F283238

General Info

Members Datasets Scaffolds Average Seq Length
184 134 173 443

Family's Representative Sequence

Representative Sequence 3300048922|Ga0496119_0000308|Ga0496119_0000308_17510_19012
Length 500
Sequence MTVKPARGAIAYWRHRGYIADQCRCPLPAATGNLVTGKFMPALMLIAAAGAATLAAPRPAQAADASEFTLANGLQVVVVPDHRTPVVTHMVWYRVGSADEQPGKSGIAHFLEHLMFKGTEKHPAGEFSQIVAKLGGQENAFTSQDYTAYFQRVAKEHLATVMGFEADRMTGLVLTDDVVLPERDVVLEERRMRTDNDPGSQLSEAAQAAMYTNHPYGHPIIGWEDEIKGLNRDDALAFYRRFYTPNNAILVVAGDVTEGEVRKLAEETYGKVQRTAEPGPRVRPTEXXXRAQRRVTLTDARVAQPSLSRTYLVPPYRTNKKDSAALDVLAQILGGGSTGRLYRGLVVDKGLAAGANAWYQSTALDDTRFGFSASPRPGVSLDTLEQGLDTVIATIAADGVDAAELERAKTRLVAESVYAQDNQATLARIYGAALTTGTTVQDVKNWPDEVKAVTADEVRDVARRYLLPARAVTGYLAKPLADGATDPAVPAAAAAPEKRS

Samples

Sample ID Description Type Environment
1 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
2 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
3 2643221651 Afipia sp. Root123D2 Isolate Unclassified
4 2738543024 Aminobacter sp. AP02 Isolate Unclassified
5 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
6 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
7 2932401849 Devosia sp. 2618 Isolate Rhizosphere
8 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
9 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
25 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
26 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
27 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
28 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
29 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
30 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
31 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
32 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
33 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
34 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
35 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
36 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
44 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
45 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
46 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
47 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
48 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
49 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
50 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
63 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
64 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
65 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
66 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
67 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
68 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
69 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
70 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
71 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
72 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
73 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
74 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
75 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
76 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
77 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
78 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
79 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
80 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
81 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
82 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
83 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
84 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
85 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
86 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
87 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
88 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
89 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
90 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
91 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
92 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
93 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
94 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
95 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
96 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
97 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
98 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
99 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
100 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
101 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
110 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
111 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
112 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
113 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
116 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
117 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
118 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
119 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
120 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
121 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
122 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
123 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
124 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
125 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
126 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
127 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
128 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
129 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
130 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
131 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
132 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
133 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
134 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.02
Metatranscriptomes 0
Isolates 5.98

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.98
Nodule 1.09
Rhizoplane 10.33
Rhizosphere 69.57
Stem 0
Stem Tuber 0
Unclassified 13.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10005473 3300003203 Bacteria 5889
2 Ga0070658_10015596 3300005327 Bacteria 6076
3 Ga0070658_10033426 3300005327 Bacteria 4137
4 Ga0070680_100087940 3300005336 Bacteria 2569
5 Ga0070682_100004996 3300005337 Bacteria 7371
6 Ga0070660_100045313 3300005339 Bacteria 3366
7 Ga0070667_100051134 3300005367 Bacteria 3483
8 Ga0070714_100036469 3300005435 Bacteria 4124
9 Ga0070681_10054259 3300005458 Bacteria 3993
10 Ga0070679_100106803 3300005530 Bacteria 2785
11 Ga0068853_100008197 3300005539 Bacteria 8388
12 Ga0068855_100044719 3300005563 Bacteria 5240
13 Ga0068855_100063829 3300005563 Bacteria 4296
14 Ga0068855_100095530 3300005563 Bacteria 3425
15 Ga0070664_100178574 3300005564 Bacteria 1886
16 Ga0068857_100048862 3300005577 Bacteria 3753
17 Ga0068854_100051007 3300005578 Bacteria 2963
18 Ga0068854_100065561 3300005578 Bacteria 2641
19 Ga0068852_100083990 3300005616 Bacteria 2833
20 Ga0068852_100087266 3300005616 Bacteria 2783
21 Ga0068858_100070296 3300005842 Bacteria 3244
22 Ga0081455_10004590 3300005937 Bacteria 15425
23 Ga0081539_10003346 3300005985 Bacteria 19920
24 Ga0075365_10017830 3300006038 Bacteria 4355
25 Ga0075365_10023345 3300006038 Bacteria 3889
26 Ga0075432_10002319 3300006058 Bacteria 6331
27 Ga0075427_10007895 3300006194 Bacteria 1570
28 Ga0075428_100002521 3300006844 Bacteria 19905
29 Ga0075430_100000128 3300006846 Bacteria 47770
30 Ga0075430_100019025 3300006846 Bacteria 5842
31 Ga0075431_100001558 3300006847 Bacteria 21282
32 Ga0075433_10000103 3300006852 Bacteria 41320
33 Ga0075434_100001533 3300006871 Bacteria 19536
34 Ga0075434_100020416 3300006871 Bacteria 6426
35 Ga0075429_100000381 3300006880 Bacteria 32664
36 Ga0075435_100061242 3300007076 Bacteria 3053
37 Ga0105240_10085217 3300009093 Bacteria 3872
38 Ga0111539_10000787 3300009094 Bacteria 41244
39 Ga0111539_10147581 3300009094 Bacteria 2754
40 Ga0105245_10043720 3300009098 Bacteria 3996
41 Ga0114129_10003834 3300009147 Bacteria 21189
42 Ga0114129_10017332 3300009147 Bacteria 10253
43 Ga0114129_10103635 3300009147 Bacteria 3933
44 Ga0105237_10044355 3300009545 Bacteria 4476
45 Ga0105238_10014423 3300009551 Bacteria 7989
46 Ga0105238_10028166 3300009551 Bacteria 5723
47 Ga0105246_10013979 3300011119 Bacteria 5040
48 Ga0157375_10075061 3300013308 Bacteria 3405
49 Ga0163163_10001022 3300014325 Bacteria 23701
50 Ga0213872_10014643 3300021361 Bacteria 3656
51 Ga0213874_10004065 3300021377 Bacteria 3303
52 Ga0213876_10001084 3300021384 Bacteria 17452
53 Ga0213876_10002924 3300021384 Bacteria 9899
54 Ga0213875_10001310 3300021388 Bacteria 16493
55 Ga0207705_10015254 3300025909 Bacteria 5517
56 Ga0207705_10044554 3300025909 Bacteria 3188
57 Ga0207707_10042405 3300025912 Bacteria 3971
58 Ga0207660_10011502 3300025917 Bacteria 5764
59 Ga0207657_10006394 3300025919 Bacteria 12233
60 Ga0207652_10041438 3300025921 Bacteria 3914
61 Ga0207694_10029087 3300025924 Bacteria 4214
62 Ga0207667_10018944 3300025949 Bacteria 7696
63 Ga0207667_10144038 3300025949 Bacteria 2453
64 Ga0207667_10154167 3300025949 Bacteria 2364
65 Ga0207658_10043115 3300025986 Bacteria 3278
66 Ga0207639_10016297 3300026041 Bacteria 5254
67 Ga0207678_10000101 3300026067 Bacteria 70507
68 Ga0207674_10045232 3300026116 Bacteria 4529
69 Ga0207698_10048463 3300026142 Bacteria 3226
70 Ga0207698_10147225 3300026142 Bacteria 2038
71 Ga0207428_10000058 3300027907 Bacteria 158579
72 Ga0207428_10094043 3300027907 Bacteria 2324
73 Ga0265313_10011055 3300031595 Bacteria 5633
74 Ga0265342_10000256 3300031712 Bacteria 59799
75 Ga0307516_10032470 3300031730 Bacteria 5258
76 Ga0307516_10127505 3300031730 Bacteria 2328
77 Ga0307414_10035044 3300032004 Bacteria 3335
78 Ga0307414_10154024 3300032004 Bacteria 1817
79 Ga0373926_0050107 3300035083 Bacteria 1505
80 Ga0395900_0029302 3300037418 Bacteria 5648
81 Ga0395900_0172226 3300037418 Bacteria 2203
82 Ga0436364_0373852 3300037853 Bacteria 2970
83 Ga0436364_1133108 3300037853 Bacteria 16676
84 Ga0395901_0124135 3300038443 Bacteria 2713
85 Ga0400483_120752 3300039062 Bacteria 2171
86 Ga0436365_0080604 3300039437 Bacteria 50922
87 Ga0436365_0485986 3300039437 Bacteria 2964
88 Ga0436361_0878640 3300039447 Bacteria 5939
89 Ga0436363_0098386 3300039450 Bacteria 4208
90 Ga0436363_0250085 3300039450 Bacteria 26739
91 Ga0436362_0789633 3300039453 Bacteria 5054
92 Ga0436362_0867424 3300039453 Bacteria 4569
93 Ga0453684_0000006 3300044712 Bacteria 1364191
94 Ga0453684_0000031 3300044712 Bacteria 752632
95 Ga0453684_0050079 3300044712 Bacteria 5499
96 Ga0451576_0002176 3300045051 Bacteria 30329
97 Ga0451576_0007295 3300045051 Bacteria 13283
98 Ga0495638_0006132 3300046460 Bacteria 8795
99 Ga0495651_0018832 3300046462 Bacteria 5347
100 Ga0495607_0046764 3300046501 Bacteria 2538
101 Ga0495634_0072504 3300046642 Bacteria 2265
102 Ga0495670_0058333 3300046691 Bacteria 1938
103 Ga0495684_0192324 3300047471 Bacteria 1508
104 Ga0496100_0109529 3300048903 Bacteria 1916
105 Ga0496101_0029315 3300048904 Bacteria 3849
106 Ga0496102_0011972 3300048905 Bacteria 7492
107 Ga0496103_0012735 3300048906 Bacteria 4988
108 Ga0496104_0000701 3300048907 Bacteria 28834
109 Ga0496104_0004705 3300048907 Bacteria 11885
110 Ga0496104_0450100 3300048907 Bacteria 1199
111 Ga0496105_0001342 3300048908 Bacteria 17252
112 Ga0496105_0002331 3300048908 Bacteria 13760
113 Ga0496105_0024869 3300048908 Bacteria 4867
114 Ga0496106_0107437 3300048909 Bacteria 2170
115 Ga0496107_0014290 3300048910 Bacteria 5559
116 Ga0496109_0018982 3300048912 Bacteria 6055
117 Ga0496109_0075204 3300048912 Bacteria 3105
118 Ga0496111_0017900 3300048914 Bacteria 4900
119 Ga0496111_0144125 3300048914 Bacteria 1765
120 Ga0496112_0004261 3300048915 Bacteria 12072
121 Ga0496113_0015347 3300048916 Bacteria 5261
122 Ga0496115_0005616 3300048918 Bacteria 9131
123 Ga0496119_0000308 3300048922 Bacteria 68303
124 Ga0496119_0001598 3300048922 Bacteria 26923
125 Ga0496122_0002958 3300048925 Bacteria 23175
126 Ga0496123_0000663 3300048926 Bacteria 56880
127 Ga0501032_0001313 3300049569 Bacteria 19912
128 Ga0501032_0039663 3300049569 Bacteria 3203
129 Ga0501034_0000031 3300049571 Bacteria 244022
130 Ga0501034_0135727 3300049571 Bacteria 2441
131 Ga0501037_0000369 3300049573 Bacteria 37612
132 Ga0501038_0015024 3300049574 Bacteria 7053
133 Ga0501039_0000109 3300049575 Bacteria 55531
134 Ga0501043_0073334 3300049579 Bacteria 2689
135 Ga0501046_0000011 3300049580 Bacteria 326457
136 Ga0501046_0010624 3300049580 Bacteria 7898
137 Ga0501047_0001419 3300049581 Bacteria 23513
138 Ga0501047_0022629 3300049581 Bacteria 6035
139 Ga0501047_0107749 3300049581 Bacteria 2668
140 Ga0501048_0000523 3300049582 Bacteria 26987
141 Ga0501048_0148933 3300049582 Bacteria 1655
142 Ga0501067_0001397 3300049583 Bacteria 13089
143 Ga0501067_0012968 3300049583 Bacteria 4613
144 Ga0501070_0008766 3300049586 Bacteria 8553
145 Ga0501073_0078570 3300049589 Bacteria 2296
146 Ga0501080_0000036 3300049742 Bacteria 83175
147 Ga0501035_0000054 3300049822 Bacteria 142023
148 Ga0501044_0000013 3300049823 Bacteria 248795
149 Ga0501044_0013518 3300049823 Bacteria 8826
150 Ga0501044_0094944 3300049823 Bacteria 3006
151 Ga0501045_0019429 3300049824 Bacteria 4844
152 nmdc:mga05p37_35_c1 3300050507 Bacteria 110751
153 nmdc:mga05p37_90982_c1 3300050507 Bacteria 3760
154 nmdc:mga09592_163_c1 3300050508 Bacteria 46620
155 nmdc:mga0qj67_143_c1 3300050509 Bacteria 48269
156 nmdc:mga06r32_774_c1 3300050510 Bacteria 28232
157 nmdc:mga08y16_356_c1 3300050511 Bacteria 41239
158 nmdc:mga08y16_50359_c1 3300050511 Bacteria 4359
159 nmdc:mga0n895_2020_c1 3300050512 Bacteria 15601
160 nmdc:mga0n895_442394_c1 3300050512 Bacteria 1313
161 nmdc:mga0rr50_2803_c1 3300050513 Bacteria 9900
162 nmdc:mga0rr50_6925_c1 3300050513 Bacteria 6950
163 Ga0495619_0071926 3300053085 Bacteria 2315
164 Ga0500555_004448 3300053103 Bacteria 3983
165 Ga0500556_0000017 3300053104 Bacteria 192495
166 Ga0500556_0001622 3300053104 Bacteria 8842
167 Ga0500556_0005837 3300053104 Bacteria 3484
168 Ga0500593_003125 3300053117 Bacteria 6198
169 Ga0500595_018172 3300053119 Bacteria 2577
170 Ga0500616_0003595 3300053153 Bacteria 11687
171 Ga0500634_0000041 3300053161 Bacteria 59177
172 Ga0500645_005390 3300053730 Bacteria 4719
173 Ga0501082_0012926 3300060353 Bacteria 7176

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046642 Ga0495634_0072504 Ga0495634_0072504_14_1213 369
2 3300048907 Ga0496104_0450100 Ga0496104_0450100_29_1153 369
3 3300035083 Ga0373926_0050107 Ga0373926_0050107_285_1484 371
4 3300046501 Ga0495607_0046764 Ga0495607_0046764_20_1219 371
5 3300050512 nmdc:mga0n895_442394_c1 nmdc:mga0n895_442394_c1_14_1144 371
6 3300049569 Ga0501032_0039663 Ga0501032_0039663_1355_2770 400
7 3300049823 Ga0501044_0013518 Ga0501044_0013518_3496_4911 400
8 3300053153 Ga0500616_0003595 Ga0500616_0003595_7818_9173 401
9 3300009147 Ga0114129_10003834 Ga0114129_1000383420 403
10 3300050513 nmdc:mga0rr50_6925_c1 nmdc:mga0rr50_6925_c1_69_1451 403
11 3300005937 Ga0081455_10004590 Ga0081455_100045909 404
12 3300006871 Ga0075434_100020416 Ga0075434_1000204164 404
13 3300005435 Ga0070714_100036469 Ga0070714_1000364694 406
14 3300005616 Ga0068852_100087266 Ga0068852_1000872662 406
15 3300053119 Ga0500595_018172 Ga0500595_018172_293_1666 410
16 3300005327 Ga0070658_10015596 Ga0070658_100155961 411
17 3300005336 Ga0070680_100087940 Ga0070680_1000879402 411
18 3300005339 Ga0070660_100045313 Ga0070660_1000453132 411
19 3300005458 Ga0070681_10054259 Ga0070681_100542594 411
20 3300005530 Ga0070679_100106803 Ga0070679_1001068032 411
21 3300005563 Ga0068855_100095530 Ga0068855_1000955302 411
22 3300005616 Ga0068852_100083990 Ga0068852_1000839903 411
23 3300025909 Ga0207705_10015254 Ga0207705_100152544 411
24 3300025912 Ga0207707_10042405 Ga0207707_100424054 411
25 3300025917 Ga0207660_10011502 Ga0207660_100115024 411
26 3300025919 Ga0207657_10006394 Ga0207657_1000639413 411
27 3300025921 Ga0207652_10041438 Ga0207652_100414382 411
28 3300025949 Ga0207667_10144038 Ga0207667_101440382 411
29 3300026142 Ga0207698_10147225 Ga0207698_101472252 411
30 3300031595 Ga0265313_10011055 Ga0265313_100110554 411
31 3300031712 Ga0265342_10000256 Ga0265342_1000025621 411
32 3300049581 Ga0501047_0022629 Ga0501047_0022629_1617_2975 411
33 3300049583 Ga0501067_0012968 Ga0501067_0012968_203_1618 411
34 3300049823 Ga0501044_0094944 Ga0501044_0094944_780_2138 411
35 3300006058 Ga0075432_10002319 Ga0075432_100023194 413
36 3300006194 Ga0075427_10007895 Ga0075427_100078951 413
37 3300006844 Ga0075428_100002521 Ga0075428_10000252120 413
38 3300006846 Ga0075430_100000128 Ga0075430_10000012826 413
39 3300006847 Ga0075431_100001558 Ga0075431_10000155813 413
40 3300006852 Ga0075433_10000103 Ga0075433_1000010320 413
41 3300006871 Ga0075434_100001533 Ga0075434_10000153313 413
42 3300006880 Ga0075429_100000381 Ga0075429_10000038125 413
43 3300007076 Ga0075435_100061242 Ga0075435_1000612422 413
44 3300009094 Ga0111539_10000787 Ga0111539_1000078710 413
45 3300009147 Ga0114129_10017332 Ga0114129_100173328 413
46 3300027907 Ga0207428_10000058 Ga0207428_1000005833 413
47 3300050507 nmdc:mga05p37_35_c1 nmdc:mga05p37_35_c1_85393_86796 413
48 3300050508 nmdc:mga09592_163_c1 nmdc:mga09592_163_c1_33082_34485 413
49 3300050509 nmdc:mga0qj67_143_c1 nmdc:mga0qj67_143_c1_33081_34484 413
50 3300050510 nmdc:mga06r32_774_c1 nmdc:mga06r32_774_c1_21298_22701 413
51 3300050511 nmdc:mga08y16_356_c1 nmdc:mga08y16_356_c1_13865_15268 413
52 3300050512 nmdc:mga0n895_2020_c1 nmdc:mga0n895_2020_c1_13993_15396 413
53 3300050513 nmdc:mga0rr50_2803_c1 nmdc:mga0rr50_2803_c1_4244_5647 413
54 3300048912 Ga0496109_0075204 Ga0496109_0075204_136_1431 415
55 3300039062 Ga0400483_120752 Ga0400483_120752_10_1341 416
56 3300045051 Ga0451576_0007295 Ga0451576_0007295_7994_9370 416
57 3300046462 Ga0495651_0018832 Ga0495651_0018832_2821_4242 418
58 3300047471 Ga0495684_0192324 Ga0495684_0192324_74_1423 419
59 3300053085 Ga0495619_0071926 Ga0495619_0071926_734_2083 420
60 3300006038 Ga0075365_10023345 Ga0075365_100233453 422
61 3300049580 Ga0501046_0000011 Ga0501046_0000011_89310_90677 424
62 3300048903 Ga0496100_0109529 Ga0496100_0109529_237_1607 426
63 3300048907 Ga0496104_0004705 Ga0496104_0004705_6679_8034 426
64 3300048908 Ga0496105_0001342 Ga0496105_0001342_3579_4934 426
65 3300048908 Ga0496105_0024869 Ga0496105_0024869_1811_3166 426
66 3300048914 Ga0496111_0144125 Ga0496111_0144125_304_1659 426
67 3300048915 Ga0496112_0004261 Ga0496112_0004261_10411_11781 426
68 3300048916 Ga0496113_0015347 Ga0496113_0015347_2397_3752 426
69 3300053104 Ga0500556_0001622 Ga0500556_0001622_5852_7168 426
70 3300006038 Ga0075365_10017830 Ga0075365_100178302 429
71 3300005563 Ga0068855_100044719 Ga0068855_1000447193 430
72 3300005578 Ga0068854_100051007 Ga0068854_1000510072 430
73 3300025949 Ga0207667_10154167 Ga0207667_101541672 430
74 3300039447 Ga0436361_0878640 Ga0436361_0878640_3042_4352 430
75 3300005539 Ga0068853_100008197 Ga0068853_1000081973 431
76 3300005564 Ga0070664_100178574 Ga0070664_1001785741 431
77 3300005577 Ga0068857_100048862 Ga0068857_1000488621 431
78 3300005842 Ga0068858_100070296 Ga0068858_1000702964 431
79 3300009551 Ga0105238_10028166 Ga0105238_100281664 431
80 3300026041 Ga0207639_10016297 Ga0207639_100162972 431
81 3300026067 Ga0207678_10000101 Ga0207678_1000010136 431
82 3300026116 Ga0207674_10045232 Ga0207674_100452324 431
83 3300048905 Ga0496102_0011972 Ga0496102_0011972_2990_4399 431
84 3300048906 Ga0496103_0012735 Ga0496103_0012735_2822_4231 431
85 3300048907 Ga0496104_0000701 Ga0496104_0000701_21170_22492 431
86 3300048908 Ga0496105_0002331 Ga0496105_0002331_6096_7418 431
87 3300048909 Ga0496106_0107437 Ga0496106_0107437_434_1843 431
88 3300048910 Ga0496107_0014290 Ga0496107_0014290_3416_4825 431
89 3300053104 Ga0500556_0000017 Ga0500556_0000017_188762_190264 432
90 3300048922 Ga0496119_0001598 Ga0496119_0001598_5864_7219 433
91 3300005327 Ga0070658_10033426 Ga0070658_100334262 434
92 3300009093 Ga0105240_10085217 Ga0105240_100852174 434
93 3300009094 Ga0111539_10147581 Ga0111539_101475812 435
94 3300009147 Ga0114129_10103635 Ga0114129_101036353 435
95 3300027907 Ga0207428_10094043 Ga0207428_100940432 435
96 3300050507 nmdc:mga05p37_90982_c1 nmdc:mga05p37_90982_c1_289_1683 435
97 3300050511 nmdc:mga08y16_50359_c1 nmdc:mga08y16_50359_c1_2280_3674 435
98 3300053104 Ga0500556_0005837 Ga0500556_0005837_210_1559 435
99 3300045051 Ga0451576_0002176 Ga0451576_0002176_20133_21491 437
100 3300049569 Ga0501032_0001313 Ga0501032_0001313_6195_7556 437
101 3300049571 Ga0501034_0000031 Ga0501034_0000031_113265_114626 437
102 3300049573 Ga0501037_0000369 Ga0501037_0000369_22623_23984 437
103 3300049574 Ga0501038_0015024 Ga0501038_0015024_4896_6257 437
104 3300049575 Ga0501039_0000109 Ga0501039_0000109_28606_29967 437
105 3300049579 Ga0501043_0073334 Ga0501043_0073334_421_1782 437
106 3300049580 Ga0501046_0010624 Ga0501046_0010624_5988_7349 437
107 3300049581 Ga0501047_0001419 Ga0501047_0001419_5798_7159 437
108 3300049582 Ga0501048_0000523 Ga0501048_0000523_8837_10201 437
109 3300049582 Ga0501048_0148933 Ga0501048_0148933_281_1642 437
110 3300049583 Ga0501067_0001397 Ga0501067_0001397_11060_12421 437
111 3300049586 Ga0501070_0008766 Ga0501070_0008766_5073_6434 437
112 3300049589 Ga0501073_0078570 Ga0501073_0078570_20_1381 437
113 3300049742 Ga0501080_0000036 Ga0501080_0000036_16875_18236 437
114 3300049822 Ga0501035_0000054 Ga0501035_0000054_54860_56221 437
115 3300049823 Ga0501044_0000013 Ga0501044_0000013_117419_118780 437
116 3300049824 Ga0501045_0019429 Ga0501045_0019429_1311_2672 437
117 3300060353 Ga0501082_0012926 Ga0501082_0012926_1285_2646 437
118 3300021361 Ga0213872_10014643 Ga0213872_100146434 438
119 3300031730 Ga0307516_10032470 Ga0307516_100324703 438
120 3300044712 Ga0453684_0000006 Ga0453684_0000006_822544_823863 438
121 3300044712 Ga0453684_0000031 Ga0453684_0000031_595282_596607 438
122 iso_pu_bacteria 2828305725 2828309218 438
123 3300021384 Ga0213876_10002924 Ga0213876_100029242 439
124 3300021388 Ga0213875_10001310 Ga0213875_100013109 439
125 3300037853 Ga0436364_0373852 Ga0436364_0373852_1046_2365 439
126 3300039437 Ga0436365_0485986 Ga0436365_0485986_756_2075 439
127 3300039450 Ga0436363_0098386 Ga0436363_0098386_507_1826 439
128 3300039453 Ga0436362_0789633 Ga0436362_0789633_221_1540 439
129 iso_pu_bacteria 2513237087 2513591288 439
130 3300009551 Ga0105238_10014423 Ga0105238_100144236 440
131 3300021377 Ga0213874_10004065 Ga0213874_100040653 440
132 3300021384 Ga0213876_10001084 Ga0213876_100010848 440
133 3300039437 Ga0436365_0080604 Ga0436365_0080604_26096_27430 440
134 3300039450 Ga0436363_0250085 Ga0436363_0250085_18205_19539 440
135 3300039453 Ga0436362_0867424 Ga0436362_0867424_798_2132 440
136 3300044712 Ga0453684_0050079 Ga0453684_0050079_3987_5366 440
137 3300025909 Ga0207705_10044554 Ga0207705_100445543 441
138 3300025924 Ga0207694_10029087 Ga0207694_100290874 441
139 3300025949 Ga0207667_10018944 Ga0207667_100189443 441
140 3300026142 Ga0207698_10048463 Ga0207698_100484633 441
141 3300053117 Ga0500593_003125 Ga0500593_003125_210_1550 441
142 iso_pu_bacteria 2919450847 2919453803 441
143 iso_pu_bacteria 8001845381 8001846754 441
144 3300014325 Ga0163163_10001022 Ga0163163_1000102218 442
145 3300037853 Ga0436364_1133108 Ga0436364_1133108_7215_8576 442
146 3300048904 Ga0496101_0029315 Ga0496101_0029315_290_1654 442
147 3300048912 Ga0496109_0018982 Ga0496109_0018982_2522_3874 442
148 3300048914 Ga0496111_0017900 Ga0496111_0017900_690_2030 442
149 3300048918 Ga0496115_0005616 Ga0496115_0005616_592_1932 442
150 iso_pu_bacteria 8045864390 8045866338 442
151 3300032004 Ga0307414_10035044 Ga0307414_100350442 443
152 3300032004 Ga0307414_10154024 Ga0307414_101540242 443
153 3300037418 Ga0395900_0029302 Ga0395900_0029302_1559_2974 443
154 3300046691 Ga0495670_0058333 Ga0495670_0058333_521_1906 443
155 3300048922 Ga0496119_0000308 Ga0496119_0000308_17510_19012 443
156 3300048925 Ga0496122_0002958 Ga0496122_0002958_17136_18521 443
157 3300048926 Ga0496123_0000663 Ga0496123_0000663_4526_5911 443
158 3300053161 Ga0500634_0000041 Ga0500634_0000041_21197_22582 443
159 3300053730 Ga0500645_005390 Ga0500645_005390_1184_2686 443
160 iso_pu_bacteria 2932401849 2932402694 443
161 iso_pu_bacteria 2996310559 2996316666 443
162 3300003203 JGI25406J46586_10005473 JGI25406J46586_100054732 444
163 3300005337 Ga0070682_100004996 Ga0070682_1000049964 444
164 3300005367 Ga0070667_100051134 Ga0070667_1000511342 444
165 3300005563 Ga0068855_100063829 Ga0068855_1000638294 444
166 3300005578 Ga0068854_100065561 Ga0068854_1000655612 444
167 3300005985 Ga0081539_10003346 Ga0081539_100033466 444
168 3300006846 Ga0075430_100019025 Ga0075430_1000190254 444
169 3300009098 Ga0105245_10043720 Ga0105245_100437202 444
170 3300009545 Ga0105237_10044355 Ga0105237_100443552 444
171 3300011119 Ga0105246_10013979 Ga0105246_100139793 444
172 3300013308 Ga0157375_10075061 Ga0157375_100750613 444
173 3300025986 Ga0207658_10043115 Ga0207658_100431152 444
174 3300031730 Ga0307516_10127505 Ga0307516_101275052 444
175 3300037418 Ga0395900_0172226 Ga0395900_0172226_294_1676 444
176 3300038443 Ga0395901_0124135 Ga0395901_0124135_1082_2464 444
177 3300046460 Ga0495638_0006132 Ga0495638_0006132_7109_8494 444
178 3300049571 Ga0501034_0135727 Ga0501034_0135727_609_1991 444
179 3300049581 Ga0501047_0107749 Ga0501047_0107749_188_1570 444
180 3300053103 Ga0500555_004448 Ga0500555_004448_2295_3641 444
181 iso_pu_bacteria 2643221623 2644133012 444
182 iso_pu_bacteria 2643221651 2644289847 444
183 iso_pu_bacteria 2738543024 2739306364 444
184 iso_pu_bacteria 8002285264 8002287693 444

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05193

Peptidase_M16_C

Peptidase M16 inactive domain

229

412

0.98

PF00675

Peptidase_M16

Insulinase (Peptidase family M16)

75

224

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4nnz-assembly2.cif.gz_B subunit pa0372 of heterodimeric zinc protease pa0371-pa0372 0.9614 24 439
4nnz-assembly2.cif.gz_A subunit pa0372 of heterodimeric zinc protease pa0371-pa0372 0.9581 24 439
4nnz-assembly2.cif.gz_B subunit pa0372 of heterodimeric zinc protease pa0371-pa0372 0.9566 24 439
4nnz-assembly2.cif.gz_A subunit pa0372 of heterodimeric zinc protease pa0371-pa0372 0.9534 24 439
3amj-assembly1.cif.gz_C the crystal structure of the heterodimer of m16b peptidase from sphingomonas sp. a1 0.9478 21 439
ID Description Score Start End Superfamily
3amjC01 Alpha Beta;2-Layer Sandwich;Cytochrome Bc1 Complex; Chain A, domain 1;Metalloenzyme, LuxS/M16 peptidase-like 0.9778 21 241 3.30.830.10
4nnzB01 Alpha Beta;2-Layer Sandwich;Cytochrome Bc1 Complex; Chain A, domain 1;Metalloenzyme, LuxS/M16 peptidase-like 0.9696 24 243 3.30.830.10
3amjC01 Alpha Beta;2-Layer Sandwich;Cytochrome Bc1 Complex; Chain A, domain 1;Metalloenzyme, LuxS/M16 peptidase-like 0.9607 21 241 3.30.830.10
4nnzB01 Alpha Beta;2-Layer Sandwich;Cytochrome Bc1 Complex; Chain A, domain 1;Metalloenzyme, LuxS/M16 peptidase-like 0.9601 24 243 3.30.830.10
4nnzB02 Alpha Beta;2-Layer Sandwich;Cytochrome Bc1 Complex; Chain A, domain 1;Metalloenzyme, LuxS/M16 peptidase-like 0.9517 244 439 3.30.830.10
ID Description Score Start End GO Terms
AF-A9MDW3-F1-model_v4 Peptidase M16 domain protein 0.9836 24 443 GO:0004222
GO:0006508
GO:0046872
AF-A0A1U7JDC2-F1-model_v4 Zinc protease 0.9793 23 444 GO:0004222
GO:0006508
GO:0046872
AF-A0A7Y4JLK4-F1-model_v4 deleted 0.9725 39 161
AF-A0A6N7A477-F1-model_v4 deleted 0.9723 39 441
AF-A0A537NVI4-F1-model_v4 Insulinase family protein 0.9719 202 440 GO:0046872

Feature Viewer

pLDDT pTM Quality
91.61 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map