F283984

General Info

Members Datasets Scaffolds Average Seq Length
185 142 183 372

Family's Representative Sequence

Representative Sequence 3300005535|Ga0070684_100046999|Ga0070684_1000469992
Length 403
Sequence VLSTESRLTFELLHRDGAARRGRVTTPHGTIETPVFMPVGTLASVKSLTTDQLKQLGSTQHSALSTQHSPDRDSGPEIILNNTYHLMLRPGAELLEKLGGVHRFMGWDRAVLSDSGGFQVFSLANIRKVREEGVEFRSHLDGSAHFLSPETSLDIQTRMGVDIAMAFDECPPYGIPHADVERSMEMTHRWARRSLAARDALADARGKAPALFGIVQGGIHLDLRTRSAAAIAELPFDGIAIGGVSVGEPKEEMLAVMRHTAPLLPADRPRYLMGVGTPQDLLDGVAAGIDMFDCVMPTRNARNGSLFTSEGKVAIKNARYAADERPLDPACRCVTCRTVSRAYLRHLFMTGEIAASVYNTIHNVSFYLDLMRGVRQAIASNSFGAFRETFLSRFAGSRADEGP

Samples

Sample ID Description Type Environment
1 2920107658 Aquisphaera insulae JC669 Isolate Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
36 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
46 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
47 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
48 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
49 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
50 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
51 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
52 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
75 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
76 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
77 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
78 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
79 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
80 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
81 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
82 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
83 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
84 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
85 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
86 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
87 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
88 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
89 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
90 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
91 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
92 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
93 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
94 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
95 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
96 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
97 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
98 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
99 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
100 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
101 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
102 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
103 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
104 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
105 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
106 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
107 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
108 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
109 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
110 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
111 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
112 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
113 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
114 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
120 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
121 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
122 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
123 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
124 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
125 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
126 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
127 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
128 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
129 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
130 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
132 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
133 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
134 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
135 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
136 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
137 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
138 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
139 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
140 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
141 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
142 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.92
Metatranscriptomes 0
Isolates 1.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.54
Nodule 0
Rhizoplane 3.78
Rhizosphere 91.35
Stem 0
Stem Tuber 0
Unclassified 4.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10103787 3300005293 Bacteria 3009
2 Ga0065707_10000867 3300005295 Bacteria 13298
3 Ga0070658_10007647 3300005327 Bacteria 8714
4 Ga0070683_100000022 3300005329 Bacteria 180088
5 Ga0070683_100144695 3300005329 Bacteria 2252
6 Ga0070670_100035451 3300005331 Bacteria 4295
7 Ga0068869_100017524 3300005334 Bacteria 4856
8 Ga0070682_100000021 3300005337 Bacteria 215101
9 Ga0068868_100026287 3300005338 Bacteria 4434
10 Ga0070689_100005520 3300005340 Bacteria 8647
11 Ga0070689_100019004 3300005340 Bacteria 5075
12 Ga0070675_100000003 3300005354 Bacteria 422595
13 Ga0070667_100028869 3300005367 Bacteria 4618
14 Ga0070705_100007843 3300005440 Bacteria 5272
15 Ga0070694_100009553 3300005444 Bacteria 5951
16 Ga0070694_100022851 3300005444 Bacteria 4013
17 Ga0070708_100164084 3300005445 Bacteria 2071
18 Ga0070678_100053048 3300005456 Bacteria 2947
19 Ga0070706_100005294 3300005467 Bacteria 12298
20 Ga0070706_100026658 3300005467 Bacteria 5317
21 Ga0070698_100033059 3300005471 Bacteria 5358
22 Ga0070698_100033689 3300005471 Bacteria 5306
23 Ga0070698_100066186 3300005471 Bacteria 3638
24 Ga0070698_100319356 3300005471 Bacteria 1484
25 Ga0070698_100335197 3300005471 Bacteria 1444
26 Ga0070699_100138147 3300005518 Bacteria 2150
27 Ga0070699_100153067 3300005518 Bacteria 2040
28 Ga0070684_100007998 3300005535 Bacteria 8255
29 Ga0070684_100046999 3300005535 Bacteria 3741
30 Ga0070697_100112283 3300005536 Bacteria 2272
31 Ga0070672_100000220 3300005543 Bacteria 31698
32 Ga0070672_100112442 3300005543 Bacteria 2221
33 Ga0070696_100028002 3300005546 Bacteria 3844
34 Ga0070704_100008363 3300005549 Bacteria 6200
35 Ga0070664_100011564 3300005564 Bacteria 7160
36 Ga0068857_100085882 3300005577 Bacteria 2813
37 Ga0068859_100051797 3300005617 Bacteria 4127
38 Ga0068864_100000001 3300005618 Bacteria 686767
39 Ga0068864_100171871 3300005618 Bacteria 1976
40 Ga0068861_100004968 3300005719 Bacteria 8958
41 Ga0068863_100021029 3300005841 Bacteria 6233
42 Ga0068858_100001005 3300005842 Bacteria 29049
43 Ga0070717_10000246 3300006028 Bacteria 37200
44 Ga0070716_100037884 3300006173 Bacteria 2667
45 Ga0070716_100095172 3300006173 Bacteria 1812
46 Ga0075428_100007773 3300006844 Bacteria 11884
47 Ga0075428_100059192 3300006844 Bacteria 4195
48 Ga0075431_100000712 3300006847 Bacteria 28698
49 Ga0075431_100236649 3300006847 Bacteria 1859
50 Ga0075431_100320304 3300006847 Bacteria 1564
51 Ga0075433_10001239 3300006852 Bacteria 18627
52 Ga0075433_10083640 3300006852 Bacteria 2817
53 Ga0075433_10105728 3300006852 Bacteria 2494
54 Ga0075434_100007325 3300006871 Bacteria 10211
55 Ga0075436_100000788 3300006914 Bacteria 21024
56 Ga0097620_100051797 3300006931 Bacteria 4127
57 Ga0075435_100001018 3300007076 Bacteria 17771
58 Ga0075435_100043775 3300007076 Bacteria 3585
59 Ga0105245_10000265 3300009098 Bacteria 49963
60 Ga0105245_10000716 3300009098 Bacteria 29866
61 Ga0114129_10054946 3300009147 Bacteria 5582
62 Ga0114129_10155019 3300009147 Bacteria 3133
63 Ga0114129_10324987 3300009147 Bacteria 2044
64 Ga0114129_10355553 3300009147 Bacteria 1939
65 Ga0114129_10576331 3300009147 Unclassified 1461
66 Ga0105242_10004046 3300009176 Bacteria 11389
67 Ga0105238_10000029 3300009551 Bacteria 182309
68 Ga0157373_10031660 3300013100 Bacteria 3807
69 Ga0157378_10017565 3300013297 Bacteria 6279
70 Ga0157378_10026702 3300013297 Bacteria 5090
71 Ga0163162_10009237 3300013306 Bacteria 9592
72 Ga0163162_10091571 3300013306 Bacteria 3124
73 Ga0157375_10000005 3300013308 Bacteria 429412
74 Ga0157375_10000758 3300013308 Bacteria 28335
75 Ga0157377_10000159 3300014745 Bacteria 41530
76 Ga0213873_10003923 3300021358 Bacteria 2727
77 Ga0213876_10000019 3300021384 Bacteria 279426
78 Ga0213876_10006035 3300021384 Bacteria 6621
79 Ga0207655_1031794 3300025728 Bacteria 2424
80 Ga0207643_10009214 3300025908 Bacteria 5301
81 Ga0207705_10049582 3300025909 Bacteria 3022
82 Ga0207684_10042076 3300025910 Bacteria 3872
83 Ga0207684_10043731 3300025910 Bacteria 3798
84 Ga0207659_10000006 3300025926 Bacteria 384976
85 Ga0207687_10000360 3300025927 Bacteria 30423
86 Ga0207687_10000554 3300025927 Bacteria 25142
87 Ga0207686_10006286 3300025934 Bacteria 6390
88 Ga0207670_10000511 3300025936 Bacteria 21359
89 Ga0207665_10008984 3300025939 Bacteria 6558
90 Ga0207665_10019732 3300025939 Bacteria 4431
91 Ga0207691_10001049 3300025940 Bacteria 27452
92 Ga0207689_10254568 3300025942 Bacteria 1452
93 Ga0207640_10236307 3300025981 Bacteria 1409
94 Ga0207677_10000003 3300026023 Bacteria 450061
95 Ga0207703_10000727 3300026035 Bacteria 32409
96 Ga0207639_10048881 3300026041 Bacteria 3204
97 Ga0207648_10259321 3300026089 Bacteria 1551
98 Ga0207676_10000002 3300026095 Bacteria 1198607
99 Ga0207676_10035856 3300026095 Bacteria 3769
100 Ga0207674_10029673 3300026116 Bacteria 5756
101 Ga0207675_100023205 3300026118 Bacteria 5769
102 Ga0209984_1003025 3300027424 Bacteria 1902
103 Ga0209971_1012208 3300027682 Bacteria 2033
104 Ga0209974_10011580 3300027876 Bacteria 2960
105 Ga0307515_10000037 3300028794 Bacteria 331970
106 Ga0307511_10003270 3300030521 Bacteria 16657
107 Ga0307405_10165783 3300031731 Bacteria 1570
108 Ga0307411_10061950 3300032005 Bacteria 2493
109 Ga0307415_100003206 3300032126 Bacteria 8300
110 Ga0373932_0000958 3300035112 Bacteria 8436
111 Ga0373936_0030616 3300035113 Bacteria 2122
112 Ga0373943_0108912 3300035170 Bacteria 1458
113 Ga0373931_0099966 3300035691 Bacteria 1630
114 Ga0373947_0096127 3300035725 Bacteria 1854
115 Ga0373937_0357782 3300036401 Bacteria 1383
116 Ga0373925_0000496 3300037068 Bacteria 39630
117 Ga0436364_0964398 3300037853 Bacteria 1203
118 Ga0436365_0142374 3300039437 Bacteria 217743
119 Ga0436365_1784003 3300039437 Bacteria 1455
120 Ga0436360_1286234 3300039438 Bacteria 20515
121 Ga0436362_1045489 3300039453 Bacteria 7025
122 Ga0436362_1140730 3300039453 Bacteria 3448
123 Ga0451576_0157271 3300045051 Bacteria 2371
124 Ga0451576_0251122 3300045051 Bacteria 1849
125 Ga0495629_0000005 3300046459 Bacteria 404868
126 Ga0495639_0008894 3300046475 Bacteria 4305
127 Ga0495594_0087224 3300046499 Bacteria 1746
128 Ga0495620_0000336 3300046515 Bacteria 32732
129 Ga0495666_0000821 3300046526 Bacteria 14356
130 Ga0495586_0000279 3300046535 Bacteria 32732
131 Ga0495622_0026624 3300046557 Bacteria 2699
132 Ga0495656_0042586 3300046615 Bacteria 1902
133 Ga0495635_0004687 3300046663 Bacteria 9495
134 Ga0495659_0000180 3300046664 Bacteria 27768
135 Ga0495659_0055426 3300046664 Bacteria 1453
136 Ga0495647_0022658 3300046681 Bacteria 2270
137 Ga0495658_0015318 3300046683 Bacteria 3932
138 Ga0495676_0009284 3300047321 Bacteria 8961
139 Ga0495680_0002121 3300047322 Bacteria 20608
140 Ga0495684_0032567 3300047471 Bacteria 4002
141 Ga0495602_0016437 3300048088 Bacteria 7443
142 Ga0496100_0241903 3300048903 Bacteria 1332
143 Ga0496104_0299775 3300048907 Bacteria 1519
144 Ga0496105_0127942 3300048908 Bacteria 2094
145 Ga0496108_0438807 3300048911 Bacteria 1140
146 Ga0496111_0115984 3300048914 Bacteria 1975
147 Ga0496112_0229993 3300048915 Bacteria 1809
148 Ga0496115_0015605 3300048918 Bacteria 5767
149 Ga0501033_0004288 3300049570 Bacteria 11462
150 Ga0501040_0015775 3300049576 Bacteria 4994
151 Ga0501043_0102561 3300049579 Bacteria 2248
152 Ga0501046_0003904 3300049580 Bacteria 13639
153 Ga0501047_0113180 3300049581 Bacteria 2595
154 Ga0501070_0022915 3300049586 Bacteria 5227
155 Ga0501071_0091435 3300049587 Bacteria 2235
156 Ga0501072_0080635 3300049588 Bacteria 2579
157 Ga0501073_0031192 3300049589 Bacteria 3803
158 Ga0501074_0045746 3300049590 Bacteria 3165
159 Ga0501075_0169412 3300049591 Bacteria 1666
160 Ga0501076_0178387 3300049592 Bacteria 1732
161 Ga0501079_0024325 3300049741 Bacteria 4646
162 Ga0501080_0019893 3300049742 Bacteria 6217
163 Ga0501080_0057542 3300049742 Bacteria 3619
164 Ga0501081_0090552 3300049743 Bacteria 2150
165 Ga0501083_0094620 3300049744 Bacteria 1972
166 Ga0501035_0093266 3300049822 Bacteria 2649
167 Ga0501044_0078389 3300049823 Bacteria 3348
168 nmdc:mga05p37_151585_c1 3300050507 Bacteria 2835
169 nmdc:mga05p37_453239_c1 3300050507 Bacteria 1484
170 nmdc:mga05p37_501125_c1 3300050507 Unclassified 1394
171 nmdc:mga05p37_59583_c1 3300050507 Bacteria 4702
172 nmdc:mga0qj67_213127_c1 3300050509 Bacteria 1568
173 nmdc:mga06r32_388_c1 3300050510 Bacteria 37004
174 nmdc:mga06r32_398494_c1 3300050510 Bacteria 1358
175 nmdc:mga06r32_52487_c1 3300050510 Bacteria 3905
176 nmdc:mga0n895_266062_c1 3300050512 Unclassified 1739
177 nmdc:mga0rr50_26_c1 3300050513 Bacteria 110468
178 nmdc:mga08x19_480_c1 3300050514 Bacteria 26754
179 nmdc:mga0a205_1583_c1 3300050515 Bacteria 19517
180 nmdc:mga0a205_9622_c1 3300050515 Bacteria 8848
181 Ga0495655_0000097 3300053083 Bacteria 16445
182 Ga0500566_0010332 3300053094 Bacteria 5505
183 Ga0530510_0189337 3300061734 Bacteria 1527

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050507 nmdc:mga05p37_501125_c1 nmdc:mga05p37_501125_c1_54_1007 315
2 3300048903 Ga0496100_0241903 Ga0496100_0241903_21_1001 317
3 3300035725 Ga0373947_0096127 Ga0373947_0096127_680_1789 320
4 3300013297 Ga0157378_10017565 Ga0157378_100175651 322
5 3300025939 Ga0207665_10008984 Ga0207665_100089844 322
6 3300005327 Ga0070658_10007647 Ga0070658_100076474 323
7 3300005471 Ga0070698_100335197 Ga0070698_1003351972 323
8 3300013308 Ga0157375_10000758 Ga0157375_100007583 323
9 3300025909 Ga0207705_10049582 Ga0207705_100495823 323
10 3300026041 Ga0207639_10048881 Ga0207639_100488813 323
11 3300005340 Ga0070689_100019004 Ga0070689_1000190043 328
12 3300006028 Ga0070717_10000246 Ga0070717_100002467 328
13 3300032005 Ga0307411_10061950 Ga0307411_100619502 330
14 3300039438 Ga0436360_1286234 Ga0436360_1286234_18320_19351 330
15 3300049591 Ga0501075_0169412 Ga0501075_0169412_55_1101 331
16 3300046515 Ga0495620_0000336 Ga0495620_0000336_11913_13037 332
17 3300049570 Ga0501033_0004288 Ga0501033_0004288_5308_6414 333
18 3300049576 Ga0501040_0015775 Ga0501040_0015775_108_1214 333
19 3300049579 Ga0501043_0102561 Ga0501043_0102561_334_1440 333
20 3300049580 Ga0501046_0003904 Ga0501046_0003904_11997_13103 333
21 3300049581 Ga0501047_0113180 Ga0501047_0113180_1378_2484 333
22 3300049586 Ga0501070_0022915 Ga0501070_0022915_1212_2318 333
23 3300049587 Ga0501071_0091435 Ga0501071_0091435_321_1427 333
24 3300049590 Ga0501074_0045746 Ga0501074_0045746_809_1915 333
25 3300049741 Ga0501079_0024325 Ga0501079_0024325_108_1214 333
26 3300049742 Ga0501080_0057542 Ga0501080_0057542_937_2043 333
27 3300049743 Ga0501081_0090552 Ga0501081_0090552_236_1342 333
28 iso_pu_bacteria 8054563764 8054568824 333
29 3300005471 Ga0070698_100319356 Ga0070698_1003193562 334
30 3300006173 Ga0070716_100037884 Ga0070716_1000378842 334
31 3300006844 Ga0075428_100007773 Ga0075428_1000077737 334
32 3300006844 Ga0075428_100059192 Ga0075428_1000591923 334
33 3300006852 Ga0075433_10001239 Ga0075433_100012397 334
34 3300006852 Ga0075433_10083640 Ga0075433_100836403 334
35 3300007076 Ga0075435_100043775 Ga0075435_1000437752 334
36 3300009147 Ga0114129_10054946 Ga0114129_100549463 334
37 3300009147 Ga0114129_10155019 Ga0114129_101550192 334
38 3300009147 Ga0114129_10324987 Ga0114129_103249872 334
39 3300009147 Ga0114129_10355553 Ga0114129_103555532 334
40 3300009147 Ga0114129_10576331 Ga0114129_105763312 334
41 3300013306 Ga0163162_10091571 Ga0163162_100915713 334
42 3300025939 Ga0207665_10019732 Ga0207665_100197324 334
43 3300031731 Ga0307405_10165783 Ga0307405_101657832 334
44 3300032126 Ga0307415_100003206 Ga0307415_1000032064 334
45 3300035113 Ga0373936_0030616 Ga0373936_0030616_686_1795 334
46 3300035691 Ga0373931_0099966 Ga0373931_0099966_207_1316 334
47 3300036401 Ga0373937_0357782 Ga0373937_0357782_136_1245 334
48 3300039453 Ga0436362_1045489 Ga0436362_1045489_1559_2674 334
49 3300046615 Ga0495656_0042586 Ga0495656_0042586_194_1303 334
50 3300046664 Ga0495659_0055426 Ga0495659_0055426_189_1298 334
51 3300048088 Ga0495602_0016437 Ga0495602_0016437_4286_5401 334
52 3300048907 Ga0496104_0299775 Ga0496104_0299775_237_1331 334
53 3300048908 Ga0496105_0127942 Ga0496105_0127942_970_2064 334
54 3300048911 Ga0496108_0438807 Ga0496108_0438807_114_1124 334
55 3300048914 Ga0496111_0115984 Ga0496111_0115984_597_1691 334
56 3300048918 Ga0496115_0015605 Ga0496115_0015605_114_1208 334
57 3300049588 Ga0501072_0080635 Ga0501072_0080635_20_1129 334
58 3300049592 Ga0501076_0178387 Ga0501076_0178387_238_1347 334
59 3300049822 Ga0501035_0093266 Ga0501035_0093266_999_2102 334
60 3300049823 Ga0501044_0078389 Ga0501044_0078389_55_1158 334
61 3300050507 nmdc:mga05p37_151585_c1 nmdc:mga05p37_151585_c1_1007_2116 334
62 3300050507 nmdc:mga05p37_453239_c1 nmdc:mga05p37_453239_c1_61_1170 334
63 3300050507 nmdc:mga05p37_59583_c1 nmdc:mga05p37_59583_c1_2961_4070 334
64 3300050510 nmdc:mga06r32_52487_c1 nmdc:mga06r32_52487_c1_2657_3766 334
65 3300050512 nmdc:mga0n895_266062_c1 nmdc:mga0n895_266062_c1_267_1376 334
66 3300050515 nmdc:mga0a205_1583_c1 nmdc:mga0a205_1583_c1_9065_10174 334
67 iso_pu_bacteria 2920107658 2920113919 334
68 3300005329 Ga0070683_100144695 Ga0070683_1001446952 336
69 3300005338 Ga0068868_100026287 Ga0068868_1000262872 336
70 3300005367 Ga0070667_100028869 Ga0070667_1000288693 336
71 3300005535 Ga0070684_100007998 Ga0070684_1000079986 336
72 3300005543 Ga0070672_100112442 Ga0070672_1001124422 336
73 3300005564 Ga0070664_100011564 Ga0070664_1000115642 336
74 3300005618 Ga0068864_100171871 Ga0068864_1001718712 336
75 3300005841 Ga0068863_100021029 Ga0068863_1000210295 336
76 3300013100 Ga0157373_10031660 Ga0157373_100316602 336
77 3300026095 Ga0207676_10035856 Ga0207676_100358563 336
78 3300037853 Ga0436364_0964398 Ga0436364_0964398_43_1152 336
79 3300039437 Ga0436365_1784003 Ga0436365_1784003_247_1353 336
80 3300049744 Ga0501083_0094620 Ga0501083_0094620_182_1318 336
81 3300061734 Ga0530510_0189337 Ga0530510_0189337_343_1452 336
82 3300005295 Ga0065707_10000867 Ga0065707_100008678 337
83 3300028794 Ga0307515_10000037 Ga0307515_1000003742 337
84 3300045051 Ga0451576_0157271 Ga0451576_0157271_65_1084 337
85 3300046663 Ga0495635_0004687 Ga0495635_0004687_7926_9047 337
86 3300047322 Ga0495680_0002121 Ga0495680_0002121_271_1392 337
87 3300047471 Ga0495684_0032567 Ga0495684_0032567_2152_3273 337
88 3300005329 Ga0070683_100000022 Ga0070683_100000022116 338
89 3300005331 Ga0070670_100035451 Ga0070670_1000354512 338
90 3300005354 Ga0070675_100000003 Ga0070675_100000003210 338
91 3300005440 Ga0070705_100007843 Ga0070705_1000078433 338
92 3300005444 Ga0070694_100009553 Ga0070694_1000095534 338
93 3300005444 Ga0070694_100022851 Ga0070694_1000228514 338
94 3300005445 Ga0070708_100164084 Ga0070708_1001640841 338
95 3300005456 Ga0070678_100053048 Ga0070678_1000530482 338
96 3300005467 Ga0070706_100005294 Ga0070706_1000052949 338
97 3300005471 Ga0070698_100033059 Ga0070698_1000330596 338
98 3300005471 Ga0070698_100033689 Ga0070698_1000336897 338
99 3300005518 Ga0070699_100138147 Ga0070699_1001381472 338
100 3300005543 Ga0070672_100000220 Ga0070672_1000002208 338
101 3300005546 Ga0070696_100028002 Ga0070696_1000280024 338
102 3300005549 Ga0070704_100008363 Ga0070704_1000083637 338
103 3300005617 Ga0068859_100051797 Ga0068859_1000517972 338
104 3300005618 Ga0068864_100000001 Ga0068864_100000001290 338
105 3300006173 Ga0070716_100095172 Ga0070716_1000951723 338
106 3300006847 Ga0075431_100320304 Ga0075431_1003203042 338
107 3300006852 Ga0075433_10105728 Ga0075433_101057283 338
108 3300006871 Ga0075434_100007325 Ga0075434_1000073258 338
109 3300006931 Ga0097620_100051797 Ga0097620_1000517974 338
110 3300009551 Ga0105238_10000029 Ga0105238_10000029158 338
111 3300013308 Ga0157375_10000005 Ga0157375_10000005383 338
112 3300021358 Ga0213873_10003923 Ga0213873_100039233 338
113 3300021384 Ga0213876_10000019 Ga0213876_10000019117 338
114 3300021384 Ga0213876_10006035 Ga0213876_100060353 338
115 3300025728 Ga0207655_1031794 Ga0207655_10317942 338
116 3300025910 Ga0207684_10042076 Ga0207684_100420764 338
117 3300025910 Ga0207684_10043731 Ga0207684_100437312 338
118 3300025926 Ga0207659_10000006 Ga0207659_10000006159 338
119 3300025940 Ga0207691_10001049 Ga0207691_100010494 338
120 3300025981 Ga0207640_10236307 Ga0207640_102363072 338
121 3300026023 Ga0207677_10000003 Ga0207677_10000003201 338
122 3300026089 Ga0207648_10259321 Ga0207648_102593211 338
123 3300026095 Ga0207676_10000002 Ga0207676_10000002544 338
124 3300027424 Ga0209984_1003025 Ga0209984_10030252 338
125 3300027682 Ga0209971_1012208 Ga0209971_10122082 338
126 3300027876 Ga0209974_10011580 Ga0209974_100115802 338
127 3300030521 Ga0307511_10003270 Ga0307511_1000327015 338
128 3300035170 Ga0373943_0108912 Ga0373943_0108912_111_1262 338
129 3300037068 Ga0373925_0000496 Ga0373925_0000496_18731_19882 338
130 3300039437 Ga0436365_0142374 Ga0436365_0142374_81997_83115 338
131 3300039453 Ga0436362_1140730 Ga0436362_1140730_2181_3299 338
132 3300045051 Ga0451576_0251122 Ga0451576_0251122_134_1237 338
133 3300046459 Ga0495629_0000005 Ga0495629_0000005_357040_358191 338
134 3300046475 Ga0495639_0008894 Ga0495639_0008894_72_1223 338
135 3300046499 Ga0495594_0087224 Ga0495594_0087224_334_1485 338
136 3300046526 Ga0495666_0000821 Ga0495666_0000821_13164_14315 338
137 3300046535 Ga0495586_0000279 Ga0495586_0000279_17549_18700 338
138 3300046557 Ga0495622_0026624 Ga0495622_0026624_591_1742 338
139 3300046664 Ga0495659_0000180 Ga0495659_0000180_24739_25815 338
140 3300046681 Ga0495647_0022658 Ga0495647_0022658_659_1810 338
141 3300046683 Ga0495658_0015318 Ga0495658_0015318_2355_3506 338
142 3300047321 Ga0495676_0009284 Ga0495676_0009284_4358_5509 338
143 3300048915 Ga0496112_0229993 Ga0496112_0229993_605_1777 338
144 3300049589 Ga0501073_0031192 Ga0501073_0031192_1574_2701 338
145 3300049742 Ga0501080_0019893 Ga0501080_0019893_1846_2973 338
146 3300050509 nmdc:mga0qj67_213127_c1 nmdc:mga0qj67_213127_c1_45_1109 338
147 3300050515 nmdc:mga0a205_9622_c1 nmdc:mga0a205_9622_c1_6627_7676 338
148 3300053083 Ga0495655_0000097 Ga0495655_0000097_9289_10392 338
149 3300053094 Ga0500566_0010332 Ga0500566_0010332_1449_2600 338
150 3300006847 Ga0075431_100236649 Ga0075431_1002366491 342
151 3300050510 nmdc:mga06r32_398494_c1 nmdc:mga06r32_398494_c1_120_1265 342
152 3300005577 Ga0068857_100085882 Ga0068857_1000858822 343
153 3300026116 Ga0207674_10029673 Ga0207674_100296733 343
154 3300005337 Ga0070682_100000021 Ga0070682_100000021121 344
155 3300014745 Ga0157377_10000159 Ga0157377_100001597 344
156 3300005334 Ga0068869_100017524 Ga0068869_1000175245 345
157 3300009098 Ga0105245_10000265 Ga0105245_1000026536 345
158 3300013306 Ga0163162_10009237 Ga0163162_100092375 345
159 3300025927 Ga0207687_10000554 Ga0207687_1000055413 345
160 3300025942 Ga0207689_10254568 Ga0207689_102545681 345
161 3300005467 Ga0070706_100026658 Ga0070706_1000266585 347
162 3300005471 Ga0070698_100066186 Ga0070698_1000661864 347
163 3300005518 Ga0070699_100153067 Ga0070699_1001530671 347
164 3300005536 Ga0070697_100112283 Ga0070697_1001122833 347
165 3300006914 Ga0075436_100000788 Ga0075436_10000078814 347
166 3300007076 Ga0075435_100001018 Ga0075435_10000101820 347
167 3300013297 Ga0157378_10026702 Ga0157378_100267023 347
168 3300025908 Ga0207643_10009214 Ga0207643_100092143 347
169 3300035112 Ga0373932_0000958 Ga0373932_0000958_6875_8023 347
170 3300050513 nmdc:mga0rr50_26_c1 nmdc:mga0rr50_26_c1_15686_16837 347
171 3300050514 nmdc:mga08x19_480_c1 nmdc:mga08x19_480_c1_16368_17519 347
172 3300005340 Ga0070689_100005520 Ga0070689_1000055203 350
173 3300005719 Ga0068861_100004968 Ga0068861_1000049683 350
174 3300005842 Ga0068858_100001005 Ga0068858_1000010053 350
175 3300006847 Ga0075431_100000712 Ga0075431_10000071217 350
176 3300009098 Ga0105245_10000716 Ga0105245_100007164 350
177 3300009176 Ga0105242_10004046 Ga0105242_100040465 350
178 3300025927 Ga0207687_10000360 Ga0207687_1000036013 350
179 3300025934 Ga0207686_10006286 Ga0207686_100062863 350
180 3300025936 Ga0207670_10000511 Ga0207670_1000051114 350
181 3300026035 Ga0207703_10000727 Ga0207703_1000072725 350
182 3300026118 Ga0207675_100023205 Ga0207675_1000232055 350
183 3300050510 nmdc:mga06r32_388_c1 nmdc:mga06r32_388_c1_31943_33121 350
184 3300005535 Ga0070684_100046999 Ga0070684_1000469992 353
185 3300005293 Ga0065715_10103787 Ga0065715_101037874 357

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01702

TGT

Queuine tRNA-ribosyltransferase

16

396

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ygv-assembly1.cif.gz_A-2 trna-guanine transglycosylase (tgt) in co-crystallized complex with (e)-n-ethyl-4-oxo-4-phenylbut-2-enamide 0.9637 35 350
5lpo-assembly1.cif.gz_A-2 trna guanine transglycosylase (tgt) in co-crystallized complex with 6-amino-2-(methylamino)-4-(2-((2r,3r,4r,5r)-3,4,5-trimethoxytetrahydrofuran-2-yl)ethyl)-1h-imidazo[4,5-g]quinazolin-8(7h)-one 0.9582 38 350
6yiq-assembly1.cif.gz_A-2 trna-guanine transglycosylase (tgt) in co-crystallized complex (p2) with 6-amino-2-(methylamino)-4-phenethyl-1,7-dihydro-8h-imidazo[4,5-g]quinazolin-8-one 0.9579 38 351
7a6d-assembly1.cif.gz_A-2 trna-guanine transglycosylase c158s/c281s/y330c/h333a mutant in complex with rac-trans-4,4-difluorocyclopentane-1,2-diol 0.9571 35 350
5lpt-assembly1.cif.gz_A trna guanine transglycosylase (tgt) in co-crystallized complex (space group p21) with 6-amino-2-(methylamino)-4-(2-((2r,3r,4s,5r,6s)-3,4,5,6-tetramethoxytetrahydro-2h-pyran-2-yl)ethyl)-1h-imidazo[4,5-g]quinazolin-8(7h)-one 0.9555 38 353
ID Description Score Start End Superfamily
2ashB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Queuine tRNA-ribosyltransferase-like 0.9509 1 351 3.20.20.105
af_Q8I507_130_631_3.20.20.105 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Queuine tRNA-ribosyltransferase-like 0.939 38 341 3.20.20.105
af_Q869B9_41_434_3.20.20.105 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Queuine tRNA-ribosyltransferase-like 0.9386 35 336 3.20.20.105
af_Q23623_1_366_3.20.20.105 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Queuine tRNA-ribosyltransferase-like 0.9379 1 348 3.20.20.105
4jbrA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Queuine tRNA-ribosyltransferase-like 0.9292 1 353 3.20.20.105
ID Description Score Start End GO Terms
AF-A0A227J4F3-F1-model_v4 tRNA guanosine(34) transglycosylase Tgt (EC 2.4.2.29) 0.9972 232 334 GO:0002099
GO:0005829
GO:0008616
GO:0016757
AF-A0A3D0EWE3-F1-model_v4 tRNA guanosine(34) transglycosylase Tgt 0.996 56 132 GO:0002099
GO:0005829
GO:0008616
GO:0016757
AF-A0A7C4JZT6-F1-model_v4 tRNA-guanine transglycosylase (EC 2.4.2.-) 0.995 234 352 GO:0002099
GO:0005829
GO:0008616
GO:0016757
AF-A0A399YY82-F1-model_v4 tRNA guanosine(34) transglycosylase Tgt 0.9938 228 350 GO:0002099
GO:0005829
GO:0008616
GO:0016757
AF-A0A3M2A5K9-F1-model_v4 tRNA-guanine transglycosylase (EC 2.4.2.-) 0.9937 229 351 GO:0002099
GO:0005829
GO:0008616
GO:0016757

Feature Viewer

pLDDT pTM Quality
88.66 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map