mga0k408_222070_c1
358 nmdc:mga0k408_76777_c1
359 Ga0500608_029088
360 Ga0500608_058398
361 Ga0500634_0128375
362 2599478980
363 2852624756
364 2884936355
365 2919438346
366 2928082705
367 2928153014
368 2932086072

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00291

PALP

Pyridoxal-phosphate dependent enzyme

7

283

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ysk-assembly1.cif.gz_B crystal structure of d-cysteine desulfhydrase from pectobacterium atrosepticum 0.8958 8 296
1j0a-assembly1.cif.gz_A crystal structure analysis of the acc deaminase homologue 0.8949 5 295
7ysl-assembly1.cif.gz_B crystal structure of d-cysteine desulfhydrase with a trapped plp-pyruvate geminal diamine 0.8897 8 297
4d8t-assembly1.cif.gz_B crystal structure of d-cysteine desulfhydrase from salmonella typhimurium at 2.2 a resolution 0.8868 4 292
4d9f-assembly2.cif.gz_C d-cysteine desulfhydrase from salmonella typhimurium complexed with d-cycloserine (dcs) 0.8862 5 292
ID Description Score Start End Superfamily
af_A0A1D6NEQ8_83_185_3.40.50.1100 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9 42 128 3.40.50.1100
4d8uD02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8388 44 139 3.40.50.1100
1j0bQ02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8267 42 139 3.40.50.1100
af_A1L4V7_217_421_3.40.50.1100 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8261 136 296 3.40.50.1100
af_B9EYZ1_202_400_3.40.50.1100 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8227 136 295 3.40.50.1100
ID Description Score Start End GO Terms
AF-A0A4Q6E4R4-F1-model_v4 Pyridoxal-phosphate dependent enzyme 0.986 1 185 GO:0019148
AF-A0A4Q6E4R4-F1-model_v4 Pyridoxal-phosphate dependent enzyme 0.9756 1 185 GO:0019148
AF-A0A4Q5S8A2-F1-model_v4 Pyridoxal-phosphate dependent enzyme 0.9702 101 295 GO:0019148
AF-A0A520AL16-F1-model_v4 Pyridoxal-phosphate dependent enzyme 0.9668 32 295 GO:0019148
AF-A0A4Q5S8A2-F1-model_v4 Pyridoxal-phosphate dependent enzyme 0.9654 101 295 GO:0019148

Map