F284886
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 185 | 124 | 371 | 284 |
Family's Representative Sequence
| Representative Sequence | 3300046512|Ga0495610_0002043|Ga0495610_0002043_7510_8472 |
| Length | 320 |
| Sequence | MKPVPAKLINFTALKLCNKQLTVAKDTFFSKKVTLNAGGRLIDLSSPKVMGIINITPDSFFADSRKPSVDEALQQAQKMLANGATFLDIGAYSSRPGAIDISAQEETDRLLPIVEAIAVKFPEAIMSIDTFRASVAEAAIKGGAHIINDISGGMLDADMFTTVARLNVPYILMHMKGSPQTMNQLAEYDDVFSEVFDYFVSKYSELKRLGVHDVILDPGFGFAKKAEHSYELISRMNEFDLFGLPVLTGISRKRMIYGLLGNTAAEVLNGTTALNTIALMKGANILRVHDVKEAVEAVKIWEACQPTIAKPAADYHFPAS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 5 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 6 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 7 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 8 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 9 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 10 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 17 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 19 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 20 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 21 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 22 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 23 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 24 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 25 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 26 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 27 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 28 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 29 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 30 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 31 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 32 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 33 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 34 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 35 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 36 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 37 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 38 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 39 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 40 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 41 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 42 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 43 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 58 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 59 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 60 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 61 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 62 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 63 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 64 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 65 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 66 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 67 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 68 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 69 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 70 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 71 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 72 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 73 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 74 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 75 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 76 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 77 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 78 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 79 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 80 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 81 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 82 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 83 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 84 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 85 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 86 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 87 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 88 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 89 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 90 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 91 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 92 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 93 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 94 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 95 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 96 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 97 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 98 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 99 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 111 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 112 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 113 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 114 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 115 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 116 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 117 | 2599185184 | Mucilaginibacter sp. NFR10 | Isolate | Rhizoplane |
| 118 | 2738543023 | Pedobacter sp. OK628 | Isolate | Unclassified |
| 119 | 2852627209 | Pedobacter sp. AK017 | Isolate | Rhizosphere |
| 120 | 2881955468 | Edaphocola flava HME-24 | Isolate | Rhizosphere |
| 121 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 122 | 2928147474 | Mucilaginibacter rubeus 2025 | Isolate | Unclassified |
| 123 | 2932082852 | Mucilaginibacter sp. 3215 | Isolate | Rhizosphere |
| 124 | 2977232053 | Mucilaginibacter terrae SORGH_AS 422 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.68 |
| Metatranscriptomes | 0 |
| Isolates | 4.32 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.95 |
| Nodule | 0 |
| Rhizoplane | 0.54 |
| Rhizosphere | 79.46 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.86 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495610_0002043 | 3300046512 | Bacteria | 17231 |
| 2 | JGI24740J21852_10075730 | 3300001979 | Bacteria | 891 |
| 3 | JGI24737J22298_10001058 | 3300001990 | Bacteria | 9730 |
| 4 | JGI24735J21928_10000019 | 3300002067 | Bacteria | 108890 |
| 5 | JGI25162J39368_1000682 | 3300002737 | Bacteria | 23752 |
| 6 | rootH1_10001789 | 3300003316 | Bacteria | 33903 |
| 7 | rootH1_10001789 | 3300003323 | Bacteria | 4140 |
| 8 | rootH1_10076145 | 3300003316 | Bacteria | 5376 |
| 9 | rootH2_10011933 | 3300003320 | Bacteria | 68387 |
| 10 | rootH2_10013134 | 3300003320 | Bacteria | 4252 |
| 11 | rootL2_10018962 | 3300003322 | Bacteria | 2865 |
| 12 | rootL2_10111323 | 3300003322 | Bacteria | 11409 |
| 13 | rootL2_10190836 | 3300003322 | Bacteria | 3575 |
| 14 | rootH1_10003840 | 3300003323 | Bacteria | 20383 |
| 15 | rootH1_10011509 | 3300003323 | Bacteria | 15051 |
| 16 | rootH1_10054743 | 3300003323 | Bacteria | 14007 |
| 17 | rootH1_10109635 | 3300003323 | Bacteria | 8130 |
| 18 | rootH1_10374861 | 3300003323 | Bacteria | 1095 |
| 19 | Ga0065714_10004425 | 3300005288 | Bacteria | 7964 |
| 20 | Ga0065714_10004588 | 3300005288 | Bacteria | 7640 |
| 21 | Ga0070658_10242983 | 3300005327 | Bacteria | 1526 |
| 22 | Ga0070682_100058231 | 3300005337 | Bacteria | 2436 |
| 23 | Ga0070689_100407454 | 3300005340 | Unclassified | 1150 |
| 24 | Ga0070700_100233549 | 3300005441 | Bacteria | 1310 |
| 25 | Ga0070663_100001541 | 3300005455 | Bacteria | 12697 |
| 26 | Ga0068853_100036828 | 3300005539 | Bacteria | 4161 |
| 27 | Ga0070665_100000212 | 3300005548 | Bacteria | 100019 |
| 28 | Ga0068855_100067123 | 3300005563 | Bacteria | 4180 |
| 29 | Ga0068855_100273743 | 3300005563 | Bacteria | 1877 |
| 30 | Ga0068856_100150877 | 3300005614 | Unclassified | 2333 |
| 31 | Ga0068859_100082758 | 3300005617 | Bacteria | 3252 |
| 32 | Ga0068864_100528242 | 3300005618 | Bacteria | 1138 |
| 33 | Ga0068870_10047720 | 3300005840 | Bacteria | 2252 |
| 34 | Ga0068863_100457393 | 3300005841 | Unclassified | 1253 |
| 35 | Ga0075366_10000107 | 3300006195 | Bacteria | 33692 |
| 36 | Ga0075366_10007484 | 3300006195 | Bacteria | 6034 |
| 37 | Ga0097620_100082758 | 3300006931 | Bacteria | 3252 |
| 38 | Ga0105240_10004416 | 3300009093 | Bacteria | 21450 |
| 39 | Ga0105240_10094403 | 3300009093 | Bacteria | 3649 |
| 40 | Ga0105240_10206941 | 3300009093 | Bacteria | 2296 |
| 41 | Ga0105241_10085820 | 3300009174 | Bacteria | 2475 |
| 42 | Ga0105237_10006942 | 3300009545 | Bacteria | 12483 |
| 43 | Ga0105237_10011183 | 3300009545 | Bacteria | 9510 |
| 44 | Ga0105237_10627733 | 3300009545 | Bacteria | 1081 |
| 45 | Ga0105239_10000059 | 3300010375 | Bacteria | 155685 |
| 46 | Ga0105239_10000286 | 3300010375 | Bacteria | 74525 |
| 47 | Ga0105239_10084940 | 3300010375 | Bacteria | 3487 |
| 48 | Ga0105239_10174059 | 3300010375 | Bacteria | 2408 |
| 49 | Ga0105246_10021954 | 3300011119 | Bacteria | 4115 |
| 50 | Ga0157371_10005893 | 3300013102 | Bacteria | 10236 |
| 51 | Ga0157371_10133299 | 3300013102 | Bacteria | 1768 |
| 52 | Ga0157369_10000495 | 3300013105 | Bacteria | 52125 |
| 53 | Ga0157369_10610039 | 3300013105 | Bacteria | 1126 |
| 54 | Ga0157374_10000414 | 3300013296 | Bacteria | 38746 |
| 55 | Ga0157374_10278486 | 3300013296 | Bacteria | 1651 |
| 56 | Ga0163162_10000008 | 3300013306 | Bacteria | 316194 |
| 57 | Ga0163162_10028223 | 3300013306 | Bacteria | 5551 |
| 58 | Ga0163162_10561405 | 3300013306 | Bacteria | 1269 |
| 59 | Ga0157372_10000048 | 3300013307 | Bacteria | 142757 |
| 60 | Ga0157372_10001240 | 3300013307 | Bacteria | 27579 |
| 61 | Ga0157372_10101351 | 3300013307 | Bacteria | 3287 |
| 62 | Ga0157372_10228325 | 3300013307 | Bacteria | 2158 |
| 63 | Ga0157375_10008624 | 3300013308 | Bacteria | 8927 |
| 64 | Ga0157375_10550128 | 3300013308 | Bacteria | 1316 |
| 65 | Ga0157377_10055334 | 3300014745 | Bacteria | 2249 |
| 66 | Ga0157379_10090547 | 3300014968 | Bacteria | 2744 |
| 67 | Ga0213872_10015920 | 3300021361 | Bacteria | 3493 |
| 68 | Ga0209437_100230 | 3300025233 | Bacteria | 95882 |
| 69 | Ga0209026_1001349 | 3300025250 | Bacteria | 10966 |
| 70 | Ga0209455_1001965 | 3300025272 | Bacteria | 8464 |
| 71 | Ga0207647_10000244 | 3300025904 | Bacteria | 44547 |
| 72 | Ga0207643_10110954 | 3300025908 | Unclassified | 1616 |
| 73 | Ga0207705_10384683 | 3300025909 | Bacteria | 1084 |
| 74 | Ga0207705_10397352 | 3300025909 | Bacteria | 1066 |
| 75 | Ga0207695_10062646 | 3300025913 | Bacteria | 3838 |
| 76 | Ga0207695_10315156 | 3300025913 | Bacteria | 1454 |
| 77 | Ga0207671_10004296 | 3300025914 | Bacteria | 13701 |
| 78 | Ga0207671_10126089 | 3300025914 | Bacteria | 1961 |
| 79 | Ga0207694_10385382 | 3300025924 | Bacteria | 1164 |
| 80 | Ga0207706_10000009 | 3300025933 | Bacteria | 200607 |
| 81 | Ga0207670_10362806 | 3300025936 | Unclassified | 1150 |
| 82 | Ga0207665_10093026 | 3300025939 | Bacteria | 2093 |
| 83 | Ga0207667_10050451 | 3300025949 | Bacteria | 4390 |
| 84 | Ga0207667_10070746 | 3300025949 | Bacteria | 3631 |
| 85 | Ga0207667_10236488 | 3300025949 | Bacteria | 1870 |
| 86 | Ga0207702_10121266 | 3300026078 | Unclassified | 2340 |
| 87 | Ga0207641_10398134 | 3300026088 | Unclassified | 1322 |
| 88 | Ga0207676_10462800 | 3300026095 | Bacteria | 1198 |
| 89 | Ga0207676_10810837 | 3300026095 | Bacteria | 914 |
| 90 | Ga0268266_10000177 | 3300028379 | Bacteria | 114318 |
| 91 | Ga0265336_10010115 | 3300028666 | Bacteria | 3235 |
| 92 | Ga0307517_10001416 | 3300028786 | Bacteria | 40353 |
| 93 | Ga0307515_10000081 | 3300028794 | Bacteria | 224753 |
| 94 | Ga0307515_10001368 | 3300028794 | Bacteria | 55146 |
| 95 | Ga0316181_1237636 | 3300030744 | Bacteria | 1246 |
| 96 | Ga0265327_10000054 | 3300031251 | Bacteria | 250337 |
| 97 | Ga0265316_10001738 | 3300031344 | Bacteria | 23105 |
| 98 | Ga0307509_10037445 | 3300031507 | Bacteria | 5304 |
| 99 | Ga0307408_100012183 | 3300031548 | Bacteria | 5692 |
| 100 | Ga0307408_100051300 | 3300031548 | Bacteria | 2971 |
| 101 | Ga0316578_10289013 | 3300031728 | Bacteria | 981 |
| 102 | Ga0307405_10021662 | 3300031731 | Bacteria | 3617 |
| 103 | Ga0307407_10280311 | 3300031903 | Bacteria | 1154 |
| 104 | Ga0307412_10005509 | 3300031911 | Bacteria | 7109 |
| 105 | Ga0307416_100001003 | 3300032002 | Bacteria | 14962 |
| 106 | Ga0307415_100008016 | 3300032126 | Bacteria | 5826 |
| 107 | Ga0307507_10000097 | 3300033179 | Bacteria | 139761 |
| 108 | Ga0307510_10000599 | 3300033180 | Bacteria | 36447 |
| 109 | Ga0395899_0000967 | 3300037312 | Bacteria | 26666 |
| 110 | Ga0395899_0009930 | 3300037312 | Bacteria | 7300 |
| 111 | Ga0395900_0002410 | 3300037418 | Bacteria | 20624 |
| 112 | Ga0395900_0211182 | 3300037418 | Bacteria | 1960 |
| 113 | Ga0395898_0027254 | 3300037466 | Bacteria | 5739 |
| 114 | Ga0395905_0004259 | 3300037471 | Bacteria | 14943 |
| 115 | Ga0395901_0003902 | 3300038443 | Bacteria | 15002 |
| 116 | Ga0436361_0054147 | 3300039447 | Bacteria | 7866 |
| 117 | Ga0451855_0177504 | 3300041511 | Bacteria | 942 |
| 118 | Ga0451855_0622107 | 3300041511 | Bacteria | 1616 |
| 119 | Ga0451855_2005776 | 3300041511 | Bacteria | 1583 |
| 120 | Ga0451577_0059642 | 3300042876 | Bacteria | 3402 |
| 121 | Ga0451577_0098376 | 3300042876 | Bacteria | 2613 |
| 122 | Ga0451577_0107543 | 3300042876 | Bacteria | 2493 |
| 123 | Ga0466966_0110407 | 3300044684 | Bacteria | 1695 |
| 124 | Ga0453684_0001882 | 3300044712 | Bacteria | 54512 |
| 125 | Ga0453684_0140129 | 3300044712 | Unclassified | 2889 |
| 126 | Ga0453684_0159468 | 3300044712 | Unclassified | 2670 |
| 127 | Ga0453684_0291355 | 3300044712 | Bacteria | 1858 |
| 128 | Ga0453684_0300491 | 3300044712 | Bacteria | 1824 |
| 129 | Ga0451576_0010901 | 3300045051 | Bacteria | 10391 |
| 130 | Ga0451576_0022374 | 3300045051 | Bacteria | 6855 |
| 131 | Ga0451576_0027872 | 3300045051 | Bacteria | 6060 |
| 132 | Ga0466958_0018012 | 3300045836 | Bacteria | 4094 |
| 133 | Ga0495629_0043694 | 3300046459 | Bacteria | 3146 |
| 134 | Ga0495638_0036676 | 3300046460 | Bacteria | 3122 |
| 135 | Ga0495650_0000023 | 3300046471 | Bacteria | 527763 |
| 136 | Ga0495605_0080311 | 3300046474 | Bacteria | 1527 |
| 137 | Ga0495585_0000250 | 3300046492 | Bacteria | 55780 |
| 138 | Ga0495585_0002184 | 3300046492 | Bacteria | 14202 |
| 139 | Ga0495583_0031992 | 3300046506 | Bacteria | 2543 |
| 140 | Ga0495606_0000717 | 3300046507 | Bacteria | 51281 |
| 141 | Ga0495606_0010959 | 3300046507 | Bacteria | 7452 |
| 142 | Ga0495606_0019786 | 3300046507 | Bacteria | 4988 |
| 143 | Ga0495616_0001269 | 3300046513 | Bacteria | 17736 |
| 144 | Ga0495616_0013236 | 3300046513 | Bacteria | 4661 |
| 145 | Ga0495631_0016852 | 3300046518 | Bacteria | 3470 |
| 146 | Ga0495637_0082586 | 3300046520 | Bacteria | 1279 |
| 147 | Ga0495644_0001634 | 3300046523 | Bacteria | 9121 |
| 148 | Ga0495648_0038594 | 3300046524 | Bacteria | 3051 |
| 149 | Ga0495648_0053578 | 3300046524 | Bacteria | 2443 |
| 150 | Ga0495609_0006950 | 3300046538 | Bacteria | 5710 |
| 151 | Ga0495668_0000011 | 3300046616 | Bacteria | 472186 |
| 152 | Ga0495625_0000018 | 3300046660 | Bacteria | 299567 |
| 153 | Ga0495625_0021528 | 3300046660 | Bacteria | 4963 |
| 154 | Ga0495625_0056241 | 3300046660 | Bacteria | 2802 |
| 155 | Ga0495661_0002212 | 3300046665 | Bacteria | 15169 |
| 156 | Ga0495661_0098437 | 3300046665 | Bacteria | 1651 |
| 157 | Ga0495661_0141403 | 3300046665 | Bacteria | 1309 |
| 158 | Ga0495649_0000015 | 3300046694 | Bacteria | 246431 |
| 159 | Ga0495649_0045523 | 3300046694 | Bacteria | 2392 |
| 160 | Ga0495660_0001444 | 3300046810 | Bacteria | 16270 |
| 161 | Ga0495687_000409 | 3300047443 | Bacteria | 53157 |
| 162 | Ga0495687_082990 | 3300047443 | Bacteria | 1249 |
| 163 | Ga0495687_093073 | 3300047443 | Bacteria | 1149 |
| 164 | Ga0495679_064044 | 3300047446 | Bacteria | 1072 |
| 165 | Ga0495681_0055705 | 3300047470 | Bacteria | 1843 |
| 166 | Ga0495686_0000303 | 3300047472 | Bacteria | 84544 |
| 167 | Ga0495686_0049621 | 3300047472 | Bacteria | 2640 |
| 168 | Ga0495614_0019465 | 3300048089 | Bacteria | 2937 |
| 169 | Ga0495678_011549 | 3300049459 | Bacteria | 4223 |
| 170 | Ga0495682_0041052 | 3300049460 | Bacteria | 1696 |
| 171 | Ga0501236_000162 | 3300049670 | Bacteria | 6947 |
| 172 | Ga0501264_000196 | 3300049761 | Bacteria | 9755 |
| 173 | nmdc:mga0k408_135_c1 | 3300050493 | Bacteria | 36841 |
| 174 | nmdc:mga0k408_18084_c1 | 3300050493 | Bacteria | 3930 |
| 175 | Ga0500608_008948 | 3300053122 | Bacteria | 4236 |
| 176 | Ga0500616_0048834 | 3300053153 | Bacteria | 2242 |
| 177 | Ga0500622_0001773 | 3300053156 | Bacteria | 16514 |
| 178 | Ga0500624_000660 | 3300053157 | Bacteria | 8961 |
| 179 | 2599481569 | 2599185184 | Bacteria | 6430550 |
| 180 | 2739302844 | 2738543023 | Bacteria | 6767879 |
| 181 | 2852631800 | 2852627209 | Bacteria | 5896285 |
| 182 | 2881957047 | 2881955468 | Bacteria | 3545609 |
| 183 | 2928083198 | 2928078545 | Bacteria | 6534839 |
| 184 | 2928152661 | 2928147474 | Bacteria | 6512076 |
| 185 | 2932086602 | 2932082852 | Bacteria | 6563563 |
| 186 | 2977234594 | 2977232053 | Bacteria | 5485925 |
| 187 | Ga0495610_0002043 | |||
| 188 | JGI24740J21852_10075730 | |||
| 189 | JGI24737J22298_10001058 | |||
| 190 | JGI24735J21928_10000019 | |||
| 191 | JGI25162J39368_1000682 | |||
| 192 | rootH1_10001789 | |||
| 193 | rootH1_10076145 | |||
| 194 | rootH2_10011933 | |||
| 195 | rootH2_10013134 | |||
| 196 | rootL2_10018962 | |||
| 197 | rootL2_10111323 | |||
| 198 | rootL2_10190836 | |||
| 199 | rootH1_10003840 | |||
| 200 | rootH1_10011509 | |||
| 201 | rootH1_10054743 | |||
| 202 | rootH1_10109635 | |||
| 203 | rootH1_10374861 | |||
| 204 | Ga0065714_10004425 | |||
| 205 | Ga0065714_10004588 | |||
| 206 | Ga0070658_10242983 | |||
| 207 | Ga0070682_100058231 | |||
| 208 | Ga0070689_100407454 | |||
| 209 | Ga0070700_100233549 | |||
| 210 | Ga0070663_100001541 | |||
| 211 | Ga0068853_100036828 | |||
| 212 | Ga0070665_100000212 | |||
| 213 | Ga0068855_100067123 | |||
| 214 | Ga0068855_100273743 | |||
| 215 | Ga0068856_100150877 | |||
| 216 | Ga0068859_100082758 | |||
| 217 | Ga0068864_100528242 | |||
| 218 | Ga0068870_10047720 | |||
| 219 | Ga0068863_100457393 | |||
| 220 | Ga0075366_10000107 | |||
| 221 | Ga0075366_10007484 | |||
| 222 | Ga0097620_100082758 | |||
| 223 | Ga0105240_10004416 | |||
| 224 | Ga0105240_10094403 | |||
| 225 | Ga0105240_10206941 | |||
| 226 | Ga0105241_10085820 | |||
| 227 | Ga0105237_10006942 | |||
| 228 | Ga0105237_10011183 | |||
| 229 | Ga0105237_10627733 | |||
| 230 | Ga0105239_10000059 | |||
| 231 | Ga0105239_10000286 | |||
| 232 | Ga0105239_10084940 | |||
| 233 | Ga0105239_10174059 | |||
| 234 | Ga0105246_10021954 | |||
| 235 | Ga0157371_10005893 | |||
| 236 | Ga0157371_10133299 | |||
| 237 | Ga0157369_10000495 | |||
| 238 | Ga0157369_10610039 | |||
| 239 | Ga0157374_10000414 | |||
| 240 | Ga0157374_10278486 | |||
| 241 | Ga0163162_10000008 | |||
| 242 | Ga0163162_10028223 | |||
| 243 | Ga0163162_10561405 | |||
| 244 | Ga0157372_10000048 | |||
| 245 | Ga0157372_10001240 | |||
| 246 | Ga0157372_10101351 | |||
| 247 | Ga0157372_10228325 | |||
| 248 | Ga0157375_10008624 | |||
| 249 | Ga0157375_10550128 | |||
| 250 | Ga0157377_10055334 | |||
| 251 | Ga0157379_10090547 | |||
| 252 | Ga0213872_10015920 | |||
| 253 | Ga0209437_100230 | |||
| 254 | Ga0209026_1001349 | |||
| 255 | Ga0209455_1001965 | |||
| 256 | Ga0207647_10000244 | |||
| 257 | Ga0207643_10110954 | |||
| 258 | Ga0207705_10384683 | |||
| 259 | Ga0207705_10397352 | |||
| 260 | Ga0207695_10062646 | |||
| 261 | Ga0207695_10315156 | |||
| 262 | Ga0207671_10004296 | |||
| 263 | Ga0207671_10126089 | |||
| 264 | Ga0207694_10385382 | |||
| 265 | Ga0207706_10000009 | |||
| 266 | Ga0207670_10362806 | |||
| 267 | Ga0207665_10093026 | |||
| 268 | Ga0207667_10050451 | |||
| 269 | Ga0207667_10070746 | |||
| 270 | Ga0207667_10236488 | |||
| 271 | Ga0207702_10121266 | |||
| 272 | Ga0207641_10398134 | |||
| 273 | Ga0207676_10462800 | |||
| 274 | Ga0207676_10810837 | |||
| 275 | Ga0268266_10000177 | |||
| 276 | Ga0265336_10010115 | |||
| 277 | Ga0307517_10001416 | |||
| 278 | Ga0307515_10000081 | |||
| 279 | Ga0307515_10001368 | |||
| 280 | Ga0316181_1237636 | |||
| 281 | Ga0265327_10000054 | |||
| 282 | Ga0265316_10001738 | |||
| 283 | Ga0307509_10037445 | |||
| 284 | Ga0307408_100012183 | |||
| 285 | Ga0307408_100051300 | |||
| 286 | Ga0316578_10289013 | |||
| 287 | Ga0307405_10021662 | |||
| 288 | Ga0307407_10280311 | |||
| 289 | Ga0307412_10005509 | |||
| 290 | Ga0307416_100001003 | |||
| 291 | Ga0307415_100008016 | |||
| 292 | Ga0307507_10000097 | |||
| 293 | Ga0307510_10000599 | |||
| 294 | Ga0395899_0000967 | |||
| 295 | Ga0395899_0009930 | |||
| 296 | Ga0395900_0002410 | |||
| 297 | Ga0395900_0211182 | |||
| 298 | Ga0395898_0027254 | |||
| 299 | Ga0395905_0004259 | |||
| 300 | Ga0395901_0003902 | |||
| 301 | Ga0436361_0054147 | |||
| 302 | Ga0451855_0177504 | |||
| 303 | Ga0451855_0622107 | |||
| 304 | Ga0451855_2005776 | |||
| 305 | Ga0451577_0059642 | |||
| 306 | Ga0451577_0098376 | |||
| 307 | Ga0451577_0107543 | |||
| 308 | Ga0466966_0110407 | |||
| 309 | Ga0453684_0001882 | |||
| 310 | Ga0453684_0140129 | |||
| 311 | Ga0453684_0159468 | |||
| 312 | Ga0453684_0291355 | |||
| 313 | Ga0453684_0300491 | |||
| 314 | Ga0451576_0010901 | |||
| 315 | Ga0451576_0022374 | |||
| 316 | Ga0451576_0027872 | |||
| 317 | Ga0466958_0018012 | |||
| 318 | Ga0495629_0043694 | |||
| 319 | Ga0495638_0036676 | |||
| 320 | Ga0495650_0000023 | |||
| 321 | Ga0495605_0080311 | |||
| 322 | Ga0495585_0000250 | |||
| 323 | Ga0495585_0002184 | |||
| 324 | Ga0495583_0031992 | |||
| 325 | Ga0495606_0000717 | |||
| 326 | Ga0495606_0010959 | |||
| 327 | Ga0495606_0019786 | |||
| 328 | Ga0495616_0001269 | |||
| 329 | Ga0495616_0013236 | |||
| 330 | Ga0495631_0016852 | |||
| 331 | Ga0495637_0082586 | |||
| 332 | Ga0495644_0001634 | |||
| 333 | Ga0495648_0038594 | |||
| 334 | Ga0495648_0053578 | |||
| 335 | Ga0495609_0006950 | |||
| 336 | Ga0495668_0000011 | |||
| 337 | Ga0495625_0000018 | |||
| 338 | Ga0495625_0021528 | |||
| 339 | Ga0495625_0056241 | |||
| 340 | Ga0495661_0002212 | |||
| 341 | Ga0495661_0098437 | |||
| 342 | Ga0495661_0141403 | |||
| 343 | Ga0495649_0000015 | |||
| 344 | Ga0495649_0045523 | |||
| 345 | Ga0495660_0001444 | |||
| 346 | Ga0495687_000409 | |||
| 347 | Ga0495687_082990 | |||
| 348 | Ga0495687_093073 | |||
| 349 | Ga0495679_064044 | |||
| 350 | Ga0495681_0055705 | |||
| 351 | Ga0495686_0000303 | |||
| 352 | Ga0495686_0049621 | |||
| 353 | Ga0495614_0019465 | |||
| 354 | Ga0495678_011549 | |||
| 355 | Ga0495682_0041052 | |||
| 356 | Ga0501236_000162 | |||
| 357 | Ga0501264_000196 | |||
| 358 | nmdc:mga0k408_135_c1 | |||
| 359 | nmdc:mga0k408_18084_c1 | |||
| 360 | Ga0500608_008948 | |||
| 361 | Ga0500616_0048834 | |||
| 362 | Ga0500622_0001773 | |||
| 363 | Ga0500624_000660 | |||
| 364 | 2599481569 | |||
| 365 | 2739302844 | |||
| 366 | 2852631800 | |||
| 367 | 2881957047 | |||
| 368 | 2928083198 | |||
| 369 | 2928152661 | |||
| 370 | 2932086602 | |||
| 371 | 2977234594 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5u10-assembly1.cif.gz_A | e. coli dihydropteroate synthase complexed with pteroic acid | 0.9627 | 12 | 282 |
| 3tzn-assembly1.cif.gz_A | crystal structure of the yersinia pestis dihydropteroate synthase. | 0.9622 | 11 | 282 |
| 5v79-assembly1.cif.gz_A | e. coli dihydropteroate synthase complexed with an 8-mercaptoguanine derivative: 2-((2-amino-9-methyl-6-oxo-6,9-dihydro-1h-purin-8-yl)thio)-n-phenylacetamide | 0.9621 | 12 | 282 |
| 5u14-assembly1.cif.gz_A | e. coli dihydropteroate synthase complexed with an 8-mercaptoguanine derivative: 4-{2-[(2-amino-6-oxo-6,9-dihydro-1h-purin-8-yl)sulfanyl]ethyl}benzene-1-sulfonamide | 0.9607 | 12 | 282 |
| 5u10-assembly1.cif.gz_B | e. coli dihydropteroate synthase complexed with pteroic acid | 0.9601 | 10 | 282 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5jq9A00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Dihydropteroate synthase-like | 0.9571 | 12 | 282 | 3.20.20.20 |
| 3tznB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Dihydropteroate synthase-like | 0.9557 | 12 | 282 | 3.20.20.20 |
| 6dayA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Dihydropteroate synthase-like | 0.9508 | 10 | 283 | 3.20.20.20 |
| af_Q7X7X0_234_532_3.20.20.20 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Dihydropteroate synthase-like | 0.9468 | 10 | 282 | 3.20.20.20 |
| 2dzaA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Dihydropteroate synthase-like | 0.94 | 12 | 281 | 3.20.20.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3B8IKA3-F1-model_v4 | dihydropteroate synthase (EC 2.5.1.15) | 0.9849 | 105 | 281 |
GO:0004156
GO:0005829 GO:0046654 GO:0046656 GO:0046872 |
| AF-A0A7Y3HPJ3-F1-model_v4 | dihydropteroate synthase (EC 2.5.1.15) | 0.9842 | 64 | 282 |
GO:0004156
GO:0005829 GO:0046654 GO:0046656 GO:0046872 |
| AF-A0A7X8GT70-F1-model_v4 | dihydropteroate synthase (EC 2.5.1.15) | 0.9841 | 113 | 282 |
GO:0004156
GO:0005829 GO:0046654 GO:0046656 GO:0046872 |
| AF-A0A1I1MNC0-F1-model_v4 | dihydropteroate synthase (EC 2.5.1.15) | 0.9826 | 45 | 283 |
GO:0004156
GO:0005829 GO:0046654 GO:0046656 GO:0046872 |
| AF-A0A3C0HFM6-F1-model_v4 | dihydropteroate synthase (EC 2.5.1.15) | 0.9809 | 12 | 274 |
GO:0004156
GO:0005829 GO:0046654 GO:0046656 GO:0046872 |