F284052

General Info

Members Datasets Scaffolds Average Seq Length
185 117 370 217

Family's Representative Sequence

Representative Sequence 3300005841|Ga0068863_100460639|Ga0068863_1004606392
Length 256
Sequence LTVIVIVMRVVSHAAKMTQTRTKVKGQEVTGRRFAAMLHARRLQMPTPHLIYFADPMCSWCYGFSPVLDDIRRTFGRALPIRVVMGGLRPGTEKPMTEAAKLEIAGHWRHVNDATGLPFDAAGMAREGFIYDTDPAARAVVVVRRDGEELAAAYLARAQRAFYAEGRDVTSGEVLADLALELGVDRDRFLEQWASDEAKEETWRDYAISQRAGVTGFPTLVAGPNEEGVYGVVTRGYAPGEQVLTVLKEWLERIAA

Samples

Sample ID Description Type Environment
1 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
4 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
22 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
23 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
24 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
25 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
26 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
27 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
28 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
30 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
33 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
34 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
35 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
36 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
37 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
38 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
39 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
40 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
41 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
42 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
69 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
70 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
71 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
72 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
73 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
74 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
75 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
76 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
77 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
78 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
79 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
80 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
81 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
82 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
83 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
84 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
85 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
86 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
87 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
88 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
89 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
90 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
91 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
92 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
93 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
94 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
95 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
96 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
97 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
98 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
99 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
100 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
101 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
102 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
103 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
108 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
109 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
110 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
111 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
112 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
113 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
114 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
115 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
116 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
117 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.84
Metatranscriptomes 0
Isolates 2.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.81
Nodule 0
Rhizoplane 3.78
Rhizosphere 79.46
Stem 0
Stem Tuber 0
Unclassified 0.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068863_100460639 3300005841 Bacteria 1249
2 JGI25153J46596_10020353 3300003215 Bacteria 2511
3 Ga0055531_10008784 3300003794 Bacteria 5268
4 Ga0065165_1000532 3300005262 Bacteria 58082
5 Ga0065165_1037931 3300005262 Bacteria 1457
6 Ga0065165_1047339 3300005262 Bacteria 1242
7 Ga0070658_10062945 3300005327 Bacteria 3024
8 Ga0070666_10080202 3300005335 Bacteria 2230
9 Ga0070666_10549259 3300005335 Bacteria 840
10 Ga0070680_100027576 3300005336 Bacteria 4548
11 Ga0070689_100581929 3300005340 Bacteria 968
12 Ga0070691_10007825 3300005341 Bacteria 4889
13 Ga0070661_100460686 3300005344 Bacteria 1013
14 Ga0070674_100473609 3300005356 Bacteria 1038
15 Ga0070659_100001259 3300005366 Bacteria 18398
16 Ga0070659_100036366 3300005366 Bacteria 3839
17 Ga0070678_100238266 3300005456 Bacteria 1520
18 Ga0070681_10292250 3300005458 Bacteria 1539
19 Ga0070679_100007510 3300005530 Bacteria 10194
20 Ga0068853_100018376 3300005539 Bacteria 5785
21 Ga0070665_100002787 3300005548 Bacteria 18954
22 Ga0070665_100035070 3300005548 Bacteria 5045
23 Ga0070665_100044778 3300005548 Bacteria 4442
24 Ga0068855_100039540 3300005563 Bacteria 5600
25 Ga0068855_100045936 3300005563 Bacteria 5163
26 Ga0068855_100123413 3300005563 Bacteria 2963
27 Ga0068855_100207331 3300005563 Bacteria 2205
28 Ga0068855_100367498 3300005563 Bacteria 1582
29 Ga0068854_100919009 3300005578 Bacteria 770
30 Ga0068856_100153261 3300005614 Bacteria 2314
31 Ga0068852_100043274 3300005616 Bacteria 3818
32 Ga0068864_100087243 3300005618 Bacteria 2747
33 Ga0068864_100147813 3300005618 Bacteria 2126
34 Ga0068863_100308814 3300005841 Bacteria 1535
35 Ga0068858_100318996 3300005842 Bacteria 1485
36 Ga0068862_100079518 3300005844 Bacteria 2842
37 Ga0070717_10579307 3300006028 Bacteria 1017
38 Ga0070717_10708204 3300006028 Bacteria 915
39 Ga0075363_100399216 3300006048 Bacteria 808
40 Ga0075362_10012310 3300006177 Bacteria 3395
41 Ga0097621_100496212 3300006237 Bacteria 1105
42 Ga0097621_100511704 3300006237 Bacteria 1089
43 Ga0075370_10117055 3300006353 Bacteria 1549
44 Ga0068865_100004358 3300006881 Bacteria 8540
45 Ga0105240_10001441 3300009093 Bacteria 40617
46 Ga0105240_10012590 3300009093 Bacteria 11666
47 Ga0105240_10034205 3300009093 Bacteria 6558
48 Ga0105240_10095872 3300009093 Bacteria 3616
49 Ga0105240_10104627 3300009093 Bacteria 3437
50 Ga0105241_10156759 3300009174 Bacteria 1868
51 Ga0105241_10230020 3300009174 Bacteria 1562
52 Ga0105248_10017249 3300009177 Bacteria 7956
53 Ga0105248_10189145 3300009177 Bacteria 2320
54 Ga0105238_10034637 3300009551 Bacteria 5137
55 Ga0105238_10047504 3300009551 Bacteria 4327
56 Ga0105238_10076190 3300009551 Bacteria 3345
57 Ga0105238_10379193 3300009551 Bacteria 1405
58 Ga0157370_10023097 3300013104 Bacteria 6182
59 Ga0157370_10075368 3300013104 Bacteria 3180
60 Ga0163162_10420127 3300013306 Bacteria 1469
61 Ga0157375_10089709 3300013308 Bacteria 3131
62 Ga0163163_10046711 3300014325 Bacteria 4253
63 Ga0163163_10053671 3300014325 Bacteria 3980
64 Ga0213872_10008388 3300021361 Bacteria 5003
65 Ga0209148_1010191 3300025254 Bacteria 1794
66 Ga0209758_1000696 3300025297 Bacteria 49847
67 Ga0209050_1000141 3300025298 Bacteria 173116
68 Ga0209257_1000692 3300025304 Bacteria 52346
69 Ga0209257_1005281 3300025304 Bacteria 9209
70 Ga0207680_10050398 3300025903 Bacteria 2484
71 Ga0207705_10006685 3300025909 Bacteria 8530
72 Ga0207705_10135713 3300025909 Bacteria 1834
73 Ga0207707_10050060 3300025912 Bacteria 3640
74 Ga0207695_10000718 3300025913 Bacteria 64451
75 Ga0207695_10001929 3300025913 Bacteria 32246
76 Ga0207695_10002461 3300025913 Bacteria 27342
77 Ga0207695_10019607 3300025913 Bacteria 7781
78 Ga0207695_10077649 3300025913 Bacteria 3371
79 Ga0207695_10666930 3300025913 Bacteria 921
80 Ga0207660_10007529 3300025917 Bacteria 7048
81 Ga0207660_10082688 3300025917 Bacteria 2363
82 Ga0207657_10005328 3300025919 Bacteria 13471
83 Ga0207652_10017696 3300025921 Bacteria 5837
84 Ga0207652_10359267 3300025921 Unclassified 1315
85 Ga0207694_10029242 3300025924 Bacteria 4204
86 Ga0207694_10056681 3300025924 Bacteria 3044
87 Ga0207694_10217481 3300025924 Bacteria 1558
88 Ga0207694_10302453 3300025924 Bacteria 1317
89 Ga0207694_10307263 3300025924 Bacteria 1307
90 Ga0207644_10313293 3300025931 Bacteria 1267
91 Ga0207690_10000053 3300025932 Bacteria 105125
92 Ga0207690_10115815 3300025932 Bacteria 1937
93 Ga0207690_10314720 3300025932 Bacteria 1229
94 Ga0207706_10444665 3300025933 Bacteria 1122
95 Ga0207669_10320202 3300025937 Bacteria 1187
96 Ga0207704_10002594 3300025938 Bacteria 8153
97 Ga0207711_10000731 3300025941 Bacteria 32250
98 Ga0207711_10107913 3300025941 Bacteria 2472
99 Ga0207679_10952305 3300025945 Bacteria 786
100 Ga0207667_10031083 3300025949 Bacteria 5768
101 Ga0207667_10052086 3300025949 Bacteria 4313
102 Ga0207667_10205285 3300025949 Bacteria 2021
103 Ga0207667_10227980 3300025949 Bacteria 1908
104 Ga0207667_10876902 3300025949 Bacteria 890
105 Ga0207712_10095821 3300025961 Bacteria 2195
106 Ga0207677_10218921 3300026023 Bacteria 1526
107 Ga0207703_10518380 3300026035 Bacteria 1121
108 Ga0207639_10053345 3300026041 Bacteria 3085
109 Ga0207639_10178969 3300026041 Bacteria 1802
110 Ga0207676_10030770 3300026095 Bacteria 4032
111 Ga0207676_10069495 3300026095 Bacteria 2820
112 Ga0207683_10479396 3300026121 Bacteria 1148
113 Ga0268266_10000355 3300028379 Bacteria 70950
114 Ga0268266_10248930 3300028379 Bacteria 1643
115 Ga0268266_10590798 3300028379 Bacteria 1066
116 Ga0268265_10014833 3300028380 Bacteria 5319
117 Ga0307517_10003553 3300028786 Bacteria 24213
118 Ga0265338_10022839 3300028800 Bacteria 6456
119 Ga0307511_10052554 3300030521 Bacteria 3245
120 Ga0265327_10000275 3300031251 Bacteria 101668
121 Ga0265327_10006665 3300031251 Bacteria 9162
122 Ga0265327_10088523 3300031251 Bacteria 1514
123 Ga0307513_10008441 3300031456 Bacteria 13188
124 Ga0307513_10475036 3300031456 Bacteria 971
125 Ga0307406_10894038 3300031901 Bacteria 756
126 Ga0307412_10758677 3300031911 Bacteria 838
127 Ga0307414_10224730 3300032004 Bacteria 1543
128 Ga0307411_10901255 3300032005 Bacteria 786
129 Ga0307510_10476049 3300033180 Bacteria 690
130 Ga0373945_0136442 3300035116 Bacteria 986
131 Ga0373935_0045875 3300035692 Bacteria 2759
132 Ga0373925_0196800 3300037068 Bacteria 1601
133 Ga0395899_0000167 3300037312 Bacteria 100973
134 Ga0395900_0000009 3300037418 Bacteria 476249
135 Ga0395900_0118276 3300037418 Bacteria 2720
136 Ga0395898_0007344 3300037466 Bacteria 11696
137 Ga0395905_0010581 3300037471 Bacteria 8961
138 Ga0395905_0021914 3300037471 Bacteria 6043
139 Ga0395905_0302341 3300037471 Bacteria 1487
140 Ga0395905_0395833 3300037471 Bacteria 1276
141 Ga0395901_0000014 3300038443 Bacteria 375100
142 Ga0395901_0191690 3300038443 Bacteria 2143
143 Ga0395901_0222326 3300038443 Bacteria 1973
144 Ga0436365_1902273 3300039437 Bacteria 1483
145 Ga0436361_0999275 3300039447 Bacteria 6807
146 Ga0495583_0026003 3300046506 Bacteria 2912
147 Ga0495628_0106253 3300046516 Bacteria 2162
148 Ga0495648_0164576 3300046524 Bacteria 1143
149 Ga0495642_0019307 3300046528 Bacteria 2671
150 Ga0495645_0010417 3300046543 Bacteria 6516
151 Ga0495668_0051959 3300046616 Bacteria 2269
152 Ga0495668_0102970 3300046616 Bacteria 1562
153 Ga0495668_0203798 3300046616 Bacteria 1083
154 Ga0495668_0217385 3300046616 Bacteria 1046
155 Ga0495625_0088238 3300046660 Bacteria 2149
156 Ga0495625_0110418 3300046660 Bacteria 1880
157 Ga0495669_0063724 3300046684 Bacteria 1672
158 Ga0495672_0025632 3300047320 Bacteria 3769
159 Ga0495677_0088945 3300047445 Bacteria 1163
160 Ga0496108_0054817 3300048911 Bacteria 3346
161 Ga0496109_0034198 3300048912 Bacteria 4575
162 Ga0496112_0100555 3300048915 Bacteria 2861
163 Ga0496115_0003170 3300048918 Bacteria 11819
164 Ga0496115_0155731 3300048918 Bacteria 1888
165 Ga0496115_0622290 3300048918 Bacteria 856
166 Ga0496115_0770702 3300048918 Bacteria 751
167 Ga0496125_0103223 3300048928 Bacteria 2093
168 Ga0501033_0052806 3300049570 Bacteria 3012
169 Ga0501043_0340286 3300049579 Bacteria 1141
170 Ga0501047_0009760 3300049581 Bacteria 9070
171 Ga0501047_0083709 3300049581 Bacteria 3066
172 Ga0501047_0188067 3300049581 Bacteria 1930
173 Ga0501035_0182782 3300049822 Bacteria 1806
174 Ga0501044_0011434 3300049823 Bacteria 9615
175 nmdc:mga03683_2779_c1 3300050489 Bacteria 5504
176 nmdc:mga07m45_179800_c1 3300050496 Bacteria 1230
177 Ga0500641_0005221 3300053096 Bacteria 4602
178 Ga0500562_001268 3300053108 Bacteria 6233
179 Ga0500595_008137 3300053119 Bacteria 4303
180 Ga0500595_068141 3300053119 Bacteria 1060
181 Ga0500645_006404 3300053730 Bacteria 4205
182 2643999454 2643221598 Bacteria 4578346
183 2644086468 2643221614 Bacteria 4260023
184 2644341422 2643221661 Bacteria 4267604
185 2644367709 2643221666 Bacteria 4265935
186 Ga0068863_100460639
187 JGI25153J46596_10020353
188 Ga0055531_10008784
189 Ga0065165_1000532
190 Ga0065165_1037931
191 Ga0065165_1047339
192 Ga0070658_10062945
193 Ga0070666_10080202
194 Ga0070666_10549259
195 Ga0070680_100027576
196 Ga0070689_100581929
197 Ga0070691_10007825
198 Ga0070661_100460686
199 Ga0070674_100473609
200 Ga0070659_100001259
201 Ga0070659_100036366
202 Ga0070678_100238266
203 Ga0070681_10292250
204 Ga0070679_100007510
205 Ga0068853_100018376
206 Ga0070665_100002787
207 Ga0070665_100035070
208 Ga0070665_100044778
209 Ga0068855_100039540
210 Ga0068855_100045936
211 Ga0068855_100123413
212 Ga0068855_100207331
213 Ga0068855_100367498
214 Ga0068854_100919009
215 Ga0068856_100153261
216 Ga0068852_100043274
217 Ga0068864_100087243
218 Ga0068864_100147813
219 Ga0068863_100308814
220 Ga0068858_100318996
221 Ga0068862_100079518
222 Ga0070717_10579307
223 Ga0070717_10708204
224 Ga0075363_100399216
225 Ga0075362_10012310
226 Ga0097621_100496212
227 Ga0097621_100511704
228 Ga0075370_10117055
229 Ga0068865_100004358
230 Ga0105240_10001441
231 Ga0105240_10012590
232 Ga0105240_10034205
233 Ga0105240_10095872
234 Ga0105240_10104627
235 Ga0105241_10156759
236 Ga0105241_10230020
237 Ga0105248_10017249
238 Ga0105248_10189145
239 Ga0105238_10034637
240 Ga0105238_10047504
241 Ga0105238_10076190
242 Ga0105238_10379193
243 Ga0157370_10023097
244 Ga0157370_10075368
245 Ga0163162_10420127
246 Ga0157375_10089709
247 Ga0163163_10046711
248 Ga0163163_10053671
249 Ga0213872_10008388
250 Ga0209148_1010191
251 Ga0209758_1000696
252 Ga0209050_1000141
253 Ga0209257_1000692
254 Ga0209257_1005281
255 Ga0207680_10050398
256 Ga0207705_10006685
257 Ga0207705_10135713
258 Ga0207707_10050060
259 Ga0207695_10000718
260 Ga0207695_10001929
261 Ga0207695_10002461
262 Ga0207695_10019607
263 Ga0207695_10077649
264 Ga0207695_10666930
265 Ga0207660_10007529
266 Ga0207660_10082688
267 Ga0207657_10005328
268 Ga0207652_10017696
269 Ga0207652_10359267
270 Ga0207694_10029242
271 Ga0207694_10056681
272 Ga0207694_10217481
273 Ga0207694_10302453
274 Ga0207694_10307263
275 Ga0207644_10313293
276 Ga0207690_10000053
277 Ga0207690_10115815
278 Ga0207690_10314720
279 Ga0207706_10444665
280 Ga0207669_10320202
281 Ga0207704_10002594
282 Ga0207711_10000731
283 Ga0207711_10107913
284 Ga0207679_10952305
285 Ga0207667_10031083
286 Ga0207667_10052086
287 Ga0207667_10205285
288 Ga0207667_10227980
289 Ga0207667_10876902
290 Ga0207712_10095821
291 Ga0207677_10218921
292 Ga0207703_10518380
293 Ga0207639_10053345
294 Ga0207639_10178969
295 Ga0207676_10030770
296 Ga0207676_10069495
297 Ga0207683_10479396
298 Ga0268266_10000355
299 Ga0268266_10248930
300 Ga0268266_10590798
301 Ga0268265_10014833
302 Ga0307517_10003553
303 Ga0265338_10022839
304 Ga0307511_10052554
305 Ga0265327_10000275
306 Ga0265327_10006665
307 Ga0265327_10088523
308 Ga0307513_10008441
309 Ga0307513_10475036
310 Ga0307406_10894038
311 Ga0307412_10758677
312 Ga0307414_10224730
313 Ga0307411_10901255
314 Ga0307510_10476049
315 Ga0373945_0136442
316 Ga0373935_0045875
317 Ga0373925_0196800
318 Ga0395899_0000167
319 Ga0395900_0000009
320 Ga0395900_0118276
321 Ga0395898_0007344
322 Ga0395905_0010581
323 Ga0395905_0021914
324 Ga0395905_0302341
325 Ga0395905_0395833
326 Ga0395901_0000014
327 Ga0395901_0191690
328 Ga0395901_0222326
329 Ga0436365_1902273
330 Ga0436361_0999275
331 Ga0495583_0026003
332 Ga0495628_0106253
333 Ga0495648_0164576
334 Ga0495642_0019307
335 Ga0495645_0010417
336 Ga0495668_0051959
337 Ga0495668_0102970
338 Ga0495668_0203798
339 Ga0495668_0217385
340 Ga0495625_0088238
341 Ga0495625_0110418
342 Ga0495669_0063724
343 Ga0495672_0025632
344 Ga0495677_0088945
345 Ga0496108_0054817
346 Ga0496109_0034198
347 Ga0496112_0100555
348 Ga0496115_0003170
349 Ga0496115_0155731
350 Ga0496115_0622290
351 Ga0496115_0770702
352 Ga0496125_0103223
353 Ga0501033_0052806
354 Ga0501043_0340286
355 Ga0501047_0009760
356 Ga0501047_0083709
357 Ga0501047_0188067
358 Ga0501035_0182782
359 Ga0501044_0011434
360 nmdc:mga03683_2779_c1
361 nmdc:mga07m45_179800_c1
362 Ga0500641_0005221
363 Ga0500562_001268
364 Ga0500595_008137
365 Ga0500595_068141
366 Ga0500645_006404
367 2643999454
368 2644086468
369 2644341422
370 2644367709

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13743

Thioredoxin_5

Thioredoxin

52

243

0.93

PF01323

DSBA

DSBA-like thioredoxin domain

49

248

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
2in3-assembly1.cif.gz_A crystal structure of a putative protein disulfide isomerase from nitrosomonas europaea 0.918 2 209
2in3-assembly1.cif.gz_A crystal structure of a putative protein disulfide isomerase from nitrosomonas europaea 0.9052 2 209
6ghb-assembly2.cif.gz_D crystal structure of spx in complex with yjbh (oxidized) 0.89 4 208
6ghb-assembly1.cif.gz_B crystal structure of spx in complex with yjbh (oxidized) 0.884 4 208
3kzq-assembly3.cif.gz_D-3 the crystal structure of the protein with unknown function from vibrio parahaemolyticus rimd 2210633 0.8805 4 209
ID Description Score Start End Superfamily
2in3A02 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;putative protein disulfide isomerase domain 0.9261 48 170 1.10.472.60
2in3A02 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;putative protein disulfide isomerase domain 0.919 48 170 1.10.472.60
2in3A01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9186 2 209 3.40.30.10
af_Q9VYV3_22_162_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9061 3 33 3.40.30.10
2in3A01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.886 2 209 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A525JFA8-F1-model_v4 DsbA family protein 0.9867 1 212 GO:0016491
AF-A0A7V5UPN0-F1-model_v4 DsbA family protein 0.9694 4 209
AF-A0A2M7GNE9-F1-model_v4 Protein-disulfide isomerase 0.9694 3 208 GO:0016491
GO:0016853
AF-A0A3B1B3I8-F1-model_v4 Thioredoxin 0.9681 4 209
AF-K5YM20-F1-model_v4 DSBA-like thioredoxin domain-containing protein 0.9678 1 209 GO:0016491

Map