F283375

General Info

Members Datasets Scaffolds Average Seq Length
184 122 180 485

Family's Representative Sequence

Representative Sequence 3300053096|Ga0500641_0000868|Ga0500641_0000868_4842_6542
Length 566
Sequence MAQALTSATFCRRSGAVGDREGIAVGVLAFAADQPAARHQLGYFGATADQLLAGRRDVLASETGPSRTCFLFFAKPVAIGYLAAMSLIKGETGEWEIVLGLEVHAQVISDAKLFSGAPTTFGADPNTQVSLVDAGMPGMLPVINKRCVEQAVRTGLGLNARINLHSVFDRKNYFYADLPAGYQISQYKDPIVGEGEVEIDLPDGKVRTIGIERLHLEQDAAKTLHDQHPSQSYVDLNRSGVALMEIVSKPDMRTADEAAAYLTKLRSIVRYLGTCDGNMDEGSMRCDVNVSVRKPNGPLGTRCEIKNVNSIRFVKQAIEYEARRQVELIEGGGKVAQETRLFDPGRGETRSLRSKEDAHDYRYFPDPDLLPLVLTKDYVEKIRASLPELPDSRKNRFIKDYGLSAYDAGVLVAEKDTAEFFEAVARGRDAKQATNWVTGDLFGMLNRRGVGIAESPVSAASLGKLLDLIGDGTISGRIAKDLFVAMEETGKDPAALVEERGLKQVTDTGAIEAAIKAVIDANPGQLAAYKVKPTLFGWFVGQVMKSTGGKANPKVVNELLKKALDA

Samples

Sample ID Description Type Environment
1 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
2 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
3 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
4 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
13 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
19 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
20 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
21 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
22 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
23 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
24 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
25 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
26 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
27 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
28 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
29 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
34 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
35 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
36 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
37 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
38 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
39 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
40 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
41 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
42 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
43 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
58 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
61 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
62 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
63 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
64 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
65 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
66 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
67 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
68 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
69 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
70 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
71 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
72 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
73 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
74 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
75 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
76 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
77 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
78 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
79 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
80 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
81 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
82 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
83 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
84 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
85 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
86 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
87 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
88 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
89 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
90 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
91 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
92 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
93 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
94 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
95 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
96 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
99 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
100 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
101 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
102 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
103 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
104 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
105 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
106 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
107 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
108 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
109 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
110 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
111 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
112 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
113 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
114 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
115 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
116 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
117 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
118 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
119 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
120 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
121 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
122 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.83
Metatranscriptomes 0
Isolates 2.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.5
Nodule 0
Rhizoplane 0.54
Rhizosphere 80.43
Stem 0
Stem Tuber 0
Unclassified 6.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10000048 3300003215 Bacteria 141500
2 Ga0055531_10010883 3300003794 Bacteria 4465
3 Ga0070658_10002658 3300005327 Bacteria 14867
4 Ga0070680_100009307 3300005336 Bacteria 7543
5 Ga0070674_100006630 3300005356 Bacteria 6771
6 Ga0070708_100003909 3300005445 Bacteria 11699
7 Ga0070708_100010727 3300005445 Bacteria 7435
8 Ga0070708_100045735 3300005445 Bacteria 3858
9 Ga0070681_10001269 3300005458 Bacteria 22019
10 Ga0070681_10010546 3300005458 Bacteria 9124
11 Ga0070698_100005130 3300005471 Bacteria 14332
12 Ga0070698_100138387 3300005471 Bacteria 2388
13 Ga0070699_100002976 3300005518 Bacteria 15050
14 Ga0070679_100000716 3300005530 Bacteria 28574
15 Ga0070679_100001788 3300005530 Bacteria 19380
16 Ga0070679_100149631 3300005530 Bacteria 2312
17 Ga0070697_100036903 3300005536 Bacteria 3947
18 Ga0068855_100005205 3300005563 Bacteria 15865
19 Ga0068855_100024602 3300005563 Bacteria 7204
20 Ga0068856_100059593 3300005614 Bacteria 3770
21 Ga0068859_100093825 3300005617 Bacteria 3052
22 Ga0081455_10001171 3300005937 Bacteria 32831
23 Ga0081455_10003510 3300005937 Bacteria 18010
24 Ga0081455_10016245 3300005937 Bacteria 7193
25 Ga0081455_10022352 3300005937 Bacteria 5913
26 Ga0081538_10007411 3300005981 Bacteria 9500
27 Ga0081538_10075756 3300005981 Bacteria 1823
28 Ga0081539_10051705 3300005985 Bacteria 2313
29 Ga0070717_10077724 3300006028 Bacteria 2780
30 Ga0070717_10154954 3300006028 Bacteria 1984
31 Ga0075362_10002877 3300006177 Bacteria 5888
32 Ga0075367_10082839 3300006178 Bacteria 1942
33 Ga0075369_10000626 3300006186 Bacteria 11209
34 Ga0075428_100086633 3300006844 Bacteria 3416
35 Ga0075430_100043138 3300006846 Bacteria 3812
36 Ga0075431_100074767 3300006847 Bacteria 3496
37 Ga0075431_100098587 3300006847 Bacteria 3017
38 Ga0097620_100093825 3300006931 Bacteria 3052
39 Ga0099794_10009473 3300007265 Bacteria 4097
40 Ga0099794_10018936 3300007265 Bacteria 3094
41 Ga0099794_10039520 3300007265 Bacteria 2240
42 Ga0105240_10019774 3300009093 Bacteria 8993
43 Ga0105240_10191186 3300009093 Bacteria 2407
44 Ga0114129_10025773 3300009147 Bacteria 8328
45 Ga0114129_10054126 3300009147 Bacteria 5627
46 Ga0105238_10090619 3300009551 Bacteria 3045
47 Ga0105239_10092474 3300010375 Bacteria 3339
48 Ga0105239_10208904 3300010375 Bacteria 2188
49 Ga0157370_10013910 3300013104 Bacteria 8263
50 Ga0157370_10014774 3300013104 Bacteria 7969
51 Ga0157369_10255304 3300013105 Bacteria 1829
52 Ga0157374_10087050 3300013296 Bacteria 2973
53 Ga0163163_10066756 3300014325 Bacteria 3574
54 Ga0157379_10051694 3300014968 Bacteria 3670
55 Ga0163161_10125120 3300017792 Bacteria 1935
56 Ga0209676_1003821 3300025292 Bacteria 8871
57 Ga0209758_1000048 3300025297 Bacteria 358400
58 Ga0209050_1005599 3300025298 Bacteria 7798
59 Ga0209257_1000237 3300025304 Bacteria 128812
60 Ga0207705_10076799 3300025909 Bacteria 2429
61 Ga0207684_10136594 3300025910 Bacteria 2106
62 Ga0207707_10001444 3300025912 Bacteria 21971
63 Ga0207707_10112417 3300025912 Bacteria 2381
64 Ga0207695_10022760 3300025913 Bacteria 7101
65 Ga0207695_10140807 3300025913 Bacteria 2361
66 Ga0207660_10084807 3300025917 Bacteria 2335
67 Ga0207660_10180092 3300025917 Bacteria 1641
68 Ga0207652_10011845 3300025921 Bacteria 7035
69 Ga0207652_10102712 3300025921 Bacteria 2527
70 Ga0207652_10105004 3300025921 Bacteria 2499
71 Ga0207650_10166343 3300025925 Bacteria 1750
72 Ga0207664_10041143 3300025929 Bacteria 3599
73 Ga0207664_10136883 3300025929 Bacteria 2068
74 Ga0207690_10083436 3300025932 Bacteria 2237
75 Ga0207679_10054501 3300025945 Bacteria 2944
76 Ga0207667_10022864 3300025949 Bacteria 6895
77 Ga0207667_10236569 3300025949 Bacteria 1869
78 Ga0209588_1006427 3300027671 Bacteria 3416
79 Ga0207428_10000198 3300027907 Bacteria 84187
80 Ga0207428_10064396 3300027907 Bacteria 2894
81 Ga0268266_10030707 3300028379 Bacteria 4564
82 Ga0268266_10127418 3300028379 Bacteria 2273
83 Ga0268265_10009305 3300028380 Bacteria 6640
84 Ga0265338_10027320 3300028800 Bacteria 5728
85 Ga0265324_10001197 3300029957 Bacteria 15415
86 Ga0265339_10023311 3300031249 Bacteria 3580
87 Ga0265331_10000429 3300031250 Bacteria 41667
88 Ga0265331_10001208 3300031250 Bacteria 19480
89 Ga0265331_10004077 3300031250 Bacteria 9188
90 Ga0265331_10009261 3300031250 Bacteria 5546
91 Ga0307513_10256199 3300031456 Bacteria 1543
92 Ga0307509_10009184 3300031507 Bacteria 12413
93 Ga0307509_10135023 3300031507 Bacteria 2414
94 Ga0265313_10001353 3300031595 Bacteria 23081
95 Ga0265314_10003394 3300031711 Bacteria 15435
96 Ga0265314_10004885 3300031711 Bacteria 12258
97 Ga0265314_10023677 3300031711 Bacteria 4675
98 Ga0265342_10030510 3300031712 Bacteria 3340
99 Ga0307516_10120834 3300031730 Bacteria 2410
100 Ga0307409_100027073 3300031995 Bacteria 4057
101 Ga0373931_0017925 3300035691 Bacteria 3512
102 Ga0373927_0062866 3300035695 Bacteria 2401
103 Ga0373933_0026192 3300035724 Bacteria 3348
104 Ga0373937_0000528 3300036401 Bacteria 34160
105 Ga0373937_0012782 3300036401 Bacteria 7391
106 Ga0373937_0236970 3300036401 Bacteria 1719
107 Ga0395899_0003694 3300037312 Bacteria 12111
108 Ga0395899_0044014 3300037312 Bacteria 3327
109 Ga0395900_0002025 3300037418 Bacteria 22792
110 Ga0395900_0004469 3300037418 Bacteria 14817
111 Ga0395900_0084965 3300037418 Bacteria 3253
112 Ga0395898_0003557 3300037466 Bacteria 17370
113 Ga0395898_0005089 3300037466 Bacteria 14247
114 Ga0395898_0006305 3300037466 Bacteria 12673
115 Ga0436364_1417642 3300037853 Bacteria 2123
116 Ga0395901_0002050 3300038443 Bacteria 20652
117 Ga0395901_0008835 3300038443 Bacteria 10198
118 Ga0395901_0018090 3300038443 Bacteria 7192
119 Ga0400483_052451 3300039062 Bacteria 2266
120 Ga0400483_148884 3300039062 Bacteria 14242
121 Ga0400483_163759 3300039062 Bacteria 2794
122 Ga0400483_171838 3300039062 Bacteria 4624
123 Ga0436365_1318739 3300039437 Bacteria 3731
124 Ga0436360_0271023 3300039438 Bacteria 2295
125 Ga0436360_0661371 3300039438 Bacteria 2670
126 Ga0436360_1133449 3300039438 Bacteria 13512
127 Ga0436361_0167365 3300039447 Bacteria 3083
128 Ga0436362_0606275 3300039453 Bacteria 3156
129 Ga0439466_0025203 3300041411 Bacteria 2078
130 Ga0451577_0095766 3300042876 Bacteria 2650
131 Ga0453683_0064529 3300044673 Bacteria 2289
132 Ga0453684_0230486 3300044712 Bacteria 2138
133 Ga0466957_0035006 3300044842 Bacteria 3013
134 Ga0466957_0051188 3300044842 Bacteria 2514
135 Ga0451576_0000040 3300045051 Bacteria 349778
136 Ga0451576_0027780 3300045051 Bacteria 6073
137 Ga0495651_0041482 3300046462 Bacteria 3575
138 Ga0495630_0091307 3300046517 Bacteria 2301
139 Ga0495674_0055066 3300047319 Bacteria 3490
140 Ga0495674_0068272 3300047319 Bacteria 3077
141 Ga0496113_0024480 3300048916 Bacteria 4291
142 Ga0496119_0010137 3300048922 Bacteria 7960
143 Ga0501034_0000983 3300049571 Bacteria 40911
144 Ga0501034_0004140 3300049571 Bacteria 16237
145 Ga0501034_0005313 3300049571 Bacteria 14118
146 Ga0501034_0159107 3300049571 Bacteria 2231
147 Ga0501046_0093869 3300049580 Bacteria 2306
148 Ga0501047_0019394 3300049581 Bacteria 6524
149 Ga0501067_0031850 3300049583 Bacteria 2926
150 Ga0501079_0006842 3300049741 Bacteria 8584
151 Ga0501080_0062459 3300049742 Bacteria 3467
152 Ga0501083_0031402 3300049744 Bacteria 3645
153 Ga0501044_0033110 3300049823 Bacteria 5431
154 nmdc:mga05p37_30296_c1 3300050507 Bacteria 6601
155 nmdc:mga05p37_34029_c1 3300050507 Bacteria 6241
156 nmdc:mga09592_84901_c1 3300050508 Bacteria 2700
157 nmdc:mga0qj67_23866_c1 3300050509 Bacteria 4710
158 nmdc:mga0qj67_3747_c1 3300050509 Bacteria 10979
159 nmdc:mga06r32_104138_c1 3300050510 Bacteria 2787
160 nmdc:mga06r32_109110_c1 3300050510 Bacteria 2722
161 nmdc:mga08y16_160_c1 3300050511 Bacteria 58113
162 nmdc:mga08y16_25168_c1 3300050511 Bacteria 6277
163 nmdc:mga08x19_19203_c1 3300050514 Bacteria 4192
164 nmdc:mga0sz30_417_c1 3300050516 Bacteria 16156
165 Ga0500578_0047891 3300053086 Bacteria 2742
166 Ga0500651_0068998 3300053093 Bacteria 2201
167 Ga0500641_0000868 3300053096 Bacteria 10795
168 Ga0500641_0010839 3300053096 Bacteria 3303
169 Ga0500618_001452 3300053125 Bacteria 10537
170 Ga0500588_0000171 3300053146 Bacteria 8778
171 Ga0500616_0002100 3300053153 Bacteria 17367
172 Ga0500616_0008652 3300053153 Bacteria 6295
173 Ga0500616_0016685 3300053153 Bacteria 4175
174 Ga0500636_0006556 3300053177 Bacteria 6685
175 Ga0500637_0005525 3300053178 Bacteria 6128
176 Ga0500609_001089 3300053731 Bacteria 4060
177 Ga0500601_001238 3300053737 Bacteria 2832
178 Ga0501084_0033892 3300054114 Bacteria 4271
179 Ga0501082_0001138 3300060353 Bacteria 23485
180 Ga0501082_0035380 3300060353 Bacteria 4304

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005445 Ga0070708_100003909 Ga0070708_1000039096 466
2 3300007265 Ga0099794_10018936 Ga0099794_100189362 466
3 3300007265 Ga0099794_10039520 Ga0099794_100395202 466
4 3300025910 Ga0207684_10136594 Ga0207684_101365941 466
5 3300027671 Ga0209588_1006427 Ga0209588_10064272 466
6 3300005445 Ga0070708_100010727 Ga0070708_1000107274 467
7 3300005518 Ga0070699_100002976 Ga0070699_1000029767 467
8 3300005536 Ga0070697_100036903 Ga0070697_1000369032 467
9 3300005981 Ga0081538_10007411 Ga0081538_100074116 468
10 3300005356 Ga0070674_100006630 Ga0070674_1000066306 470
11 3300028380 Ga0268265_10009305 Ga0268265_100093052 470
12 3300039438 Ga0436360_0271023 Ga0436360_0271023_18_1430 470
13 3300044842 Ga0466957_0051188 Ga0466957_0051188_136_1554 471
14 3300009147 Ga0114129_10054126 Ga0114129_100541264 472
15 3300050507 nmdc:mga05p37_30296_c1 nmdc:mga05p37_30296_c1_342_1820 472
16 3300050508 nmdc:mga09592_84901_c1 nmdc:mga09592_84901_c1_1111_2589 472
17 3300050511 nmdc:mga08y16_25168_c1 nmdc:mga08y16_25168_c1_4744_6204 474
18 3300027907 Ga0207428_10064396 Ga0207428_100643963 475
19 3300036401 Ga0373937_0236970 Ga0373937_0236970_201_1673 478
20 3300005937 Ga0081455_10016245 Ga0081455_100162452 480
21 3300005981 Ga0081538_10075756 Ga0081538_100757561 480
22 3300006177 Ga0075362_10002877 Ga0075362_100028775 480
23 3300006186 Ga0075369_10000626 Ga0075369_100006262 480
24 3300025945 Ga0207679_10054501 Ga0207679_100545011 480
25 3300039438 Ga0436360_1133449 Ga0436360_1133449_6453_7895 480
26 iso_pu_bacteria 2524023250 2524612226 480
27 3300005985 Ga0081539_10051705 Ga0081539_100517052 481
28 3300006028 Ga0070717_10077724 Ga0070717_100777242 481
29 3300049571 Ga0501034_0000983 Ga0501034_0000983_18766_20211 481
30 3300005327 Ga0070658_10002658 Ga0070658_1000265810 482
31 3300005336 Ga0070680_100009307 Ga0070680_1000093074 482
32 3300005458 Ga0070681_10001269 Ga0070681_1000126916 482
33 3300005471 Ga0070698_100005130 Ga0070698_1000051308 482
34 3300005530 Ga0070679_100001788 Ga0070679_1000017885 482
35 3300005563 Ga0068855_100005205 Ga0068855_10000520512 482
36 3300005617 Ga0068859_100093825 Ga0068859_1000938252 482
37 3300005937 Ga0081455_10001171 Ga0081455_1000117111 482
38 3300006178 Ga0075367_10082839 Ga0075367_100828391 482
39 3300006931 Ga0097620_100093825 Ga0097620_1000938252 482
40 3300007265 Ga0099794_10009473 Ga0099794_100094732 482
41 3300009093 Ga0105240_10019774 Ga0105240_100197745 482
42 3300009551 Ga0105238_10090619 Ga0105238_100906192 482
43 3300010375 Ga0105239_10208904 Ga0105239_102089043 482
44 3300013104 Ga0157370_10013910 Ga0157370_100139104 482
45 3300025913 Ga0207695_10022760 Ga0207695_100227603 482
46 3300025921 Ga0207652_10105004 Ga0207652_101050042 482
47 3300025925 Ga0207650_10166343 Ga0207650_101663432 482
48 3300025932 Ga0207690_10083436 Ga0207690_100834361 482
49 3300025949 Ga0207667_10236569 Ga0207667_102365691 482
50 3300028379 Ga0268266_10030707 Ga0268266_100307073 482
51 3300028379 Ga0268266_10127418 Ga0268266_101274182 482
52 3300031250 Ga0265331_10004077 Ga0265331_100040777 482
53 3300035691 Ga0373931_0017925 Ga0373931_0017925_893_2341 482
54 3300037312 Ga0395899_0003694 Ga0395899_0003694_7906_9354 482
55 3300037418 Ga0395900_0002025 Ga0395900_0002025_5659_7107 482
56 3300037418 Ga0395900_0004469 Ga0395900_0004469_10240_11688 482
57 3300037466 Ga0395898_0003557 Ga0395898_0003557_10316_11764 482
58 3300037466 Ga0395898_0006305 Ga0395898_0006305_3511_4959 482
59 3300038443 Ga0395901_0002050 Ga0395901_0002050_13520_14968 482
60 3300038443 Ga0395901_0008835 Ga0395901_0008835_5722_7170 482
61 3300038443 Ga0395901_0018090 Ga0395901_0018090_3224_4672 482
62 3300039437 Ga0436365_1318739 Ga0436365_1318739_1945_3393 482
63 3300044842 Ga0466957_0035006 Ga0466957_0035006_839_2287 482
64 3300049571 Ga0501034_0005313 Ga0501034_0005313_1426_2874 482
65 3300049583 Ga0501067_0031850 Ga0501067_0031850_1376_2824 482
66 3300049744 Ga0501083_0031402 Ga0501083_0031402_621_2069 482
67 3300050516 nmdc:mga0sz30_417_c1 nmdc:mga0sz30_417_c1_2633_4081 482
68 3300053093 Ga0500651_0068998 Ga0500651_0068998_705_2153 482
69 3300053153 Ga0500616_0002100 Ga0500616_0002100_13747_15195 482
70 3300053178 Ga0500637_0005525 Ga0500637_0005525_1328_2779 482
71 3300060353 Ga0501082_0035380 Ga0501082_0035380_2408_3856 482
72 3300005458 Ga0070681_10010546 Ga0070681_1001054610 483
73 3300005530 Ga0070679_100000716 Ga0070679_1000007162 483
74 3300005530 Ga0070679_100149631 Ga0070679_1001496312 483
75 3300005614 Ga0068856_100059593 Ga0068856_1000595931 483
76 3300006028 Ga0070717_10154954 Ga0070717_101549542 483
77 3300009093 Ga0105240_10191186 Ga0105240_101911862 483
78 3300013104 Ga0157370_10014774 Ga0157370_100147749 483
79 3300013105 Ga0157369_10255304 Ga0157369_102553042 483
80 3300013296 Ga0157374_10087050 Ga0157374_100870503 483
81 3300014325 Ga0163163_10066756 Ga0163163_100667562 483
82 3300025909 Ga0207705_10076799 Ga0207705_100767992 483
83 3300025912 Ga0207707_10001444 Ga0207707_1000144413 483
84 3300025912 Ga0207707_10112417 Ga0207707_101124172 483
85 3300025913 Ga0207695_10140807 Ga0207695_101408072 483
86 3300025917 Ga0207660_10084807 Ga0207660_100848072 483
87 3300025917 Ga0207660_10180092 Ga0207660_101800921 483
88 3300025921 Ga0207652_10011845 Ga0207652_100118453 483
89 3300025921 Ga0207652_10102712 Ga0207652_101027122 483
90 3300025929 Ga0207664_10041143 Ga0207664_100411434 483
91 3300025929 Ga0207664_10136883 Ga0207664_101368832 483
92 3300028800 Ga0265338_10027320 Ga0265338_100273204 483
93 3300035695 Ga0373927_0062866 Ga0373927_0062866_862_2313 483
94 3300035724 Ga0373933_0026192 Ga0373933_0026192_1319_2770 483
95 3300036401 Ga0373937_0000528 Ga0373937_0000528_27609_29060 483
96 3300036401 Ga0373937_0012782 Ga0373937_0012782_1072_2523 483
97 3300037418 Ga0395900_0084965 Ga0395900_0084965_946_2397 483
98 3300039447 Ga0436361_0167365 Ga0436361_0167365_1595_3049 483
99 3300045051 Ga0451576_0027780 Ga0451576_0027780_4359_5810 483
100 3300046462 Ga0495651_0041482 Ga0495651_0041482_952_2403 483
101 3300047319 Ga0495674_0068272 Ga0495674_0068272_1174_2625 483
102 3300048916 Ga0496113_0024480 Ga0496113_0024480_1930_3387 483
103 3300048922 Ga0496119_0010137 Ga0496119_0010137_4344_5795 483
104 3300049571 Ga0501034_0159107 Ga0501034_0159107_385_1836 483
105 3300050514 nmdc:mga08x19_19203_c1 nmdc:mga08x19_19203_c1_1449_2915 483
106 3300053146 Ga0500588_0000171 Ga0500588_0000171_2865_4319 483
107 3300053737 Ga0500601_001238 Ga0500601_001238_296_1783 483
108 3300005563 Ga0068855_100024602 Ga0068855_1000246022 484
109 3300014968 Ga0157379_10051694 Ga0157379_100516943 484
110 3300025949 Ga0207667_10022864 Ga0207667_100228645 484
111 3300029957 Ga0265324_10001197 Ga0265324_100011974 484
112 3300031250 Ga0265331_10000429 Ga0265331_1000042935 484
113 3300031250 Ga0265331_10009261 Ga0265331_100092613 484
114 3300031711 Ga0265314_10004885 Ga0265314_100048853 484
115 3300037466 Ga0395898_0005089 Ga0395898_0005089_12646_14121 484
116 3300037853 Ga0436364_1417642 Ga0436364_1417642_268_1722 484
117 3300042876 Ga0451577_0095766 Ga0451577_0095766_817_2277 484
118 3300044673 Ga0453683_0064529 Ga0453683_0064529_678_2138 484
119 3300044712 Ga0453684_0230486 Ga0453684_0230486_116_1573 484
120 3300045051 Ga0451576_0000040 Ga0451576_0000040_29302_30759 484
121 3300047319 Ga0495674_0055066 Ga0495674_0055066_18_1472 484
122 3300006844 Ga0075428_100086633 Ga0075428_1000866332 485
123 3300006846 Ga0075430_100043138 Ga0075430_1000431382 485
124 3300006847 Ga0075431_100074767 Ga0075431_1000747674 485
125 3300006847 Ga0075431_100098587 Ga0075431_1000985873 485
126 3300039062 Ga0400483_052451 Ga0400483_052451_323_1780 485
127 3300039062 Ga0400483_148884 Ga0400483_148884_12573_14030 485
128 3300039062 Ga0400483_163759 Ga0400483_163759_411_1868 485
129 3300039062 Ga0400483_171838 Ga0400483_171838_2619_4076 485
130 3300050509 nmdc:mga0qj67_23866_c1 nmdc:mga0qj67_23866_c1_1944_3404 485
131 3300050509 nmdc:mga0qj67_3747_c1 nmdc:mga0qj67_3747_c1_779_2239 485
132 3300050510 nmdc:mga06r32_104138_c1 nmdc:mga06r32_104138_c1_607_2067 485
133 3300050510 nmdc:mga06r32_109110_c1 nmdc:mga06r32_109110_c1_687_2147 485
134 iso_pu_bacteria 2829745981 2829747353 485
135 iso_pu_bacteria 2861691609 2861693589 485
136 3300017792 Ga0163161_10125120 Ga0163161_101251202 486
137 3300037312 Ga0395899_0044014 Ga0395899_0044014_364_1845 486
138 3300039453 Ga0436362_0606275 Ga0436362_0606275_691_2151 486
139 3300009147 Ga0114129_10025773 Ga0114129_100257732 487
140 3300027907 Ga0207428_10000198 Ga0207428_1000019843 487
141 3300031507 Ga0307509_10009184 Ga0307509_100091842 487
142 3300031507 Ga0307509_10135023 Ga0307509_101350232 487
143 3300031730 Ga0307516_10120834 Ga0307516_101208342 487
144 3300031995 Ga0307409_100027073 Ga0307409_1000270733 487
145 3300039438 Ga0436360_0661371 Ga0436360_0661371_687_2150 487
146 3300046517 Ga0495630_0091307 Ga0495630_0091307_573_2036 487
147 3300050507 nmdc:mga05p37_34029_c1 nmdc:mga05p37_34029_c1_379_1842 487
148 3300050511 nmdc:mga08y16_160_c1 nmdc:mga08y16_160_c1_13411_14874 487
149 3300053177 Ga0500636_0006556 Ga0500636_0006556_4035_5510 487
150 iso_pu_bacteria 2883291878 2883293550 487
151 3300031711 Ga0265314_10003394 Ga0265314_100033943 488
152 3300053125 Ga0500618_001452 Ga0500618_001452_2162_3631 488
153 3300005937 Ga0081455_10003510 Ga0081455_1000351018 489
154 3300005937 Ga0081455_10022352 Ga0081455_100223524 489
155 3300031249 Ga0265339_10023311 Ga0265339_100233113 489
156 3300031250 Ga0265331_10001208 Ga0265331_100012086 489
157 3300031595 Ga0265313_10001353 Ga0265313_1000135319 489
158 3300031711 Ga0265314_10023677 Ga0265314_100236774 489
159 3300031712 Ga0265342_10030510 Ga0265342_100305101 489
160 3300041411 Ga0439466_0025203 Ga0439466_0025203_392_1879 489
161 3300049580 Ga0501046_0093869 Ga0501046_0093869_236_1726 489
162 3300049741 Ga0501079_0006842 Ga0501079_0006842_2914_4404 489
163 3300049742 Ga0501080_0062459 Ga0501080_0062459_570_2039 489
164 3300053153 Ga0500616_0008652 Ga0500616_0008652_965_2446 489
165 3300060353 Ga0501082_0001138 Ga0501082_0001138_4214_5704 489
166 3300005445 Ga0070708_100045735 Ga0070708_1000457353 490
167 3300005471 Ga0070698_100138387 Ga0070698_1001383872 490
168 3300010375 Ga0105239_10092474 Ga0105239_100924742 490
169 3300049571 Ga0501034_0004140 Ga0501034_0004140_9112_10590 490
170 3300053096 Ga0500641_0000868 Ga0500641_0000868_4842_6542 490
171 3300003215 JGI25153J46596_10000048 JGI25153J46596_10000048111 491
172 3300003794 Ga0055531_10010883 Ga0055531_100108832 491
173 3300025292 Ga0209676_1003821 Ga0209676_10038218 491
174 3300025297 Ga0209758_1000048 Ga0209758_1000048321 491
175 3300025298 Ga0209050_1005599 Ga0209050_10055993 491
176 3300025304 Ga0209257_1000237 Ga0209257_100023756 491
177 3300031456 Ga0307513_10256199 Ga0307513_102561991 491
178 3300049581 Ga0501047_0019394 Ga0501047_0019394_3558_5033 491
179 3300049823 Ga0501044_0033110 Ga0501044_0033110_1704_3179 491
180 3300053086 Ga0500578_0047891 Ga0500578_0047891_126_1601 491
181 3300053096 Ga0500641_0010839 Ga0500641_0010839_171_1646 491
182 3300053153 Ga0500616_0016685 Ga0500616_0016685_492_1967 491
183 3300053731 Ga0500609_001089 Ga0500609_001089_1570_3045 491
184 3300054114 Ga0501084_0033892 Ga0501084_0033892_45_1520 491

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02934

GatB_N

GatB/GatE catalytic domain

97

380

0.98

PF02637

GatB_Yqey

GatB domain

419

564

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4wj3-assembly2.cif.gz_H crystal structure of the asparagine transamidosome from pseudomonas aeruginosa 0.9394 19 416
3h0l-assembly2.cif.gz_E structure of trna-dependent amidotransferase gatcab from aquifex aeolicus 0.9094 19 426
4n0i-assembly1.cif.gz_B crystal structure of s. cerevisiae mitochondrial gatfab in complex with glutamine 0.9083 20 314
2g5h-assembly1.cif.gz_B structure of trna-dependent amidotransferase gatcab 0.904 20 410
3h0l-assembly2.cif.gz_E structure of trna-dependent amidotransferase gatcab from aquifex aeolicus 0.9032 19 426
ID Description Score Start End Superfamily
af_Q2R2Z0_480_542_1.10.10.410 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; 0.9928 429 491 1.10.10.410
af_I1K5J4_480_543_1.10.10.410 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; 0.9914 429 491 1.10.10.410
af_I1KQC8_485_546_1.10.10.410 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; 0.9914 429 489 1.10.10.410
af_Q2R2Z0_480_542_1.10.10.410 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; 0.9774 429 491 1.10.10.410
af_I1K5J4_480_543_1.10.10.410 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; 0.9612 429 491 1.10.10.410
ID Description Score Start End GO Terms
AF-A0A7C1U5C9-F1-model_v4 Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase GatCAB subunit B (EC 6.3.5.-) 0.983 11 244 GO:0005524
GO:0006412
GO:0050567
GO:0070681
AF-A0A4Q3W4I9-F1-model_v4 Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase GatCAB subunit B (EC 6.3.5.-) 0.9822 19 226 GO:0005524
GO:0006412
GO:0016740
GO:0050567
GO:0070681
AF-A0A383DV80-F1-model_v4 Aspartyl/Glutamyl-tRNA(Gln) amidotransferase subunit B/E catalytic domain-containing protein 0.9794 29 137 GO:0005524
GO:0006412
GO:0050567
GO:0070681
AF-A0A3D2EUX3-F1-model_v4 Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase GatCAB subunit B (EC 6.3.5.-) 0.9789 19 193 GO:0005524
GO:0006412
GO:0016740
GO:0050567
GO:0070681
AF-A0A660LWG7-F1-model_v4 Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatB 0.9782 29 146 GO:0005524
GO:0006412
GO:0016740
GO:0050567
GO:0070681

Feature Viewer

pLDDT pTM Quality
89.32 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map