F284914

General Info

Members Datasets Scaffolds Average Seq Length
185 150 176 145

Family's Representative Sequence

Representative Sequence 3300046665|Ga0495661_0000362|Ga0495661_0000362_47467_47988
Length 173
Sequence MAVLSAFIVGLVFGIGLIVAGMTNPAKVQGFLDVAGNWDPSLAFVMGGAILVGLLAFRLAGRRERALLGGPMRLPTAARIDRRLVLGSLAFGVGWGLAGFCPGPALASLAAGGVKPLIFSAAMLAGMAAFELLERRGSGGGERAHGVPDQQGDELPADHRQQEKHHHLAEAQH

Samples

Sample ID Description Type Environment
1 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
2 2643221556 Massilia sp. Root1485 Isolate Unclassified
3 2643221569 Achromobacter sp. Root565 Isolate Unclassified
4 2643221684 Massilia sp. Root133 Isolate Unclassified
5 2738541280 Massilia sp. GV090 Isolate Unclassified
6 2738541300 Massilia sp. GV016 Isolate Unclassified
7 2738543018 Massilia sp. GV045 Isolate Unclassified
8 2738543030 Massilia sp. GV097 Isolate Unclassified
9 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
10 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
11 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
12 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
13 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
14 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
15 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
16 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
17 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
18 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
19 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
20 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
21 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
22 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
23 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
24 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
25 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
26 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
27 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
28 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
45 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
46 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
53 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
54 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
55 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
75 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
76 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
77 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
78 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
79 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
80 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
81 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
82 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
83 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
84 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
85 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
86 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
87 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
88 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
89 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
90 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
91 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
92 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
93 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
94 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
95 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
96 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
97 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
98 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
99 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
100 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
101 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
102 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
103 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
104 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
105 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
106 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
107 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
108 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
109 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
110 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
111 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
112 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
113 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
114 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
115 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
116 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
117 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
118 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
119 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
120 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
121 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
122 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
123 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
124 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
125 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
126 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
127 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
128 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
129 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
130 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
131 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
132 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
133 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
134 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
135 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
136 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
137 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
144 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
145 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
146 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
147 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
148 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
149 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
150 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.14
Metatranscriptomes 0
Isolates 4.86

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.92
Nodule 0
Rhizoplane 5.95
Rhizosphere 69.19
Stem 0
Stem Tuber 0
Unclassified 5.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25158J39367_1006010 3300002739 Bacteria 1755
2 JGI25150J39212_1003724 3300002774 Bacteria 3519
3 JGI25159J45721_1008732 3300002987 Bacteria 2751
4 JGI25160J50197_1013684 3300003354 Bacteria 2751
5 JGI25161J50226_1001925 3300003374 Bacteria 5737
6 JGI25161J50226_1003632 3300003374 Bacteria 3459
7 Ga0055538_1000002 3300003751 Bacteria 999437
8 Ga0055539_1000002 3300003752 Bacteria 999437
9 Ga0055533_1000004 3300003756 Bacteria 999437
10 Ga0055525_1000002 3300003759 Bacteria 999437
11 Ga0055526_1015838 3300003771 Bacteria 2998
12 Ga0055537_1006584 3300003773 Bacteria 2922
13 Ga0055524_1004644 3300003775 Bacteria 6300
14 Ga0055534_1002193 3300003784 Bacteria 6962
15 Ga0055530_10007853 3300003791 Bacteria 4395
16 Ga0055531_10011775 3300003794 Bacteria 4179
17 Ga0055541_1000002 3300003841 Bacteria 896405
18 Ga0055543_1002090 3300004625 Bacteria 6955
19 Ga0065165_1016110 3300005262 Bacteria 2814
20 Ga0070689_100023484 3300005340 Bacteria 4616
21 Ga0070668_100041350 3300005347 Bacteria 3532
22 Ga0070710_11019089 3300005437 Bacteria 604
23 Ga0070711_101531254 3300005439 Bacteria 582
24 Ga0070700_101245127 3300005441 Bacteria 623
25 Ga0070708_100614417 3300005445 Bacteria 1025
26 Ga0070698_100354437 3300005471 Bacteria 1399
27 Ga0070697_100160259 3300005536 Bacteria 1900
28 Ga0068853_101384696 3300005539 Bacteria 680
29 Ga0070696_100211358 3300005546 Bacteria 1452
30 Ga0070704_100136289 3300005549 Bacteria 1910
31 Ga0070664_101054159 3300005564 Bacteria 765
32 Ga0068859_101120331 3300005617 Bacteria 866
33 Ga0068863_100133729 3300005841 Bacteria 2369
34 Ga0068858_101735943 3300005842 Bacteria 616
35 Ga0068860_100012669 3300005843 Bacteria 8295
36 Ga0075365_10006101 3300006038 Bacteria 6588
37 Ga0070716_100354867 3300006173 Bacteria 1039
38 Ga0075366_10030868 3300006195 Bacteria 3152
39 Ga0075366_10492404 3300006195 Bacteria 758
40 Ga0097621_100344926 3300006237 Bacteria 1323
41 Ga0097620_101120333 3300006931 Bacteria 866
42 Ga0105245_10957477 3300009098 Bacteria 899
43 Ga0157371_10000010 3300013102 Bacteria 384921
44 Ga0157372_10831751 3300013307 Bacteria 1072
45 Ga0182008_10041835 3300014497 Bacteria 2284
46 Ga0157376_11663091 3300014969 Bacteria 673
47 Ga0213872_10007002 3300021361 Bacteria 5588
48 Ga0209784_100002 3300025224 Bacteria 1753105
49 Ga0209566_100003 3300025225 Bacteria 1753105
50 Ga0209674_100004 3300025226 Bacteria 1753105
51 Ga0209563_100006 3300025230 Bacteria 1753105
52 Ga0209677_100003 3300025253 Bacteria 1753105
53 Ga0209676_1036622 3300025292 Bacteria 1425
54 Ga0209050_1004241 3300025298 Bacteria 9849
55 Ga0207663_10470325 3300025916 Bacteria 972
56 Ga0207670_10161575 3300025936 Bacteria 1672
57 Ga0207665_10133099 3300025939 Bacteria 1767
58 Ga0207679_11029571 3300025945 Bacteria 755
59 Ga0207668_10048430 3300025972 Bacteria 2917
60 Ga0207658_10094709 3300025986 Bacteria 2325
61 Ga0207703_10250430 3300026035 Bacteria 1596
62 Ga0207708_10997173 3300026075 Bacteria 728
63 Ga0207641_10150702 3300026088 Bacteria 2106
64 Ga0209968_1023140 3300027526 Bacteria 1015
65 Ga0209970_1002335 3300027614 Bacteria 3236
66 Ga0268264_10043365 3300028381 Bacteria 3727
67 Ga0307511_10002108 3300030521 Bacteria 20827
68 Ga0265328_10005122 3300031239 Bacteria 5643
69 Ga0265331_10117391 3300031250 Bacteria 1217
70 Ga0265327_10036770 3300031251 Bacteria 2687
71 Ga0307405_11192433 3300031731 Bacteria 658
72 Ga0307412_10266122 3300031911 Bacteria 1339
73 Ga0373925_0525585 3300037068 Bacteria 972
74 Ga0395900_0000640 3300037418 Bacteria 47118
75 Ga0395900_0080968 3300037418 Bacteria 3337
76 Ga0395898_1509368 3300037466 Bacteria 598
77 Ga0395905_0351870 3300037471 Bacteria 1365
78 Ga0395901_0000074 3300038443 Bacteria 138735
79 Ga0436361_0830823 3300039447 Bacteria 16213
80 Ga0466963_0138056 3300044694 Bacteria 1688
81 Ga0466971_0470915 3300044719 Bacteria 617
82 Ga0466967_0674022 3300045976 Bacteria 1023
83 Ga0495627_000033 3300046453 Bacteria 220621
84 Ga0495590_0001511 3300046457 Bacteria 10003
85 Ga0495585_0002552 3300046492 Bacteria 12907
86 Ga0495607_0044132 3300046501 Bacteria 2630
87 Ga0495583_0024879 3300046506 Bacteria 3000
88 Ga0495606_0001496 3300046507 Bacteria 31075
89 Ga0495616_0022166 3300046513 Bacteria 3431
90 Ga0495631_0000543 3300046518 Bacteria 25366
91 Ga0495631_0013366 3300046518 Bacteria 3986
92 Ga0495637_0003469 3300046520 Bacteria 8375
93 Ga0495643_0042373 3300046522 Bacteria 2480
94 Ga0495643_0052085 3300046522 Bacteria 2199
95 Ga0495643_0117697 3300046522 Bacteria 1345
96 Ga0495643_0131611 3300046522 Bacteria 1255
97 Ga0495644_0011512 3300046523 Bacteria 3405
98 Ga0495648_0000445 3300046524 Bacteria 44691
99 Ga0495642_0034953 3300046528 Bacteria 2026
100 Ga0495654_0007964 3300046530 Bacteria 5884
101 Ga0495654_0066503 3300046530 Bacteria 1718
102 Ga0495597_0000827 3300046542 Bacteria 24312
103 Ga0495597_0013685 3300046542 Bacteria 3880
104 Ga0495597_0078484 3300046542 Bacteria 1414
105 Ga0495597_0116501 3300046542 Bacteria 1116
106 Ga0495597_0139343 3300046542 Bacteria 1001
107 Ga0495622_0404485 3300046557 Bacteria 588
108 Ga0495633_0002907 3300046558 Bacteria 11748
109 Ga0495633_0068486 3300046558 Bacteria 1657
110 Ga0495668_0001962 3300046616 Bacteria 18142
111 Ga0495668_0440455 3300046616 Bacteria 717
112 Ga0495625_0006101 3300046660 Bacteria 10803
113 Ga0495625_0007939 3300046660 Bacteria 9122
114 Ga0495625_0027044 3300046660 Bacteria 4325
115 Ga0495625_0080754 3300046660 Bacteria 2264
116 Ga0495659_0000231 3300046664 Bacteria 23421
117 Ga0495661_0000362 3300046665 Bacteria 49179
118 Ga0495661_0005398 3300046665 Bacteria 9088
119 Ga0495661_0009917 3300046665 Bacteria 6514
120 Ga0495661_0019377 3300046665 Bacteria 4458
121 Ga0495661_0101257 3300046665 Bacteria 1621
122 Ga0495623_0083825 3300046679 Bacteria 1968
123 Ga0495623_0126795 3300046679 Bacteria 1532
124 Ga0495623_0164512 3300046679 Bacteria 1301
125 Ga0495623_0481925 3300046679 Bacteria 657
126 Ga0495670_0009907 3300046691 Bacteria 4685
127 Ga0495670_0020403 3300046691 Bacteria 3268
128 Ga0495671_0000108 3300046692 Bacteria 74169
129 Ga0495671_0002867 3300046692 Bacteria 10781
130 Ga0495649_0000750 3300046694 Bacteria 26137
131 Ga0495660_0120468 3300046810 Bacteria 1328
132 Ga0495604_0078940 3300047317 Bacteria 2469
133 Ga0495604_0397111 3300047317 Bacteria 909
134 Ga0495636_0150650 3300047318 Bacteria 1044
135 Ga0495636_0220267 3300047318 Bacteria 871
136 Ga0495672_0000181 3300047320 Bacteria 91278
137 Ga0495672_0503098 3300047320 Bacteria 538
138 Ga0495687_000002 3300047443 Bacteria 1085770
139 Ga0495687_030328 3300047443 Bacteria 2490
140 Ga0495677_0123402 3300047445 Bacteria 989
141 Ga0495679_001726 3300047446 Bacteria 12083
142 Ga0495685_009533 3300047447 Bacteria 3247
143 Ga0495681_0012910 3300047470 Bacteria 4883
144 Ga0495686_0547376 3300047472 Bacteria 604
145 Ga0495626_0000353 3300048091 Bacteria 47964
146 Ga0495626_0001443 3300048091 Bacteria 18883
147 Ga0496100_0441345 3300048903 Bacteria 996
148 Ga0496101_0151528 3300048904 Unclassified 1774
149 Ga0496104_0361047 3300048907 Unclassified 1365
150 Ga0496106_0324442 3300048909 Unclassified 1236
151 Ga0496109_0089219 3300048912 Bacteria 2850
152 Ga0496109_0372959 3300048912 Unclassified 1348
153 Ga0496113_0001305 3300048916 Bacteria 13776
154 Ga0496114_0285945 3300048917 Unclassified 1454
155 Ga0496115_0023877 3300048918 Bacteria 4748
156 Ga0496115_0109086 3300048918 Unclassified 2273
157 Ga0496122_0000971 3300048925 Bacteria 51480
158 Ga0496123_0000786 3300048926 Bacteria 51250
159 Ga0496125_0007001 3300048928 Bacteria 12068
160 Ga0495678_000041 3300049459 Bacteria 185715
161 Ga0501032_0874055 3300049569 Unclassified 566
162 Ga0501036_0992207 3300049572 Bacteria 688
163 Ga0501038_0131811 3300049574 Bacteria 2051
164 Ga0501038_0414104 3300049574 Unclassified 1041
165 Ga0501039_0444190 3300049575 Bacteria 1018
166 Ga0501041_0859812 3300049577 Unclassified 582
167 Ga0501035_0002545 3300049822 Bacteria 17829
168 Ga0501044_0200731 3300049823 Bacteria 1952
169 nmdc:mga03683_65761_c1 3300050489 Bacteria 1540
170 nmdc:mga0k408_435599_c1 3300050493 Bacteria 779
171 nmdc:mga0k408_63249_c1 3300050493 Bacteria 2152
172 nmdc:mga0sz30_153198_c1 3300050516 Bacteria 1020
173 Ga0500646_0000786 3300053090 Bacteria 8853
174 Ga0500641_0377008 3300053096 Bacteria 563
175 Ga0590075_199205 3300059424 Bacteria 530
176 Ga0466962_0451425 3300061719 Bacteria 647

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037068 Ga0373925_0525585 Ga0373925_0525585_328_765 131
2 3300046665 Ga0495661_0101257 Ga0495661_0101257_483_908 134
3 3300047443 Ga0495687_000002 Ga0495687_000002_495085_495510 134
4 iso_pu_bacteria 2599185292 2599904276 134
5 iso_pu_bacteria 2643221556 2643796642 134
6 iso_pu_bacteria 2643221569 2643859431 134
7 iso_pu_bacteria 2643221684 2644470253 134
8 iso_pu_bacteria 2738541280 2738741248 134
9 iso_pu_bacteria 2738541300 2738845715 134
10 iso_pu_bacteria 2738543018 2739277523 134
11 iso_pu_bacteria 2738543030 2739346554 134
12 iso_pu_bacteria 2808606418 2809143504 134
13 3300046492 Ga0495585_0002552 Ga0495585_0002552_1442_1876 137
14 3300046518 Ga0495631_0013366 Ga0495631_0013366_1675_2109 137
15 3300046528 Ga0495642_0034953 Ga0495642_0034953_587_1021 137
16 3300046542 Ga0495597_0139343 Ga0495597_0139343_524_958 137
17 3300046558 Ga0495633_0002907 Ga0495633_0002907_10649_11083 137
18 3300046660 Ga0495625_0080754 Ga0495625_0080754_1526_1957 137
19 3300046665 Ga0495661_0019377 Ga0495661_0019377_241_675 137
20 3300046679 Ga0495623_0164512 Ga0495623_0164512_729_1160 137
21 3300046679 Ga0495623_0481925 Ga0495623_0481925_123_557 137
22 3300046691 Ga0495670_0009907 Ga0495670_0009907_4035_4469 137
23 3300047317 Ga0495604_0397111 Ga0495604_0397111_68_499 137
24 3300048918 Ga0496115_0023877 Ga0496115_0023877_2073_2507 137
25 3300002739 JGI25158J39367_1006010 JGI25158J39367_10060103 138
26 3300002774 JGI25150J39212_1003724 JGI25150J39212_10037246 138
27 3300002987 JGI25159J45721_1008732 JGI25159J45721_10087323 138
28 3300003354 JGI25160J50197_1013684 JGI25160J50197_10136843 138
29 3300003374 JGI25161J50226_1001925 JGI25161J50226_10019256 138
30 3300003374 JGI25161J50226_1003632 JGI25161J50226_10036325 138
31 3300003751 Ga0055538_1000002 Ga0055538_1000002370 138
32 3300003752 Ga0055539_1000002 Ga0055539_1000002370 138
33 3300003756 Ga0055533_1000004 Ga0055533_1000004370 138
34 3300003759 Ga0055525_1000002 Ga0055525_1000002370 138
35 3300003771 Ga0055526_1015838 Ga0055526_10158384 138
36 3300003773 Ga0055537_1006584 Ga0055537_10065844 138
37 3300003775 Ga0055524_1004644 Ga0055524_10046446 138
38 3300003784 Ga0055534_1002193 Ga0055534_10021936 138
39 3300003791 Ga0055530_10007853 Ga0055530_100078534 138
40 3300003794 Ga0055531_10011775 Ga0055531_100117752 138
41 3300003841 Ga0055541_1000002 Ga0055541_1000002473 138
42 3300004625 Ga0055543_1002090 Ga0055543_10020907 138
43 3300005262 Ga0065165_1016110 Ga0065165_10161104 138
44 3300005340 Ga0070689_100023484 Ga0070689_1000234844 138
45 3300005347 Ga0070668_100041350 Ga0070668_1000413502 138
46 3300005437 Ga0070710_11019089 Ga0070710_110190891 138
47 3300005439 Ga0070711_101531254 Ga0070711_1015312541 138
48 3300005441 Ga0070700_101245127 Ga0070700_1012451271 138
49 3300005445 Ga0070708_100614417 Ga0070708_1006144171 138
50 3300005471 Ga0070698_100354437 Ga0070698_1003544372 138
51 3300005536 Ga0070697_100160259 Ga0070697_1001602592 138
52 3300005539 Ga0068853_101384696 Ga0068853_1013846961 138
53 3300005546 Ga0070696_100211358 Ga0070696_1002113581 138
54 3300005549 Ga0070704_100136289 Ga0070704_1001362892 138
55 3300005564 Ga0070664_101054159 Ga0070664_1010541592 138
56 3300005617 Ga0068859_101120331 Ga0068859_1011203312 138
57 3300005841 Ga0068863_100133729 Ga0068863_1001337292 138
58 3300005842 Ga0068858_101735943 Ga0068858_1017359432 138
59 3300005843 Ga0068860_100012669 Ga0068860_1000126692 138
60 3300006038 Ga0075365_10006101 Ga0075365_100061017 138
61 3300006173 Ga0070716_100354867 Ga0070716_1003548672 138
62 3300006195 Ga0075366_10030868 Ga0075366_100308684 138
63 3300006195 Ga0075366_10492404 Ga0075366_104924042 138
64 3300006237 Ga0097621_100344926 Ga0097621_1003449262 138
65 3300006931 Ga0097620_101120333 Ga0097620_1011203332 138
66 3300009098 Ga0105245_10957477 Ga0105245_109574772 138
67 3300013102 Ga0157371_10000010 Ga0157371_10000010182 138
68 3300013307 Ga0157372_10831751 Ga0157372_108317512 138
69 3300014497 Ga0182008_10041835 Ga0182008_100418354 138
70 3300014969 Ga0157376_11663091 Ga0157376_116630912 138
71 3300021361 Ga0213872_10007002 Ga0213872_100070026 138
72 3300025224 Ga0209784_100002 Ga0209784_100002600 138
73 3300025225 Ga0209566_100003 Ga0209566_100003600 138
74 3300025226 Ga0209674_100004 Ga0209674_100004600 138
75 3300025230 Ga0209563_100006 Ga0209563_100006600 138
76 3300025253 Ga0209677_100003 Ga0209677_100003600 138
77 3300025292 Ga0209676_1036622 Ga0209676_10366222 138
78 3300025298 Ga0209050_1004241 Ga0209050_10042416 138
79 3300025916 Ga0207663_10470325 Ga0207663_104703252 138
80 3300025936 Ga0207670_10161575 Ga0207670_101615754 138
81 3300025939 Ga0207665_10133099 Ga0207665_101330992 138
82 3300025945 Ga0207679_11029571 Ga0207679_110295712 138
83 3300025972 Ga0207668_10048430 Ga0207668_100484303 138
84 3300025986 Ga0207658_10094709 Ga0207658_100947093 138
85 3300026035 Ga0207703_10250430 Ga0207703_102504303 138
86 3300026075 Ga0207708_10997173 Ga0207708_109971732 138
87 3300026088 Ga0207641_10150702 Ga0207641_101507022 138
88 3300027526 Ga0209968_1023140 Ga0209968_10231402 138
89 3300027614 Ga0209970_1002335 Ga0209970_10023355 138
90 3300028381 Ga0268264_10043365 Ga0268264_100433653 138
91 3300030521 Ga0307511_10002108 Ga0307511_1000210818 138
92 3300031239 Ga0265328_10005122 Ga0265328_100051225 138
93 3300031250 Ga0265331_10117391 Ga0265331_101173912 138
94 3300031251 Ga0265327_10036770 Ga0265327_100367702 138
95 3300031731 Ga0307405_11192433 Ga0307405_111924332 138
96 3300031911 Ga0307412_10266122 Ga0307412_102661222 138
97 3300037418 Ga0395900_0000640 Ga0395900_0000640_38519_38953 138
98 3300037418 Ga0395900_0080968 Ga0395900_0080968_344_790 138
99 3300037466 Ga0395898_1509368 Ga0395898_1509368_61_498 138
100 3300037471 Ga0395905_0351870 Ga0395905_0351870_721_1167 138
101 3300038443 Ga0395901_0000074 Ga0395901_0000074_98892_99326 138
102 3300039447 Ga0436361_0830823 Ga0436361_0830823_7488_7910 138
103 3300044694 Ga0466963_0138056 Ga0466963_0138056_160_597 138
104 3300044719 Ga0466971_0470915 Ga0466971_0470915_143_580 138
105 3300045976 Ga0466967_0674022 Ga0466967_0674022_451_888 138
106 3300046453 Ga0495627_000033 Ga0495627_000033_78216_78638 138
107 3300046457 Ga0495590_0001511 Ga0495590_0001511_6138_6575 138
108 3300046501 Ga0495607_0044132 Ga0495607_0044132_1737_2174 138
109 3300046506 Ga0495583_0024879 Ga0495583_0024879_2264_2701 138
110 3300046507 Ga0495606_0001496 Ga0495606_0001496_13145_13573 138
111 3300046513 Ga0495616_0022166 Ga0495616_0022166_109_546 138
112 3300046518 Ga0495631_0000543 Ga0495631_0000543_316_753 138
113 3300046520 Ga0495637_0003469 Ga0495637_0003469_6046_6483 138
114 3300046522 Ga0495643_0042373 Ga0495643_0042373_1756_2193 138
115 3300046522 Ga0495643_0052085 Ga0495643_0052085_584_1021 138
116 3300046522 Ga0495643_0117697 Ga0495643_0117697_635_1072 138
117 3300046522 Ga0495643_0131611 Ga0495643_0131611_599_1033 138
118 3300046523 Ga0495644_0011512 Ga0495644_0011512_2063_2485 138
119 3300046524 Ga0495648_0000445 Ga0495648_0000445_44083_44520 138
120 3300046530 Ga0495654_0007964 Ga0495654_0007964_2197_2634 138
121 3300046530 Ga0495654_0066503 Ga0495654_0066503_337_771 138
122 3300046542 Ga0495597_0000827 Ga0495597_0000827_15373_15810 138
123 3300046542 Ga0495597_0013685 Ga0495597_0013685_180_614 138
124 3300046542 Ga0495597_0078484 Ga0495597_0078484_901_1338 138
125 3300046542 Ga0495597_0116501 Ga0495597_0116501_448_882 138
126 3300046557 Ga0495622_0404485 Ga0495622_0404485_26_490 138
127 3300046558 Ga0495633_0068486 Ga0495633_0068486_932_1369 138
128 3300046616 Ga0495668_0001962 Ga0495668_0001962_12428_12865 138
129 3300046616 Ga0495668_0440455 Ga0495668_0440455_220_654 138
130 3300046660 Ga0495625_0006101 Ga0495625_0006101_9379_9813 138
131 3300046660 Ga0495625_0007939 Ga0495625_0007939_3267_3704 138
132 3300046660 Ga0495625_0027044 Ga0495625_0027044_1476_1913 138
133 3300046664 Ga0495659_0000231 Ga0495659_0000231_22463_22897 138
134 3300046665 Ga0495661_0000362 Ga0495661_0000362_47467_47988 138
135 3300046665 Ga0495661_0005398 Ga0495661_0005398_887_1324 138
136 3300046665 Ga0495661_0009917 Ga0495661_0009917_2240_2677 138
137 3300046679 Ga0495623_0083825 Ga0495623_0083825_847_1284 138
138 3300046679 Ga0495623_0126795 Ga0495623_0126795_473_898 138
139 3300046691 Ga0495670_0020403 Ga0495670_0020403_1324_1761 138
140 3300046692 Ga0495671_0000108 Ga0495671_0000108_52921_53355 138
141 3300046692 Ga0495671_0002867 Ga0495671_0002867_9730_10167 138
142 3300046694 Ga0495649_0000750 Ga0495649_0000750_10956_11393 138
143 3300046810 Ga0495660_0120468 Ga0495660_0120468_641_1075 138
144 3300047317 Ga0495604_0078940 Ga0495604_0078940_722_1159 138
145 3300047318 Ga0495636_0150650 Ga0495636_0150650_600_1034 138
146 3300047318 Ga0495636_0220267 Ga0495636_0220267_217_657 138
147 3300047320 Ga0495672_0000181 Ga0495672_0000181_13643_14077 138
148 3300047320 Ga0495672_0503098 Ga0495672_0503098_40_477 138
149 3300047443 Ga0495687_030328 Ga0495687_030328_814_1251 138
150 3300047445 Ga0495677_0123402 Ga0495677_0123402_366_800 138
151 3300047446 Ga0495679_001726 Ga0495679_001726_7713_8150 138
152 3300047447 Ga0495685_009533 Ga0495685_009533_2728_3165 138
153 3300047470 Ga0495681_0012910 Ga0495681_0012910_1014_1451 138
154 3300047472 Ga0495686_0547376 Ga0495686_0547376_82_519 138
155 3300048091 Ga0495626_0000353 Ga0495626_0000353_46911_47348 138
156 3300048091 Ga0495626_0001443 Ga0495626_0001443_2365_2802 138
157 3300048903 Ga0496100_0441345 Ga0496100_0441345_52_573 138
158 3300048904 Ga0496101_0151528 Ga0496101_0151528_653_1108 138
159 3300048907 Ga0496104_0361047 Ga0496104_0361047_875_1330 138
160 3300048909 Ga0496106_0324442 Ga0496106_0324442_600_1055 138
161 3300048912 Ga0496109_0089219 Ga0496109_0089219_379_900 138
162 3300048912 Ga0496109_0372959 Ga0496109_0372959_368_823 138
163 3300048916 Ga0496113_0001305 Ga0496113_0001305_693_1214 138
164 3300048917 Ga0496114_0285945 Ga0496114_0285945_261_716 138
165 3300048918 Ga0496115_0109086 Ga0496115_0109086_1652_2107 138
166 3300048925 Ga0496122_0000971 Ga0496122_0000971_50255_50776 138
167 3300048926 Ga0496123_0000786 Ga0496123_0000786_603_1124 138
168 3300048928 Ga0496125_0007001 Ga0496125_0007001_725_1246 138
169 3300049459 Ga0495678_000041 Ga0495678_000041_61485_61922 138
170 3300049569 Ga0501032_0874055 Ga0501032_0874055_31_480 138
171 3300049572 Ga0501036_0992207 Ga0501036_0992207_32_475 138
172 3300049574 Ga0501038_0131811 Ga0501038_0131811_763_1212 138
173 3300049574 Ga0501038_0414104 Ga0501038_0414104_319_798 138
174 3300049575 Ga0501039_0444190 Ga0501039_0444190_447_896 138
175 3300049577 Ga0501041_0859812 Ga0501041_0859812_14_463 138
176 3300049822 Ga0501035_0002545 Ga0501035_0002545_15590_16024 138
177 3300049823 Ga0501044_0200731 Ga0501044_0200731_702_1136 138
178 3300050489 nmdc:mga03683_65761_c1 nmdc:mga03683_65761_c1_247_678 138
179 3300050493 nmdc:mga0k408_435599_c1 nmdc:mga0k408_435599_c1_185_616 138
180 3300050493 nmdc:mga0k408_63249_c1 nmdc:mga0k408_63249_c1_1618_2055 138
181 3300050516 nmdc:mga0sz30_153198_c1 nmdc:mga0sz30_153198_c1_336_767 138
182 3300053090 Ga0500646_0000786 Ga0500646_0000786_4776_5210 138
183 3300053096 Ga0500641_0377008 Ga0500641_0377008_18_449 138
184 3300059424 Ga0590075_199205 Ga0590075_199205_70_513 138
185 3300061719 Ga0466962_0451425 Ga0466962_0451425_130_567 138

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20398

DUF6691

Family of unknown function (DUF6691)

1

140

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
6g90-assembly1.cif.gz_Z prespliceosome structure provides insight into spliceosome assembly and regulation (map a2) 0.3611 39 138
6g90-assembly1.cif.gz_Z prespliceosome structure provides insight into spliceosome assembly and regulation (map a2) 0.3596 39 138
2qnj-assembly1.cif.gz_A kinase and ubiquitin-associated domains of mark3/par-1 0.3102 69 120
2ib0-assembly1.cif.gz_B crystal structure of a conserved hypothetical protein, rv2844, from mycobacterium tuberculosis 0.2627 23 138
2ib0-assembly1.cif.gz_B crystal structure of a conserved hypothetical protein, rv2844, from mycobacterium tuberculosis 0.2332 23 138
ID Description Score Start End Superfamily
af_I1MDI7_1_157_1.20.1080.10 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.3206 15 126 1.20.1080.10
af_Q8S7T9_89_547_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.3015 51 131 3.40.50.720
4h44B02 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;plastocyanin oxidoreductase 0.2963 27 109 1.10.287.980
af_I1MDI7_1_157_1.20.1080.10 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.2817 15 126 1.20.1080.10
2ib0B00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.2627 23 138 1.20.1260.10
ID Description Score Start End GO Terms
AF-A0A2E3U3T0-F1-model_v4 Transporter 0.9117 23 137 GO:0016020
AF-A0A1I4ZDY5-F1-model_v4 Sulphur transport domain-containing protein 0.9101 2 137 GO:0016020
AF-A0A4Q9H1Z3-F1-model_v4 YeeE/YedE family protein 0.9069 3 137 GO:0016020
AF-A0A244DMK6-F1-model_v4 deleted 0.9044 2 95
AF-A0A6L6Q481-F1-model_v4 YeeE/YedE family protein 0.902 1 138 GO:0016020

Feature Viewer

pLDDT pTM Quality
79.14 0.55 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map