F285133

General Info

Members Datasets Scaffolds Average Seq Length
185 122 185 428

Family's Representative Sequence

Representative Sequence 3300059424|Ga0590075_003080|Ga0590075_003080_587_2023
Length 478
Sequence MRSCFALSLAAAGFVAQMTAAPVADEWPQWRGPGGSGVSQDAKAPLHWSPETNVAWKTEIPGRGHSSPVVAGNRIVLTTSIRGEHVPGRKAPVHLGFDRKPGYVHPDSVDVDYRYTLKVVAVDATTGALAWERTAYEGVMFDDRHRKNTFASSTVATDGTLIYAFFESAGLYCYDTNGTLKWHASLGPIIKAGLGPGTSPVIYESLVILQCDQEMGDGSFIVALNRFDGKEAWRVARTNRRSWATPILVRTPQRTELIASGAEAVIAYDPATGKELWRANGVQSHPIPSPVAGHGLVFVTAGSQAKRAYAFRVGGSGALAGTAHVAWEYAKGTAYVPSPILHGRYLYLMTDKGLLTCLDAMTGEVKYEGGRVPVPATFTASPIAIRDRLYLTSEDGDTFVVKAGPVHEVVATNPIGEPVYASLAVARGTIYIRGERHLYAVKGSGVRGEESGPSQETGRKGQGPRSALVPPALPLRLP

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
38 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
39 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
40 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
41 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
55 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
74 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
76 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
77 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
78 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
79 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
80 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
81 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
82 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
83 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
84 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
85 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
86 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
87 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
88 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
89 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
90 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
91 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
92 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
93 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
94 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
95 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
96 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
97 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
98 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
99 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
100 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
101 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
102 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
103 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
104 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
105 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
106 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
107 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
108 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
109 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
110 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
111 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
112 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
113 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
114 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
115 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
116 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
117 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
118 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
119 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
120 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
121 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
122 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.65
Nodule 0
Rhizoplane 0
Rhizosphere 91.35
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_7995161 2162886012 Bacteria 2007
2 Ga0065712_10012048 3300005290 Bacteria 3028
3 Ga0065712_10069448 3300005290 Bacteria 7278
4 Ga0065712_10089674 3300005290 Bacteria 2459
5 Ga0065715_10147591 3300005293 Bacteria 1759
6 Ga0065715_10148254 3300005293 Bacteria 1761
7 Ga0065707_10013612 3300005295 Bacteria 4212
8 Ga0065707_10086558 3300005295 Bacteria 5402
9 Ga0070690_100075228 3300005330 Bacteria 2201
10 Ga0068869_100006351 3300005334 Bacteria 7489
11 Ga0070666_10129415 3300005335 Bacteria 1753
12 Ga0070687_100003799 3300005343 Bacteria 5928
13 Ga0070687_100010142 3300005343 Bacteria 4060
14 Ga0070692_10005924 3300005345 Bacteria 5264
15 Ga0070669_100008642 3300005353 Bacteria 7265
16 Ga0070671_100038286 3300005355 Bacteria 3980
17 Ga0070673_100061333 3300005364 Unclassified 2983
18 Ga0070688_100131003 3300005365 Bacteria 1692
19 Ga0070701_10072278 3300005438 Unclassified 1847
20 Ga0070705_100085172 3300005440 Bacteria 1953
21 Ga0070700_100007106 3300005441 Bacteria 6022
22 Ga0070700_100075015 3300005441 Bacteria 2168
23 Ga0070700_100087430 3300005441 Unclassified 2026
24 Ga0070694_100010698 3300005444 Bacteria 5671
25 Ga0070694_100027866 3300005444 Bacteria 3672
26 Ga0070694_100045096 3300005444 Unclassified 2954
27 Ga0070708_100072124 3300005445 Bacteria 3111
28 Ga0070678_100192741 3300005456 Unclassified 1677
29 Ga0070662_100175048 3300005457 Unclassified 1688
30 Ga0068867_100084743 3300005459 Unclassified 2395
31 Ga0068867_100162549 3300005459 Bacteria 1762
32 Ga0070706_100153348 3300005467 Bacteria 2151
33 Ga0070707_100231698 3300005468 Bacteria 1797
34 Ga0070698_100231831 3300005471 Bacteria 1779
35 Ga0068853_100000006 3300005539 Bacteria 295921
36 Ga0070672_100115063 3300005543 Unclassified 2196
37 Ga0070686_100008042 3300005544 Bacteria 5891
38 Ga0070686_100019481 3300005544 Bacteria 4000
39 Ga0070695_100006128 3300005545 Bacteria 7104
40 Ga0070696_100068356 3300005546 Bacteria 2495
41 Ga0070704_100188309 3300005549 Bacteria 1657
42 Ga0068852_100135823 3300005616 Bacteria 2271
43 Ga0068859_100033854 3300005617 Bacteria 5130
44 Ga0068859_100035529 3300005617 Bacteria 5000
45 Ga0068863_100089190 3300005841 Bacteria 2923
46 Ga0068860_100128795 3300005843 Unclassified 2427
47 Ga0068862_100014136 3300005844 Bacteria 6619
48 Ga0068862_100040573 3300005844 Bacteria 3956
49 Ga0081455_10013191 3300005937 Bacteria 8185
50 Ga0075365_10008324 3300006038 Bacteria 5877
51 Ga0075365_10051399 3300006038 Bacteria 2722
52 Ga0075364_10002543 3300006051 Bacteria 10222
53 Ga0075364_10099453 3300006051 Bacteria 1936
54 Ga0075362_10013627 3300006177 Bacteria 3259
55 Ga0075367_10004554 3300006178 Bacteria 6784
56 Ga0075367_10009779 3300006178 Bacteria 5024
57 Ga0075367_10023085 3300006178 Bacteria 3497
58 Ga0075366_10021559 3300006195 Bacteria 3745
59 Ga0075428_100014208 3300006844 Bacteria 8856
60 Ga0075431_100049555 3300006847 Unclassified 4330
61 Ga0075431_100080412 3300006847 Bacteria 3365
62 Ga0075431_100115654 3300006847 Bacteria 2769
63 Ga0075431_100181603 3300006847 Bacteria 2159
64 Ga0075433_10020334 3300006852 Bacteria 5548
65 Ga0075429_100099096 3300006880 Bacteria 2543
66 Ga0097620_100033848 3300006931 Bacteria 5130
67 Ga0097620_100035526 3300006931 Bacteria 5000
68 Ga0111539_10013361 3300009094 Bacteria 10261
69 Ga0111539_10026016 3300009094 Bacteria 7162
70 Ga0111539_10043452 3300009094 Bacteria 5387
71 Ga0111539_10132987 3300009094 Unclassified 2913
72 Ga0111539_10219658 3300009094 Unclassified 2214
73 Ga0114129_10000108 3300009147 Bacteria 81939
74 Ga0114129_10066973 3300009147 Bacteria 5008
75 Ga0114129_10191218 3300009147 Bacteria 2779
76 Ga0105243_10000044 3300009148 Bacteria 156661
77 Ga0105243_10233305 3300009148 Unclassified 1634
78 Ga0105242_10000012 3300009176 Bacteria 136893
79 Ga0105248_10037457 3300009177 Bacteria 5426
80 Ga0105248_10232387 3300009177 Unclassified 2076
81 Ga0157378_10014809 3300013297 Bacteria 6826
82 Ga0157378_10048861 3300013297 Unclassified 3762
83 Ga0163162_10289536 3300013306 Unclassified 1770
84 Ga0157380_10005208 3300014326 Bacteria 9088
85 Ga0157380_10054526 3300014326 Unclassified 3173
86 Ga0207645_10013057 3300025907 Bacteria 5613
87 Ga0207684_10156556 3300025910 Unclassified 1961
88 Ga0207662_10003788 3300025918 Bacteria 7846
89 Ga0207662_10014463 3300025918 Unclassified 4430
90 Ga0207646_10201728 3300025922 Bacteria 1797
91 Ga0207646_10278471 3300025922 Unclassified 1512
92 Ga0207681_10014725 3300025923 Unclassified 4869
93 Ga0207681_10045957 3300025923 Bacteria 2935
94 Ga0207659_10188266 3300025926 Bacteria 1640
95 Ga0207706_10134833 3300025933 Bacteria 2172
96 Ga0207706_10138395 3300025933 Unclassified 2142
97 Ga0207706_10150225 3300025933 Bacteria 2049
98 Ga0207686_10000445 3300025934 Bacteria 27617
99 Ga0207709_10000029 3300025935 Bacteria 333327
100 Ga0207691_10028164 3300025940 Bacteria 5262
101 Ga0207691_10130614 3300025940 Unclassified 2219
102 Ga0207691_10190746 3300025940 Unclassified 1787
103 Ga0207711_10098000 3300025941 Bacteria 2590
104 Ga0207689_10011607 3300025942 Bacteria 7548
105 Ga0207679_10151218 3300025945 Bacteria 1889
106 Ga0207651_10011262 3300025960 Bacteria 4998
107 Ga0207651_10071554 3300025960 Bacteria 2459
108 Ga0207639_10000001 3300026041 Bacteria 1431562
109 Ga0207708_10001112 3300026075 Bacteria 20185
110 Ga0207648_10029259 3300026089 Unclassified 4885
111 Ga0207648_10078092 3300026089 Bacteria 2887
112 Ga0207683_10250021 3300026121 Unclassified 1618
113 Ga0207428_10004909 3300027907 Bacteria 12605
114 Ga0268265_10033817 3300028380 Unclassified 3720
115 Ga0265338_10041733 3300028800 Bacteria 4287
116 Ga0265339_10000357 3300031249 Bacteria 36243
117 Ga0307408_100187693 3300031548 Bacteria 1663
118 Ga0265313_10000964 3300031595 Bacteria 28500
119 Ga0265314_10000403 3300031711 Bacteria 58630
120 Ga0265342_10009689 3300031712 Bacteria 6754
121 Ga0307405_10152084 3300031731 Bacteria 1629
122 Ga0307410_10003868 3300031852 Bacteria 7617
123 Ga0307410_10023172 3300031852 Bacteria 3854
124 Ga0307410_10047744 3300031852 Unclassified 2863
125 Ga0307406_10007776 3300031901 Bacteria 5959
126 Ga0307407_10015335 3300031903 Unclassified 3785
127 Ga0307409_100007815 3300031995 Bacteria 6434
128 Ga0307416_100012146 3300032002 Bacteria 5786
129 Ga0307411_10009803 3300032005 Bacteria 5063
130 Ga0307411_10186064 3300032005 Bacteria 1581
131 Ga0373946_0029432 3300035171 Bacteria 2186
132 Ga0373933_0038732 3300035724 Unclassified 2802
133 Ga0373937_0059630 3300036401 Unclassified 3507
134 Ga0373925_0002006 3300037068 Bacteria 16871
135 Ga0453684_0055404 3300044712 Bacteria 5155
136 Ga0453684_0106219 3300044712 Bacteria 3422
137 Ga0495638_0025485 3300046460 Bacteria 3844
138 Ga0495674_0025800 3300047319 Bacteria 5382
139 Ga0501034_0001655 3300049571 Bacteria 28760
140 Ga0501039_0058677 3300049575 Unclassified 2981
141 Ga0501042_0006342 3300049578 Bacteria 7673
142 Ga0501072_0020110 3300049588 Bacteria 5170
143 Ga0501074_0130643 3300049590 Bacteria 1797
144 Ga0501075_0139388 3300049591 Bacteria 1848
145 Ga0501075_0209462 3300049591 Unclassified 1487
146 Ga0501076_0007902 3300049592 Bacteria 7756
147 Ga0501076_0052712 3300049592 Bacteria 3223
148 Ga0501079_0147979 3300049741 Bacteria 1831
149 Ga0501081_0130492 3300049743 Unclassified 1795
150 Ga0501045_0024959 3300049824 Unclassified 4295
151 nmdc:mga03683_10920_c1 3300050489 Bacteria 3269
152 nmdc:mga00v17_50806_c1 3300050491 Bacteria 2521
153 nmdc:mga00v17_52902_c1 3300050491 Unclassified 2473
154 nmdc:mga0k408_2062_c2 3300050493 Bacteria 8461
155 nmdc:mga06z11_23820_c1 3300050494 Bacteria 2881
156 nmdc:mga06z11_58476_c1 3300050494 Bacteria 2000
157 nmdc:mga05p37_276374_c1 3300050507 Bacteria 2005
158 nmdc:mga05p37_779_c1 3300050507 Bacteria 35459
159 nmdc:mga09592_193061_c1 3300050508 Bacteria 1762
160 nmdc:mga06r32_109556_c1 3300050510 Bacteria 2716
161 nmdc:mga06r32_294356_c1 3300050510 Bacteria 1610
162 nmdc:mga06r32_82551_c1 3300050510 Bacteria 3131
163 nmdc:mga08y16_103566_c1 3300050511 Bacteria 2963
164 nmdc:mga08y16_173289_c1 3300050511 Unclassified 2241
165 nmdc:mga08y16_26205_c1 3300050511 Bacteria 6148
166 nmdc:mga08y16_46446_c1 3300050511 Bacteria 4547
167 nmdc:mga0n895_90703_c1 3300050512 Bacteria 3058
168 nmdc:mga0rr50_51856_c1 3300050513 Bacteria 3046
169 nmdc:mga0rr50_8260_c1 3300050513 Bacteria 6471
170 nmdc:mga0a205_210010_c1 3300050515 Bacteria 1835
171 nmdc:mga0a205_40692_c1 3300050515 Bacteria 4474
172 Ga0500568_0002493 3300053139 Bacteria 10786
173 Ga0501084_0038276 3300054114 Bacteria 4010
174 Ga0501084_0047061 3300054114 Bacteria 3612
175 Ga0590071_000064 3300059421 Bacteria 28214
176 Ga0590071_000295 3300059421 Bacteria 14516
177 Ga0590074_002816 3300059423 Bacteria 2866
178 Ga0590075_000164 3300059424 Bacteria 18191
179 Ga0590075_003080 3300059424 Bacteria 3956
180 Ga0590075_003456 3300059424 Bacteria 3757
181 Ga0590077_000117 3300059426 Bacteria 21293
182 Ga0590077_000584 3300059426 Bacteria 10046
183 Ga0501082_0067326 3300060353 Bacteria 3084
184 Ga0501082_0077684 3300060353 Bacteria 2863
185 Ga0501082_0303546 3300060353 Bacteria 1390

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300060353 Ga0501082_0303546 Ga0501082_0303546_169_1263 326
2 3300009177 Ga0105248_10232387 Ga0105248_102323872 366
3 3300014326 Ga0157380_10054526 Ga0157380_100545262 366
4 3300025933 Ga0207706_10134833 Ga0207706_101348331 366
5 3300005616 Ga0068852_100135823 Ga0068852_1001358231 371
6 3300005841 Ga0068863_100089190 Ga0068863_1000891902 371
7 3300009177 Ga0105248_10037457 Ga0105248_100374575 371
8 3300025918 Ga0207662_10003788 Ga0207662_100037885 371
9 3300025941 Ga0207711_10098000 Ga0207711_100980002 371
10 3300025960 Ga0207651_10011262 Ga0207651_100112625 371
11 3300050513 nmdc:mga0rr50_8260_c1 nmdc:mga0rr50_8260_c1_2854_4146 371
12 3300049588 Ga0501072_0020110 Ga0501072_0020110_1255_2496 374
13 3300049592 Ga0501076_0007902 Ga0501076_0007902_3877_5118 374
14 3300049743 Ga0501081_0130492 Ga0501081_0130492_150_1391 374
15 3300044712 Ga0453684_0055404 Ga0453684_0055404_2264_3475 375
16 3300005459 Ga0068867_100162549 Ga0068867_1001625492 381
17 3300005456 Ga0070678_100192741 Ga0070678_1001927411 382
18 3300026121 Ga0207683_10250021 Ga0207683_102500212 382
19 3300026089 Ga0207648_10078092 Ga0207648_100780923 383
20 3300025933 Ga0207706_10150225 Ga0207706_101502251 385
21 3300005293 Ga0065715_10148254 Ga0065715_101482542 386
22 3300005335 Ga0070666_10129415 Ga0070666_101294151 386
23 3300005355 Ga0070671_100038286 Ga0070671_1000382861 386
24 3300005365 Ga0070688_100131003 Ga0070688_1001310031 386
25 3300025926 Ga0207659_10188266 Ga0207659_101882661 386
26 3300025945 Ga0207679_10151218 Ga0207679_101512181 386
27 3300025960 Ga0207651_10071554 Ga0207651_100715541 386
28 3300005441 Ga0070700_100075015 Ga0070700_1000750152 387
29 3300005444 Ga0070694_100027866 Ga0070694_1000278662 387
30 3300025907 Ga0207645_10013057 Ga0207645_100130575 387
31 3300049578 Ga0501042_0006342 Ga0501042_0006342_146_1492 387
32 3300049592 Ga0501076_0052712 Ga0501076_0052712_715_2061 387
33 3300005343 Ga0070687_100010142 Ga0070687_1000101422 388
34 3300060353 Ga0501082_0067326 Ga0501082_0067326_93_1439 388
35 3300005290 Ga0065712_10012048 Ga0065712_100120481 389
36 3300006051 Ga0075364_10099453 Ga0075364_100994532 389
37 3300009148 Ga0105243_10000044 Ga0105243_1000004453 389
38 3300009176 Ga0105242_10000012 Ga0105242_1000001226 389
39 3300025934 Ga0207686_10000445 Ga0207686_100004458 389
40 3300025935 Ga0207709_10000029 Ga0207709_1000002927 389
41 3300050491 nmdc:mga00v17_52902_c1 nmdc:mga00v17_52902_c1_813_2165 389
42 3300013306 Ga0163162_10289536 Ga0163162_102895362 390
43 3300005440 Ga0070705_100085172 Ga0070705_1000851722 391
44 3300025940 Ga0207691_10190746 Ga0207691_101907461 391
45 3300031852 Ga0307410_10023172 Ga0307410_100231722 391
46 3300032005 Ga0307411_10009803 Ga0307411_100098032 391
47 3300005617 Ga0068859_100033854 Ga0068859_1000338542 393
48 3300006931 Ga0097620_100033848 Ga0097620_1000338482 393
49 3300049571 Ga0501034_0001655 Ga0501034_0001655_18841_20268 393
50 3300005290 Ga0065712_10089674 Ga0065712_100896742 394
51 3300006038 Ga0075365_10051399 Ga0075365_100513992 394
52 3300006051 Ga0075364_10002543 Ga0075364_100025434 394
53 3300006177 Ga0075362_10013627 Ga0075362_100136273 394
54 3300006178 Ga0075367_10004554 Ga0075367_100045542 394
55 3300050489 nmdc:mga03683_10920_c1 nmdc:mga03683_10920_c1_1158_2477 394
56 3300050491 nmdc:mga00v17_50806_c1 nmdc:mga00v17_50806_c1_741_2060 394
57 3300050493 nmdc:mga0k408_2062_c2 nmdc:mga0k408_2062_c2_6845_8164 394
58 3300025923 Ga0207681_10045957 Ga0207681_100459572 395
59 3300025940 Ga0207691_10028164 Ga0207691_100281644 395
60 3300005293 Ga0065715_10147591 Ga0065715_101475912 396
61 3300005444 Ga0070694_100045096 Ga0070694_1000450961 397
62 3300005467 Ga0070706_100153348 Ga0070706_1001533481 397
63 3300006847 Ga0075431_100080412 Ga0075431_1000804122 397
64 3300037068 Ga0373925_0002006 Ga0373925_0002006_3851_5161 397
65 3300005471 Ga0070698_100231831 Ga0070698_1002318311 399
66 3300054114 Ga0501084_0047061 Ga0501084_0047061_2271_3572 399
67 3300059421 Ga0590071_000295 Ga0590071_000295_9736_11064 399
68 3300059423 Ga0590074_002816 Ga0590074_002816_111_1439 399
69 3300059426 Ga0590077_000584 Ga0590077_000584_7693_9021 399
70 3300006844 Ga0075428_100014208 Ga0075428_1000142081 400
71 3300009148 Ga0105243_10233305 Ga0105243_102333052 400
72 3300049590 Ga0501074_0130643 Ga0501074_0130643_475_1776 400
73 3300050511 nmdc:mga08y16_26205_c1 nmdc:mga08y16_26205_c1_3608_5005 400
74 3300005546 Ga0070696_100068356 Ga0070696_1000683562 401
75 3300013297 Ga0157378_10048861 Ga0157378_100488612 401
76 3300031903 Ga0307407_10015335 Ga0307407_100153352 402
77 3300009094 Ga0111539_10013361 Ga0111539_100133615 403
78 3300031852 Ga0307410_10047744 Ga0307410_100477442 403
79 3300050511 nmdc:mga08y16_173289_c1 nmdc:mga08y16_173289_c1_525_1889 403
80 3300031901 Ga0307406_10007776 Ga0307406_100077762 404
81 3300005334 Ga0068869_100006351 Ga0068869_1000063516 405
82 3300025942 Ga0207689_10011607 Ga0207689_100116072 405
83 3300035171 Ga0373946_0029432 Ga0373946_0029432_134_1453 405
84 3300050512 nmdc:mga0n895_90703_c1 nmdc:mga0n895_90703_c1_880_2172 405
85 3300059421 Ga0590071_000064 Ga0590071_000064_17921_19279 405
86 3300059424 Ga0590075_000164 Ga0590075_000164_1267_2625 405
87 3300059426 Ga0590077_000117 Ga0590077_000117_18499_19857 405
88 3300005544 Ga0070686_100019481 Ga0070686_1000194812 406
89 3300006038 Ga0075365_10008324 Ga0075365_100083244 406
90 3300006847 Ga0075431_100181603 Ga0075431_1001816032 406
91 3300005295 Ga0065707_10013612 Ga0065707_100136122 408
92 3300032005 Ga0307411_10186064 Ga0307411_101860641 409
93 3300005545 Ga0070695_100006128 Ga0070695_1000061285 410
94 3300031995 Ga0307409_100007815 Ga0307409_1000078153 410
95 3300049591 Ga0501075_0139388 Ga0501075_0139388_83_1372 410
96 3300049741 Ga0501079_0147979 Ga0501079_0147979_295_1584 410
97 3300060353 Ga0501082_0077684 Ga0501082_0077684_759_2048 410
98 3300031852 Ga0307410_10003868 Ga0307410_100038684 411
99 3300049591 Ga0501075_0209462 Ga0501075_0209462_53_1393 411
100 3300009147 Ga0114129_10000108 Ga0114129_1000010831 413
101 3300049575 Ga0501039_0058677 Ga0501039_0058677_49_1560 413
102 3300050507 nmdc:mga05p37_779_c1 nmdc:mga05p37_779_c1_12143_13546 413
103 3300005468 Ga0070707_100231698 Ga0070707_1002316981 414
104 3300025922 Ga0207646_10201728 Ga0207646_102017281 414
105 3300009147 Ga0114129_10066973 Ga0114129_100669733 415
106 3300049824 Ga0501045_0024959 Ga0501045_0024959_785_2296 415
107 3300006852 Ga0075433_10020334 Ga0075433_100203341 416
108 3300006880 Ga0075429_100099096 Ga0075429_1000990962 416
109 3300009094 Ga0111539_10132987 Ga0111539_101329873 416
110 3300027907 Ga0207428_10004909 Ga0207428_100049093 416
111 3300050508 nmdc:mga09592_193061_c1 nmdc:mga09592_193061_c1_343_1716 416
112 3300050511 nmdc:mga08y16_46446_c1 nmdc:mga08y16_46446_c1_1498_2871 416
113 3300050515 nmdc:mga0a205_40692_c1 nmdc:mga0a205_40692_c1_2702_4054 416
114 3300054114 Ga0501084_0038276 Ga0501084_0038276_367_1740 416
115 3300006847 Ga0075431_100049555 Ga0075431_1000495554 417
116 3300006847 Ga0075431_100115654 Ga0075431_1001156542 417
117 3300050510 nmdc:mga06r32_109556_c1 nmdc:mga06r32_109556_c1_1166_2539 417
118 3300050510 nmdc:mga06r32_294356_c1 nmdc:mga06r32_294356_c1_161_1534 417
119 3300050510 nmdc:mga06r32_82551_c1 nmdc:mga06r32_82551_c1_1031_2404 417
120 3300005539 Ga0068853_100000006 Ga0068853_100000006166 419
121 3300026041 Ga0207639_10000001 Ga0207639_100000011065 419
122 3300035724 Ga0373933_0038732 Ga0373933_0038732_1100_2446 419
123 3300036401 Ga0373937_0059630 Ga0373937_0059630_234_1580 419
124 3300047319 Ga0495674_0025800 Ga0495674_0025800_729_2075 419
125 3300005445 Ga0070708_100072124 Ga0070708_1000721243 420
126 3300005549 Ga0070704_100188309 Ga0070704_1001883091 420
127 3300005617 Ga0068859_100035529 Ga0068859_1000355292 420
128 3300005844 Ga0068862_100040573 Ga0068862_1000405732 420
129 3300006931 Ga0097620_100035526 Ga0097620_1000355262 420
130 3300025910 Ga0207684_10156556 Ga0207684_101565562 420
131 3300028800 Ga0265338_10041733 Ga0265338_100417332 420
132 3300031249 Ga0265339_10000357 Ga0265339_100003575 420
133 3300031595 Ga0265313_10000964 Ga0265313_1000096422 420
134 3300031711 Ga0265314_10000403 Ga0265314_1000040347 420
135 3300031712 Ga0265342_10009689 Ga0265342_100096894 420
136 3300009147 Ga0114129_10191218 Ga0114129_101912182 421
137 3300050507 nmdc:mga05p37_276374_c1 nmdc:mga05p37_276374_c1_11_1360 421
138 3300005290 Ga0065712_10069448 Ga0065712_100694483 422
139 3300009094 Ga0111539_10219658 Ga0111539_102196582 422
140 3300053139 Ga0500568_0002493 Ga0500568_0002493_2826_4190 425
141 3300025922 Ga0207646_10278471 Ga0207646_102784711 426
142 3300044712 Ga0453684_0106219 Ga0453684_0106219_2015_3379 426
143 3300059424 Ga0590075_003080 Ga0590075_003080_587_2023 427
144 3300059424 Ga0590075_003456 Ga0590075_003456_1142_2488 427
145 3300006178 Ga0075367_10023085 Ga0075367_100230852 428
146 3300050494 nmdc:mga06z11_23820_c1 nmdc:mga06z11_23820_c1_1003_2322 428
147 3300005937 Ga0081455_10013191 Ga0081455_100131911 429
148 3300009094 Ga0111539_10043452 Ga0111539_100434522 429
149 3300031548 Ga0307408_100187693 Ga0307408_1001876932 429
150 3300031731 Ga0307405_10152084 Ga0307405_101520841 429
151 3300032002 Ga0307416_100012146 Ga0307416_1000121463 429
152 3300050511 nmdc:mga08y16_103566_c1 nmdc:mga08y16_103566_c1_390_1733 429
153 3300006178 Ga0075367_10009779 Ga0075367_100097792 430
154 3300006195 Ga0075366_10021559 Ga0075366_100215592 430
155 3300050494 nmdc:mga06z11_58476_c1 nmdc:mga06z11_58476_c1_456_1823 430
156 2162886012 MBSR1b_contig_7995161 MBSR1b_0202.00000460 432
157 3300005295 Ga0065707_10086558 Ga0065707_100865582 432
158 3300005330 Ga0070690_100075228 Ga0070690_1000752281 432
159 3300005343 Ga0070687_100003799 Ga0070687_1000037992 432
160 3300005345 Ga0070692_10005924 Ga0070692_100059243 432
161 3300005353 Ga0070669_100008642 Ga0070669_1000086425 432
162 3300005364 Ga0070673_100061333 Ga0070673_1000613332 432
163 3300005438 Ga0070701_10072278 Ga0070701_100722781 432
164 3300005441 Ga0070700_100007106 Ga0070700_1000071063 432
165 3300005441 Ga0070700_100087430 Ga0070700_1000874302 432
166 3300005444 Ga0070694_100010698 Ga0070694_1000106982 432
167 3300005457 Ga0070662_100175048 Ga0070662_1001750482 432
168 3300005459 Ga0068867_100084743 Ga0068867_1000847432 432
169 3300005543 Ga0070672_100115063 Ga0070672_1001150631 432
170 3300005544 Ga0070686_100008042 Ga0070686_1000080422 432
171 3300005843 Ga0068860_100128795 Ga0068860_1001287952 432
172 3300005844 Ga0068862_100014136 Ga0068862_1000141364 432
173 3300009094 Ga0111539_10026016 Ga0111539_100260164 432
174 3300013297 Ga0157378_10014809 Ga0157378_100148094 432
175 3300014326 Ga0157380_10005208 Ga0157380_100052085 432
176 3300025918 Ga0207662_10014463 Ga0207662_100144632 432
177 3300025923 Ga0207681_10014725 Ga0207681_100147252 432
178 3300025933 Ga0207706_10138395 Ga0207706_101383951 432
179 3300025940 Ga0207691_10130614 Ga0207691_101306142 432
180 3300026075 Ga0207708_10001112 Ga0207708_100011126 432
181 3300026089 Ga0207648_10029259 Ga0207648_100292593 432
182 3300028380 Ga0268265_10033817 Ga0268265_100338174 432
183 3300046460 Ga0495638_0025485 Ga0495638_0025485_214_1572 432
184 3300050513 nmdc:mga0rr50_51856_c1 nmdc:mga0rr50_51856_c1_1389_2759 432
185 3300050515 nmdc:mga0a205_210010_c1 nmdc:mga0a205_210010_c1_45_1409 432

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13570

PQQ_3

PQQ-like domain

324

362

0.94

PF13570

PQQ_3

PQQ-like domain

53

85

0.92

PF13360

PQQ_2

PQQ-like domain

117

367

0.77

PF13360

PQQ_2

PQQ-like domain

217

442

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
2yms-assembly1.cif.gz_D structure and assembly of a b-propeller with nine blades and a new conserved repetitive sequence motif 0.8317 278 359
6y7o-assembly2.cif.gz_B the complex between the eight-bladed symmetrical designer protein tako8 and the silicotungstic acid keggin (sta) 0.8183 52 432
6y7o-assembly3.cif.gz_C the complex between the eight-bladed symmetrical designer protein tako8 and the silicotungstic acid keggin (sta) 0.8144 52 429
6y7o-assembly2.cif.gz_B the complex between the eight-bladed symmetrical designer protein tako8 and the silicotungstic acid keggin (sta) 0.8136 52 432
6g6n-assembly3.cif.gz_C crystal structure of the computationally designed tako8 protein in c2 0.8065 53 431
ID Description Score Start End Superfamily
af_Q5RG49_936_1023_2.40.128.630 Mainly Beta;Beta Barrel;Lipocalin; 0.8608 335 416 2.40.128.630
af_F1M5N7_1487_1623_2.40.128.630 Mainly Beta;Beta Barrel;Lipocalin; 0.8454 329 432 2.40.128.630
af_Q55E07_784_923_2.40.128.630 Mainly Beta;Beta Barrel;Lipocalin; 0.8376 246 391 2.40.128.630
af_Q60282_716_812_2.40.128.630 Mainly Beta;Beta Barrel;Lipocalin; 0.8357 283 393 2.40.128.630
2ymsD00 Mainly Beta;Beta Barrel;Thrombin, subunit H; 0.8317 278 359 2.40.10.480
ID Description Score Start End GO Terms
AF-A0A7W0ZLC8-F1-model_v4 PQQ-like beta-propeller repeat protein 0.9746 301 432
AF-A0A4V0XNS4-F1-model_v4 Pyrrolo-quinoline quinone 0.9742 317 431
AF-A0A6N7MC15-F1-model_v4 Pyrrolo-quinoline quinone 0.9739 328 432
AF-A0A2A4M016-F1-model_v4 VCBS repeat-containing protein 0.9715 212 432
AF-A0A356FF92-F1-model_v4 Serine/threonine protein kinase 0.9693 281 432

Feature Viewer

pLDDT pTM Quality
88.72 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map