F284946

General Info

Members Datasets Scaffolds Average Seq Length
185 147 370 164

Family's Representative Sequence

Representative Sequence 3300047673|Ga0495593_0107049|Ga0495593_0107049_650_1198
Length 182
Sequence MSGGPYRSRLLEATKCEKITFVLRRDYPGQICSIAKALEVIGERWSLLIVRDVMNGRRRFGELQQGLGVARNVLSTRLQRLVEEDILERRPYQSNPERYEYFLTEKGLDLWPALIALLSWGDRYSPSPEGPPMLIVHKECGGAVSDRGICESCGKVLHARDARALPGPGLAVGRDTATVAAR

Samples

Sample ID Description Type Environment
1 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
33 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
34 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
43 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
44 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
45 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
48 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
49 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
50 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
79 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
80 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
81 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
82 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
83 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
84 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
85 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
86 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
87 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
88 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
89 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
90 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
91 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
92 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
93 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
94 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
95 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
96 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
97 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
98 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
99 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
100 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
101 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
102 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
103 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
104 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
105 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
106 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
107 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
108 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
109 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
110 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
111 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
112 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
113 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
114 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
115 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
116 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
117 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
118 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
119 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
120 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
121 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
122 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
123 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
124 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
125 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
126 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
127 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
128 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
129 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
130 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
131 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
132 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
133 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
134 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
135 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
139 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
140 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
141 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
142 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
143 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
144 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
145 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
146 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
147 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.54
Nodule 0
Rhizoplane 14.05
Rhizosphere 84.32
Stem 0
Stem Tuber 0
Unclassified 1.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495593_0107049 3300047673 Bacteria 1430
2 JGI24746J21847_1000126 3300001977 Bacteria 9216
3 JGI24748J21848_1000258 3300002074 Bacteria 6311
4 JGI24034J26672_10001085 3300002239 Bacteria 3549
5 Ga0070683_100018758 3300005329 Bacteria 6133
6 Ga0070677_10000098 3300005333 Bacteria 28689
7 Ga0070682_100000013 3300005337 Bacteria 254641
8 Ga0070691_10000939 3300005341 Bacteria 11847
9 Ga0070674_100000025 3300005356 Bacteria 78679
10 Ga0070674_100112686 3300005356 Bacteria 2000
11 Ga0070673_100001851 3300005364 Bacteria 12652
12 Ga0070659_101113687 3300005366 Bacteria 696
13 Ga0070714_100319376 3300005435 Bacteria 1452
14 Ga0070701_10413826 3300005438 Bacteria 857
15 Ga0070711_100035320 3300005439 Bacteria 3341
16 Ga0070678_100029882 3300005456 Bacteria 3738
17 Ga0070662_100000016 3300005457 Bacteria 105820
18 Ga0070681_10141466 3300005458 Bacteria 2336
19 Ga0068867_100061530 3300005459 Bacteria 2787
20 Ga0070679_100003743 3300005530 Bacteria 13949
21 Ga0070684_100122747 3300005535 Bacteria 2337
22 Ga0070684_100185749 3300005535 Bacteria 1890
23 Ga0068853_100011592 3300005539 Bacteria 7167
24 Ga0070693_100657024 3300005547 Bacteria 763
25 Ga0070665_100000202 3300005548 Bacteria 104773
26 Ga0068854_100083426 3300005578 Bacteria 2363
27 Ga0068856_100653538 3300005614 Bacteria 1072
28 Ga0068856_100906867 3300005614 Bacteria 900
29 Ga0068864_100000178 3300005618 Bacteria 58416
30 Ga0068866_10000001 3300005718 Bacteria 519680
31 Ga0068863_100000021 3300005841 Bacteria 198088
32 Ga0068858_100000450 3300005842 Bacteria 43091
33 Ga0068860_100036457 3300005843 Bacteria 4712
34 Ga0068862_101121993 3300005844 Bacteria 782
35 Ga0081540_1202180 3300005983 Bacteria 721
36 Ga0070715_10000001 3300006163 Bacteria 693690
37 Ga0075430_100493713 3300006846 Unclassified 1010
38 Ga0075434_100301128 3300006871 Bacteria 1624
39 Ga0068865_100164129 3300006881 Bacteria 1697
40 Ga0105245_10000832 3300009098 Bacteria 28099
41 Ga0105245_10066897 3300009098 Bacteria 3253
42 Ga0105245_10199587 3300009098 Bacteria 1920
43 Ga0105242_10537268 3300009176 Bacteria 1118
44 Ga0105238_10000201 3300009551 Bacteria 66092
45 Ga0105249_10000068 3300009553 Bacteria 148594
46 Ga0105249_10302960 3300009553 Bacteria 1603
47 Ga0105239_10608054 3300010375 Bacteria 1247
48 Ga0105239_12205666 3300010375 Bacteria 640
49 Ga0105246_10049328 3300011119 Bacteria 2882
50 Ga0157370_11116962 3300013104 Bacteria 712
51 Ga0157374_10001471 3300013296 Bacteria 19884
52 Ga0157374_10264497 3300013296 Bacteria 1695
53 Ga0157378_10138579 3300013297 Bacteria 2258
54 Ga0157375_10279721 3300013308 Bacteria 1832
55 Ga0157380_10000158 3300014326 Bacteria 39132
56 Ga0157379_10020408 3300014968 Bacteria 5857
57 Ga0163161_10000032 3300017792 Bacteria 165511
58 Ga0207682_10000182 3300025893 Bacteria 28392
59 Ga0207642_10000006 3300025899 Bacteria 230268
60 Ga0207642_10000007 3300025899 Bacteria 226017
61 Ga0207685_10000011 3300025905 Bacteria 213430
62 Ga0207707_10017656 3300025912 Bacteria 6223
63 Ga0207663_10000683 3300025916 Bacteria 15043
64 Ga0207663_10008349 3300025916 Bacteria 5410
65 Ga0207652_10003054 3300025921 Bacteria 13970
66 Ga0207694_10000004 3300025924 Bacteria 967075
67 Ga0207687_10000018 3300025927 Bacteria 236159
68 Ga0207687_10002274 3300025927 Bacteria 13067
69 Ga0207664_10410681 3300025929 Bacteria 1205
70 Ga0207706_10000068 3300025933 Bacteria 105795
71 Ga0207686_10000859 3300025934 Bacteria 18488
72 Ga0207670_10678021 3300025936 Bacteria 852
73 Ga0207669_10000009 3300025937 Bacteria 168012
74 Ga0207669_10108507 3300025937 Bacteria 1854
75 Ga0207661_10011566 3300025944 Bacteria 6401
76 Ga0207661_10022730 3300025944 Bacteria 4728
77 Ga0207679_10028101 3300025945 Bacteria 3899
78 Ga0207651_10002014 3300025960 Bacteria 9552
79 Ga0207712_10000007 3300025961 Bacteria 539589
80 Ga0207640_10103129 3300025981 Bacteria 2005
81 Ga0207677_10000821 3300026023 Bacteria 17760
82 Ga0207703_10000322 3300026035 Bacteria 52048
83 Ga0207639_10086933 3300026041 Bacteria 2491
84 Ga0207702_10356891 3300026078 Bacteria 1400
85 Ga0207641_10000094 3300026088 Bacteria 124545
86 Ga0207648_10007579 3300026089 Bacteria 10644
87 Ga0207676_10000016 3300026095 Bacteria 311561
88 Ga0207698_10453176 3300026142 Bacteria 1239
89 Ga0207698_11955590 3300026142 Bacteria 601
90 Ga0268266_10000020 3300028379 Bacteria 527065
91 Ga0268264_10002386 3300028381 Bacteria 16562
92 Ga0373953_0157850 3300035117 Bacteria 974
93 Ga0373933_0061095 3300035724 Bacteria 2273
94 Ga0373937_0099860 3300036401 Bacteria 2692
95 Ga0451853_3297601 3300041512 Bacteria 6976
96 Ga0466963_0000312 3300044694 Bacteria 21872
97 Ga0466967_0166607 3300045976 Bacteria 2071
98 Ga0495592_0000036 3300046454 Bacteria 125461
99 Ga0495592_0162364 3300046454 Bacteria 1536
100 Ga0495603_0013324 3300046455 Bacteria 4973
101 Ga0495641_0000003 3300046461 Bacteria 242879
102 Ga0495651_0098612 3300046462 Bacteria 2180
103 Ga0495653_0148340 3300046463 Bacteria 1641
104 Ga0495582_0000027 3300046473 Bacteria 79970
105 Ga0495639_0054606 3300046475 Bacteria 1821
106 Ga0495662_0017427 3300046476 Bacteria 3476
107 Ga0495594_0152316 3300046499 Unclassified 1313
108 Ga0495608_0014382 3300046511 Bacteria 5490
109 Ga0495608_0038913 3300046511 Bacteria 3191
110 Ga0495618_0000004 3300046514 Bacteria 245690
111 Ga0495620_0000246 3300046515 Bacteria 40444
112 Ga0495628_0022623 3300046516 Bacteria 5163
113 Ga0495628_0502294 3300046516 Bacteria 876
114 Ga0495630_0006076 3300046517 Bacteria 8558
115 Ga0495630_0617913 3300046517 Bacteria 830
116 Ga0495644_0001410 3300046523 Bacteria 9822
117 Ga0495663_0062866 3300046525 Bacteria 1170
118 Ga0495652_0038688 3300046529 Bacteria 4130
119 Ga0495640_0004574 3300046533 Bacteria 11028
120 Ga0495586_0009467 3300046535 Bacteria 5186
121 Ga0495598_0000203 3300046537 Bacteria 10475
122 Ga0495645_0008375 3300046543 Bacteria 7220
123 Ga0495633_0155045 3300046558 Bacteria 1057
124 Ga0495656_0004298 3300046615 Bacteria 4868
125 Ga0495635_0000016 3300046663 Bacteria 214088
126 Ga0495588_0159905 3300046674 Bacteria 1191
127 Ga0495657_0044373 3300046675 Bacteria 3024
128 Ga0495647_0000007 3300046681 Bacteria 103790
129 Ga0495647_0014619 3300046681 Bacteria 2737
130 Ga0495658_0000025 3300046683 Bacteria 79910
131 Ga0495669_0000126 3300046684 Bacteria 48798
132 Ga0495613_0000152 3300046689 Bacteria 68384
133 Ga0495624_0000009 3300046690 Bacteria 145026
134 Ga0495670_0009984 3300046691 Bacteria 4668
135 Ga0495649_0009127 3300046694 Bacteria 5914
136 Ga0495600_0049526 3300046809 Bacteria 2741
137 Ga0495676_0014956 3300047321 Bacteria 6926
138 Ga0495676_0117539 3300047321 Bacteria 1940
139 Ga0495676_0426594 3300047321 Bacteria 877
140 Ga0495680_0000061 3300047322 Bacteria 90676
141 Ga0495680_0001442 3300047322 Bacteria 25638
142 Ga0495680_0022347 3300047322 Bacteria 5273
143 Ga0495684_0545802 3300047471 Bacteria 790
144 Ga0495602_0062108 3300048088 Bacteria 3243
145 Ga0496100_0000002 3300048903 Bacteria 489057
146 Ga0496101_0000001 3300048904 Bacteria 489057
147 Ga0496104_0000004 3300048907 Bacteria 641830
148 Ga0496104_0000013 3300048907 Bacteria 397163
149 Ga0496104_0026846 3300048907 Bacteria 5322
150 Ga0496105_0000001 3300048908 Bacteria 1328178
151 Ga0496105_0000006 3300048908 Bacteria 393578
152 Ga0496105_0000500 3300048908 Bacteria 25873
153 Ga0496105_0046411 3300048908 Bacteria 3586
154 Ga0496106_0000022 3300048909 Bacteria 166339
155 Ga0496106_0004469 3300048909 Bacteria 10370
156 Ga0496106_0155402 3300048909 Bacteria 1806
157 Ga0496107_0000016 3300048910 Bacteria 172319
158 Ga0496107_0177734 3300048910 Bacteria 1580
159 Ga0496108_0000001 3300048911 Bacteria 919044
160 Ga0496108_0018714 3300048911 Bacteria 5676
161 Ga0496109_0000003 3300048912 Bacteria 420862
162 Ga0496109_0392760 3300048912 Bacteria 1311
163 Ga0496110_0001693 3300048913 Bacteria 16200
164 Ga0496110_0008920 3300048913 Bacteria 8084
165 Ga0496111_0051292 3300048914 Bacteria 2978
166 Ga0496112_0000003 3300048915 Bacteria 660147
167 Ga0496112_0188330 3300048915 Bacteria 2026
168 Ga0496113_0044902 3300048916 Bacteria 3274
169 Ga0496113_0103157 3300048916 Bacteria 2212
170 Ga0496113_0619102 3300048916 Bacteria 866
171 Ga0496120_0057657 3300048923 Bacteria 2185
172 Ga0501042_0017821 3300049578 Bacteria 4905
173 Ga0501046_0458444 3300049580 Bacteria 916
174 Ga0501047_0929033 3300049581 Bacteria 683
175 Ga0501070_0293899 3300049586 Bacteria 1324
176 Ga0501075_0007831 3300049591 Bacteria 7418
177 nmdc:mga0qj67_480185_c1 3300050509 Unclassified 1000
178 nmdc:mga0n895_157862_c1 3300050512 Bacteria 2299
179 nmdc:mga0rr50_858401_c1 3300050513 Bacteria 774
180 Ga0495601_0000126 3300053077 Bacteria 42871
181 Ga0495601_0004268 3300053077 Bacteria 8251
182 Ga0495612_0004112 3300053078 Bacteria 6027
183 Ga0495595_0014911 3300053084 Bacteria 3305
184 Ga0495619_0003990 3300053085 Bacteria 9460
185 Ga0500614_000581 3300053123 Bacteria 9395
186 Ga0495593_0107049
187 JGI24746J21847_1000126
188 JGI24748J21848_1000258
189 JGI24034J26672_10001085
190 Ga0070683_100018758
191 Ga0070677_10000098
192 Ga0070682_100000013
193 Ga0070691_10000939
194 Ga0070674_100000025
195 Ga0070674_100112686
196 Ga0070673_100001851
197 Ga0070659_101113687
198 Ga0070714_100319376
199 Ga0070701_10413826
200 Ga0070711_100035320
201 Ga0070678_100029882
202 Ga0070662_100000016
203 Ga0070681_10141466
204 Ga0068867_100061530
205 Ga0070679_100003743
206 Ga0070684_100122747
207 Ga0070684_100185749
208 Ga0068853_100011592
209 Ga0070693_100657024
210 Ga0070665_100000202
211 Ga0068854_100083426
212 Ga0068856_100653538
213 Ga0068856_100906867
214 Ga0068864_100000178
215 Ga0068866_10000001
216 Ga0068863_100000021
217 Ga0068858_100000450
218 Ga0068860_100036457
219 Ga0068862_101121993
220 Ga0081540_1202180
221 Ga0070715_10000001
222 Ga0075430_100493713
223 Ga0075434_100301128
224 Ga0068865_100164129
225 Ga0105245_10000832
226 Ga0105245_10066897
227 Ga0105245_10199587
228 Ga0105242_10537268
229 Ga0105238_10000201
230 Ga0105249_10000068
231 Ga0105249_10302960
232 Ga0105239_10608054
233 Ga0105239_12205666
234 Ga0105246_10049328
235 Ga0157370_11116962
236 Ga0157374_10001471
237 Ga0157374_10264497
238 Ga0157378_10138579
239 Ga0157375_10279721
240 Ga0157380_10000158
241 Ga0157379_10020408
242 Ga0163161_10000032
243 Ga0207682_10000182
244 Ga0207642_10000006
245 Ga0207642_10000007
246 Ga0207685_10000011
247 Ga0207707_10017656
248 Ga0207663_10000683
249 Ga0207663_10008349
250 Ga0207652_10003054
251 Ga0207694_10000004
252 Ga0207687_10000018
253 Ga0207687_10002274
254 Ga0207664_10410681
255 Ga0207706_10000068
256 Ga0207686_10000859
257 Ga0207670_10678021
258 Ga0207669_10000009
259 Ga0207669_10108507
260 Ga0207661_10011566
261 Ga0207661_10022730
262 Ga0207679_10028101
263 Ga0207651_10002014
264 Ga0207712_10000007
265 Ga0207640_10103129
266 Ga0207677_10000821
267 Ga0207703_10000322
268 Ga0207639_10086933
269 Ga0207702_10356891
270 Ga0207641_10000094
271 Ga0207648_10007579
272 Ga0207676_10000016
273 Ga0207698_10453176
274 Ga0207698_11955590
275 Ga0268266_10000020
276 Ga0268264_10002386
277 Ga0373953_0157850
278 Ga0373933_0061095
279 Ga0373937_0099860
280 Ga0451853_3297601
281 Ga0466963_0000312
282 Ga0466967_0166607
283 Ga0495592_0000036
284 Ga0495592_0162364
285 Ga0495603_0013324
286 Ga0495641_0000003
287 Ga0495651_0098612
288 Ga0495653_0148340
289 Ga0495582_0000027
290 Ga0495639_0054606
291 Ga0495662_0017427
292 Ga0495594_0152316
293 Ga0495608_0014382
294 Ga0495608_0038913
295 Ga0495618_0000004
296 Ga0495620_0000246
297 Ga0495628_0022623
298 Ga0495628_0502294
299 Ga0495630_0006076
300 Ga0495630_0617913
301 Ga0495644_0001410
302 Ga0495663_0062866
303 Ga0495652_0038688
304 Ga0495640_0004574
305 Ga0495586_0009467
306 Ga0495598_0000203
307 Ga0495645_0008375
308 Ga0495633_0155045
309 Ga0495656_0004298
310 Ga0495635_0000016
311 Ga0495588_0159905
312 Ga0495657_0044373
313 Ga0495647_0000007
314 Ga0495647_0014619
315 Ga0495658_0000025
316 Ga0495669_0000126
317 Ga0495613_0000152
318 Ga0495624_0000009
319 Ga0495670_0009984
320 Ga0495649_0009127
321 Ga0495600_0049526
322 Ga0495676_0014956
323 Ga0495676_0117539
324 Ga0495676_0426594
325 Ga0495680_0000061
326 Ga0495680_0001442
327 Ga0495680_0022347
328 Ga0495684_0545802
329 Ga0495602_0062108
330 Ga0496100_0000002
331 Ga0496101_0000001
332 Ga0496104_0000004
333 Ga0496104_0000013
334 Ga0496104_0026846
335 Ga0496105_0000001
336 Ga0496105_0000006
337 Ga0496105_0000500
338 Ga0496105_0046411
339 Ga0496106_0000022
340 Ga0496106_0004469
341 Ga0496106_0155402
342 Ga0496107_0000016
343 Ga0496107_0177734
344 Ga0496108_0000001
345 Ga0496108_0018714
346 Ga0496109_0000003
347 Ga0496109_0392760
348 Ga0496110_0001693
349 Ga0496110_0008920
350 Ga0496111_0051292
351 Ga0496112_0000003
352 Ga0496112_0188330
353 Ga0496113_0044902
354 Ga0496113_0103157
355 Ga0496113_0619102
356 Ga0496120_0057657
357 Ga0501042_0017821
358 Ga0501046_0458444
359 Ga0501047_0929033
360 Ga0501070_0293899
361 Ga0501075_0007831
362 nmdc:mga0qj67_480185_c1
363 nmdc:mga0n895_157862_c1
364 nmdc:mga0rr50_858401_c1
365 Ga0495601_0000126
366 Ga0495601_0004268
367 Ga0495612_0004112
368 Ga0495595_0014911
369 Ga0495619_0003990
370 Ga0500614_000581

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01638

HxlR

HxlR-like helix-turn-helix

40

129

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ija-assembly1.cif.gz_B structure of s. aureus methicillin resistance factor mecr2 0.9315 26 67
5yhx-assembly2.cif.gz_H structure of lactococcus lactis zitr, wild type 0.9187 26 89
6jbx-assembly1.cif.gz_B crystal structure of streptococcus pneumoniae fabt in complex with dna 0.8973 26 86
3tgn-assembly1.cif.gz_A crystal structure of the zinc-dependent marr family transcriptional regulator adcr in the zn(ii)-bound state 0.8958 26 89
5k5r-assembly2.cif.gz_E aspa-32mer dna,crystal form 2 0.8771 26 92
ID Description Score Start End Superfamily
af_P0AAP5_138_205_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9246 39 67 1.10.10.10
af_Q2FVB5_3_147_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8885 26 89 1.10.10.10
5k5rE00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8771 26 92 1.10.10.10
af_Q5A246_423_511_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8732 28 83 1.10.10.10
5zuoA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8705 39 83 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A3A5HAC0-F1-model_v4 Transcriptional regulator 0.9018 24 102 GO:0003677
AF-A0A3N0CHH4-F1-model_v4 Transcriptional regulator 0.8819 18 100 GO:0003677
AF-A0A544W878-F1-model_v4 Helix-turn-helix transcriptional regulator 0.8465 19 110 GO:0003677
AF-A0A1C5AFU8-F1-model_v4 Transcriptional regulator, HxlR family 0.8369 11 103 GO:0003677
GO:0016209
GO:0016491
AF-A0A1G7XTF7-F1-model_v4 Transcriptional regulator, HxlR family 0.8323 14 102 GO:0003677

Map