F284886

General Info

Members Datasets Scaffolds Average Seq Length
185 124 371 284

Family's Representative Sequence

Representative Sequence 3300046512|Ga0495610_0002043|Ga0495610_0002043_7510_8472
Length 320
Sequence MKPVPAKLINFTALKLCNKQLTVAKDTFFSKKVTLNAGGRLIDLSSPKVMGIINITPDSFFADSRKPSVDEALQQAQKMLANGATFLDIGAYSSRPGAIDISAQEETDRLLPIVEAIAVKFPEAIMSIDTFRASVAEAAIKGGAHIINDISGGMLDADMFTTVARLNVPYILMHMKGSPQTMNQLAEYDDVFSEVFDYFVSKYSELKRLGVHDVILDPGFGFAKKAEHSYELISRMNEFDLFGLPVLTGISRKRMIYGLLGNTAAEVLNGTTALNTIALMKGANILRVHDVKEAVEAVKIWEACQPTIAKPAADYHFPAS

Samples

Sample ID Description Type Environment
1 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
21 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
22 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
23 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
24 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
25 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
26 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
27 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
28 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
29 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
30 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
31 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
32 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
33 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
34 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
35 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
36 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
37 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
38 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
39 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
40 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
41 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
42 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
58 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
59 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
60 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
61 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
62 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
63 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
64 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
65 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
66 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
67 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
68 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
69 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
70 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
71 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
72 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
73 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
74 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
75 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
76 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
77 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
78 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
79 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
80 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
81 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
82 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
83 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
84 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
85 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
86 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
87 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
88 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
89 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
90 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
91 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
92 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
93 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
94 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
95 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
96 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
97 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
98 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
99 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
100 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
101 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
102 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
103 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
104 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
105 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
106 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
107 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
108 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
109 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
110 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
111 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
112 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
113 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
114 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
115 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
116 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
117 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
118 2738543023 Pedobacter sp. OK628 Isolate Unclassified
119 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
120 2881955468 Edaphocola flava HME-24 Isolate Rhizosphere
121 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
122 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
123 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
124 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.68
Metatranscriptomes 0
Isolates 4.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.95
Nodule 0
Rhizoplane 0.54
Rhizosphere 79.46
Stem 0
Stem Tuber 0
Unclassified 4.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495610_0002043 3300046512 Bacteria 17231
2 JGI24740J21852_10075730 3300001979 Bacteria 891
3 JGI24737J22298_10001058 3300001990 Bacteria 9730
4 JGI24735J21928_10000019 3300002067 Bacteria 108890
5 JGI25162J39368_1000682 3300002737 Bacteria 23752
6 rootH1_10001789 3300003316 Bacteria 33903
7 rootH1_10001789 3300003323 Bacteria 4140
8 rootH1_10076145 3300003316 Bacteria 5376
9 rootH2_10011933 3300003320 Bacteria 68387
10 rootH2_10013134 3300003320 Bacteria 4252
11 rootL2_10018962 3300003322 Bacteria 2865
12 rootL2_10111323 3300003322 Bacteria 11409
13 rootL2_10190836 3300003322 Bacteria 3575
14 rootH1_10003840 3300003323 Bacteria 20383
15 rootH1_10011509 3300003323 Bacteria 15051
16 rootH1_10054743 3300003323 Bacteria 14007
17 rootH1_10109635 3300003323 Bacteria 8130
18 rootH1_10374861 3300003323 Bacteria 1095
19 Ga0065714_10004425 3300005288 Bacteria 7964
20 Ga0065714_10004588 3300005288 Bacteria 7640
21 Ga0070658_10242983 3300005327 Bacteria 1526
22 Ga0070682_100058231 3300005337 Bacteria 2436
23 Ga0070689_100407454 3300005340 Unclassified 1150
24 Ga0070700_100233549 3300005441 Bacteria 1310
25 Ga0070663_100001541 3300005455 Bacteria 12697
26 Ga0068853_100036828 3300005539 Bacteria 4161
27 Ga0070665_100000212 3300005548 Bacteria 100019
28 Ga0068855_100067123 3300005563 Bacteria 4180
29 Ga0068855_100273743 3300005563 Bacteria 1877
30 Ga0068856_100150877 3300005614 Unclassified 2333
31 Ga0068859_100082758 3300005617 Bacteria 3252
32 Ga0068864_100528242 3300005618 Bacteria 1138
33 Ga0068870_10047720 3300005840 Bacteria 2252
34 Ga0068863_100457393 3300005841 Unclassified 1253
35 Ga0075366_10000107 3300006195 Bacteria 33692
36 Ga0075366_10007484 3300006195 Bacteria 6034
37 Ga0097620_100082758 3300006931 Bacteria 3252
38 Ga0105240_10004416 3300009093 Bacteria 21450
39 Ga0105240_10094403 3300009093 Bacteria 3649
40 Ga0105240_10206941 3300009093 Bacteria 2296
41 Ga0105241_10085820 3300009174 Bacteria 2475
42 Ga0105237_10006942 3300009545 Bacteria 12483
43 Ga0105237_10011183 3300009545 Bacteria 9510
44 Ga0105237_10627733 3300009545 Bacteria 1081
45 Ga0105239_10000059 3300010375 Bacteria 155685
46 Ga0105239_10000286 3300010375 Bacteria 74525
47 Ga0105239_10084940 3300010375 Bacteria 3487
48 Ga0105239_10174059 3300010375 Bacteria 2408
49 Ga0105246_10021954 3300011119 Bacteria 4115
50 Ga0157371_10005893 3300013102 Bacteria 10236
51 Ga0157371_10133299 3300013102 Bacteria 1768
52 Ga0157369_10000495 3300013105 Bacteria 52125
53 Ga0157369_10610039 3300013105 Bacteria 1126
54 Ga0157374_10000414 3300013296 Bacteria 38746
55 Ga0157374_10278486 3300013296 Bacteria 1651
56 Ga0163162_10000008 3300013306 Bacteria 316194
57 Ga0163162_10028223 3300013306 Bacteria 5551
58 Ga0163162_10561405 3300013306 Bacteria 1269
59 Ga0157372_10000048 3300013307 Bacteria 142757
60 Ga0157372_10001240 3300013307 Bacteria 27579
61 Ga0157372_10101351 3300013307 Bacteria 3287
62 Ga0157372_10228325 3300013307 Bacteria 2158
63 Ga0157375_10008624 3300013308 Bacteria 8927
64 Ga0157375_10550128 3300013308 Bacteria 1316
65 Ga0157377_10055334 3300014745 Bacteria 2249
66 Ga0157379_10090547 3300014968 Bacteria 2744
67 Ga0213872_10015920 3300021361 Bacteria 3493
68 Ga0209437_100230 3300025233 Bacteria 95882
69 Ga0209026_1001349 3300025250 Bacteria 10966
70 Ga0209455_1001965 3300025272 Bacteria 8464
71 Ga0207647_10000244 3300025904 Bacteria 44547
72 Ga0207643_10110954 3300025908 Unclassified 1616
73 Ga0207705_10384683 3300025909 Bacteria 1084
74 Ga0207705_10397352 3300025909 Bacteria 1066
75 Ga0207695_10062646 3300025913 Bacteria 3838
76 Ga0207695_10315156 3300025913 Bacteria 1454
77 Ga0207671_10004296 3300025914 Bacteria 13701
78 Ga0207671_10126089 3300025914 Bacteria 1961
79 Ga0207694_10385382 3300025924 Bacteria 1164
80 Ga0207706_10000009 3300025933 Bacteria 200607
81 Ga0207670_10362806 3300025936 Unclassified 1150
82 Ga0207665_10093026 3300025939 Bacteria 2093
83 Ga0207667_10050451 3300025949 Bacteria 4390
84 Ga0207667_10070746 3300025949 Bacteria 3631
85 Ga0207667_10236488 3300025949 Bacteria 1870
86 Ga0207702_10121266 3300026078 Unclassified 2340
87 Ga0207641_10398134 3300026088 Unclassified 1322
88 Ga0207676_10462800 3300026095 Bacteria 1198
89 Ga0207676_10810837 3300026095 Bacteria 914
90 Ga0268266_10000177 3300028379 Bacteria 114318
91 Ga0265336_10010115 3300028666 Bacteria 3235
92 Ga0307517_10001416 3300028786 Bacteria 40353
93 Ga0307515_10000081 3300028794 Bacteria 224753
94 Ga0307515_10001368 3300028794 Bacteria 55146
95 Ga0316181_1237636 3300030744 Bacteria 1246
96 Ga0265327_10000054 3300031251 Bacteria 250337
97 Ga0265316_10001738 3300031344 Bacteria 23105
98 Ga0307509_10037445 3300031507 Bacteria 5304
99 Ga0307408_100012183 3300031548 Bacteria 5692
100 Ga0307408_100051300 3300031548 Bacteria 2971
101 Ga0316578_10289013 3300031728 Bacteria 981
102 Ga0307405_10021662 3300031731 Bacteria 3617
103 Ga0307407_10280311 3300031903 Bacteria 1154
104 Ga0307412_10005509 3300031911 Bacteria 7109
105 Ga0307416_100001003 3300032002 Bacteria 14962
106 Ga0307415_100008016 3300032126 Bacteria 5826
107 Ga0307507_10000097 3300033179 Bacteria 139761
108 Ga0307510_10000599 3300033180 Bacteria 36447
109 Ga0395899_0000967 3300037312 Bacteria 26666
110 Ga0395899_0009930 3300037312 Bacteria 7300
111 Ga0395900_0002410 3300037418 Bacteria 20624
112 Ga0395900_0211182 3300037418 Bacteria 1960
113 Ga0395898_0027254 3300037466 Bacteria 5739
114 Ga0395905_0004259 3300037471 Bacteria 14943
115 Ga0395901_0003902 3300038443 Bacteria 15002
116 Ga0436361_0054147 3300039447 Bacteria 7866
117 Ga0451855_0177504 3300041511 Bacteria 942
118 Ga0451855_0622107 3300041511 Bacteria 1616
119 Ga0451855_2005776 3300041511 Bacteria 1583
120 Ga0451577_0059642 3300042876 Bacteria 3402
121 Ga0451577_0098376 3300042876 Bacteria 2613
122 Ga0451577_0107543 3300042876 Bacteria 2493
123 Ga0466966_0110407 3300044684 Bacteria 1695
124 Ga0453684_0001882 3300044712 Bacteria 54512
125 Ga0453684_0140129 3300044712 Unclassified 2889
126 Ga0453684_0159468 3300044712 Unclassified 2670
127 Ga0453684_0291355 3300044712 Bacteria 1858
128 Ga0453684_0300491 3300044712 Bacteria 1824
129 Ga0451576_0010901 3300045051 Bacteria 10391
130 Ga0451576_0022374 3300045051 Bacteria 6855
131 Ga0451576_0027872 3300045051 Bacteria 6060
132 Ga0466958_0018012 3300045836 Bacteria 4094
133 Ga0495629_0043694 3300046459 Bacteria 3146
134 Ga0495638_0036676 3300046460 Bacteria 3122
135 Ga0495650_0000023 3300046471 Bacteria 527763
136 Ga0495605_0080311 3300046474 Bacteria 1527
137 Ga0495585_0000250 3300046492 Bacteria 55780
138 Ga0495585_0002184 3300046492 Bacteria 14202
139 Ga0495583_0031992 3300046506 Bacteria 2543
140 Ga0495606_0000717 3300046507 Bacteria 51281
141 Ga0495606_0010959 3300046507 Bacteria 7452
142 Ga0495606_0019786 3300046507 Bacteria 4988
143 Ga0495616_0001269 3300046513 Bacteria 17736
144 Ga0495616_0013236 3300046513 Bacteria 4661
145 Ga0495631_0016852 3300046518 Bacteria 3470
146 Ga0495637_0082586 3300046520 Bacteria 1279
147 Ga0495644_0001634 3300046523 Bacteria 9121
148 Ga0495648_0038594 3300046524 Bacteria 3051
149 Ga0495648_0053578 3300046524 Bacteria 2443
150 Ga0495609_0006950 3300046538 Bacteria 5710
151 Ga0495668_0000011 3300046616 Bacteria 472186
152 Ga0495625_0000018 3300046660 Bacteria 299567
153 Ga0495625_0021528 3300046660 Bacteria 4963
154 Ga0495625_0056241 3300046660 Bacteria 2802
155 Ga0495661_0002212 3300046665 Bacteria 15169
156 Ga0495661_0098437 3300046665 Bacteria 1651
157 Ga0495661_0141403 3300046665 Bacteria 1309
158 Ga0495649_0000015 3300046694 Bacteria 246431
159 Ga0495649_0045523 3300046694 Bacteria 2392
160 Ga0495660_0001444 3300046810 Bacteria 16270
161 Ga0495687_000409 3300047443 Bacteria 53157
162 Ga0495687_082990 3300047443 Bacteria 1249
163 Ga0495687_093073 3300047443 Bacteria 1149
164 Ga0495679_064044 3300047446 Bacteria 1072
165 Ga0495681_0055705 3300047470 Bacteria 1843
166 Ga0495686_0000303 3300047472 Bacteria 84544
167 Ga0495686_0049621 3300047472 Bacteria 2640
168 Ga0495614_0019465 3300048089 Bacteria 2937
169 Ga0495678_011549 3300049459 Bacteria 4223
170 Ga0495682_0041052 3300049460 Bacteria 1696
171 Ga0501236_000162 3300049670 Bacteria 6947
172 Ga0501264_000196 3300049761 Bacteria 9755
173 nmdc:mga0k408_135_c1 3300050493 Bacteria 36841
174 nmdc:mga0k408_18084_c1 3300050493 Bacteria 3930
175 Ga0500608_008948 3300053122 Bacteria 4236
176 Ga0500616_0048834 3300053153 Bacteria 2242
177 Ga0500622_0001773 3300053156 Bacteria 16514
178 Ga0500624_000660 3300053157 Bacteria 8961
179 2599481569 2599185184 Bacteria 6430550
180 2739302844 2738543023 Bacteria 6767879
181 2852631800 2852627209 Bacteria 5896285
182 2881957047 2881955468 Bacteria 3545609
183 2928083198 2928078545 Bacteria 6534839
184 2928152661 2928147474 Bacteria 6512076
185 2932086602 2932082852 Bacteria 6563563
186 2977234594 2977232053 Bacteria 5485925
187 Ga0495610_0002043
188 JGI24740J21852_10075730
189 JGI24737J22298_10001058
190 JGI24735J21928_10000019
191 JGI25162J39368_1000682
192 rootH1_10001789
193 rootH1_10076145
194 rootH2_10011933
195 rootH2_10013134
196 rootL2_10018962
197 rootL2_10111323
198 rootL2_10190836
199 rootH1_10003840
200 rootH1_10011509
201 rootH1_10054743
202 rootH1_10109635
203 rootH1_10374861
204 Ga0065714_10004425
205 Ga0065714_10004588
206 Ga0070658_10242983
207 Ga0070682_100058231
208 Ga0070689_100407454
209 Ga0070700_100233549
210 Ga0070663_100001541
211 Ga0068853_100036828
212 Ga0070665_100000212
213 Ga0068855_100067123
214 Ga0068855_100273743
215 Ga0068856_100150877
216 Ga0068859_100082758
217 Ga0068864_100528242
218 Ga0068870_10047720
219 Ga0068863_100457393
220 Ga0075366_10000107
221 Ga0075366_10007484
222 Ga0097620_100082758
223 Ga0105240_10004416
224 Ga0105240_10094403
225 Ga0105240_10206941
226 Ga0105241_10085820
227 Ga0105237_10006942
228 Ga0105237_10011183
229 Ga0105237_10627733
230 Ga0105239_10000059
231 Ga0105239_10000286
232 Ga0105239_10084940
233 Ga0105239_10174059
234 Ga0105246_10021954
235 Ga0157371_10005893
236 Ga0157371_10133299
237 Ga0157369_10000495
238 Ga0157369_10610039
239 Ga0157374_10000414
240 Ga0157374_10278486
241 Ga0163162_10000008
242 Ga0163162_10028223
243 Ga0163162_10561405
244 Ga0157372_10000048
245 Ga0157372_10001240
246 Ga0157372_10101351
247 Ga0157372_10228325
248 Ga0157375_10008624
249 Ga0157375_10550128
250 Ga0157377_10055334
251 Ga0157379_10090547
252 Ga0213872_10015920
253 Ga0209437_100230
254 Ga0209026_1001349
255 Ga0209455_1001965
256 Ga0207647_10000244
257 Ga0207643_10110954
258 Ga0207705_10384683
259 Ga0207705_10397352
260 Ga0207695_10062646
261 Ga0207695_10315156
262 Ga0207671_10004296
263 Ga0207671_10126089
264 Ga0207694_10385382
265 Ga0207706_10000009
266 Ga0207670_10362806
267 Ga0207665_10093026
268 Ga0207667_10050451
269 Ga0207667_10070746
270 Ga0207667_10236488
271 Ga0207702_10121266
272 Ga0207641_10398134
273 Ga0207676_10462800
274 Ga0207676_10810837
275 Ga0268266_10000177
276 Ga0265336_10010115
277 Ga0307517_10001416
278 Ga0307515_10000081
279 Ga0307515_10001368
280 Ga0316181_1237636
281 Ga0265327_10000054
282 Ga0265316_10001738
283 Ga0307509_10037445
284 Ga0307408_100012183
285 Ga0307408_100051300
286 Ga0316578_10289013
287 Ga0307405_10021662
288 Ga0307407_10280311
289 Ga0307412_10005509
290 Ga0307416_100001003
291 Ga0307415_100008016
292 Ga0307507_10000097
293 Ga0307510_10000599
294 Ga0395899_0000967
295 Ga0395899_0009930
296 Ga0395900_0002410
297 Ga0395900_0211182
298 Ga0395898_0027254
299 Ga0395905_0004259
300 Ga0395901_0003902
301 Ga0436361_0054147
302 Ga0451855_0177504
303 Ga0451855_0622107
304 Ga0451855_2005776
305 Ga0451577_0059642
306 Ga0451577_0098376
307 Ga0451577_0107543
308 Ga0466966_0110407
309 Ga0453684_0001882
310 Ga0453684_0140129
311 Ga0453684_0159468
312 Ga0453684_0291355
313 Ga0453684_0300491
314 Ga0451576_0010901
315 Ga0451576_0022374
316 Ga0451576_0027872
317 Ga0466958_0018012
318 Ga0495629_0043694
319 Ga0495638_0036676
320 Ga0495650_0000023
321 Ga0495605_0080311
322 Ga0495585_0000250
323 Ga0495585_0002184
324 Ga0495583_0031992
325 Ga0495606_0000717
326 Ga0495606_0010959
327 Ga0495606_0019786
328 Ga0495616_0001269
329 Ga0495616_0013236
330 Ga0495631_0016852
331 Ga0495637_0082586
332 Ga0495644_0001634
333 Ga0495648_0038594
334 Ga0495648_0053578
335 Ga0495609_0006950
336 Ga0495668_0000011
337 Ga0495625_0000018
338 Ga0495625_0021528
339 Ga0495625_0056241
340 Ga0495661_0002212
341 Ga0495661_0098437
342 Ga0495661_0141403
343 Ga0495649_0000015
344 Ga0495649_0045523
345 Ga0495660_0001444
346 Ga0495687_000409
347 Ga0495687_082990
348 Ga0495687_093073
349 Ga0495679_064044
350 Ga0495681_0055705
351 Ga0495686_0000303
352 Ga0495686_0049621
353 Ga0495614_0019465
354 Ga0495678_011549
355 Ga0495682_0041052
356 Ga0501236_000162
357 Ga0501264_000196
358 nmdc:mga0k408_135_c1
359 nmdc:mga0k408_18084_c1
360 Ga0500608_008948
361 Ga0500616_0048834
362 Ga0500622_0001773
363 Ga0500624_000660
364 2599481569
365 2739302844
366 2852631800
367 2881957047
368 2928083198
369 2928152661
370 2932086602
371 2977234594

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00809

Pterin_bind

Pterin binding enzyme

50

289

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
5u10-assembly1.cif.gz_A e. coli dihydropteroate synthase complexed with pteroic acid 0.9627 12 282
3tzn-assembly1.cif.gz_A crystal structure of the yersinia pestis dihydropteroate synthase. 0.9622 11 282
5v79-assembly1.cif.gz_A e. coli dihydropteroate synthase complexed with an 8-mercaptoguanine derivative: 2-((2-amino-9-methyl-6-oxo-6,9-dihydro-1h-purin-8-yl)thio)-n-phenylacetamide 0.9621 12 282
5u14-assembly1.cif.gz_A e. coli dihydropteroate synthase complexed with an 8-mercaptoguanine derivative: 4-{2-[(2-amino-6-oxo-6,9-dihydro-1h-purin-8-yl)sulfanyl]ethyl}benzene-1-sulfonamide 0.9607 12 282
5u10-assembly1.cif.gz_B e. coli dihydropteroate synthase complexed with pteroic acid 0.9601 10 282
ID Description Score Start End Superfamily
5jq9A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Dihydropteroate synthase-like 0.9571 12 282 3.20.20.20
3tznB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Dihydropteroate synthase-like 0.9557 12 282 3.20.20.20
6dayA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Dihydropteroate synthase-like 0.9508 10 283 3.20.20.20
af_Q7X7X0_234_532_3.20.20.20 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Dihydropteroate synthase-like 0.9468 10 282 3.20.20.20
2dzaA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Dihydropteroate synthase-like 0.94 12 281 3.20.20.20
ID Description Score Start End GO Terms
AF-A0A3B8IKA3-F1-model_v4 dihydropteroate synthase (EC 2.5.1.15) 0.9849 105 281 GO:0004156
GO:0005829
GO:0046654
GO:0046656
GO:0046872
AF-A0A7Y3HPJ3-F1-model_v4 dihydropteroate synthase (EC 2.5.1.15) 0.9842 64 282 GO:0004156
GO:0005829
GO:0046654
GO:0046656
GO:0046872
AF-A0A7X8GT70-F1-model_v4 dihydropteroate synthase (EC 2.5.1.15) 0.9841 113 282 GO:0004156
GO:0005829
GO:0046654
GO:0046656
GO:0046872
AF-A0A1I1MNC0-F1-model_v4 dihydropteroate synthase (EC 2.5.1.15) 0.9826 45 283 GO:0004156
GO:0005829
GO:0046654
GO:0046656
GO:0046872
AF-A0A3C0HFM6-F1-model_v4 dihydropteroate synthase (EC 2.5.1.15) 0.9809 12 274 GO:0004156
GO:0005829
GO:0046654
GO:0046656
GO:0046872

Map