F285336

General Info

Members Datasets Scaffolds Average Seq Length
186 130 372 86

Family's Representative Sequence

Representative Sequence 3300005262|Ga0065165_1000264|Ga0065165_10002643
Length 96
Sequence LRTAAGTSFYERCVRGLLRAYKLTLSPLIGRQCRFAPTCSEYAAEALIGHGPVRGTVLTVRRLCRCHPWGGAGWDPHKAESPDGQAAARDWKCEEP

Samples

Sample ID Description Type Environment
1 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
24 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
25 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
26 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
27 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
28 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
29 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
30 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
31 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
32 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
33 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
36 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
37 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
38 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
39 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
40 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
41 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
63 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
64 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
68 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
69 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
70 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
71 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
72 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
73 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
74 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
75 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
76 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
77 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
78 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
79 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
80 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
81 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
82 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
83 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
84 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
85 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
86 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
87 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
88 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
89 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
90 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
91 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
92 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
93 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
94 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
95 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
96 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
97 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
98 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
99 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
100 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
101 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
102 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
103 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
104 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
105 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
106 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
107 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
108 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
109 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
110 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
114 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
115 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
116 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
117 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
118 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
119 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
120 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
121 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
122 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
123 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
124 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
125 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
126 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
127 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
128 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
129 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
130 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.46
Metatranscriptomes 0
Isolates 0.54

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.67
Nodule 0
Rhizoplane 3.23
Rhizosphere 78.49
Stem 0
Stem Tuber 0
Unclassified 1.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065165_1000264 3300005262 Bacteria 90435
2 Ga0065165_1012656 3300005262 Bacteria 3418
3 Ga0065165_1108752 3300005262 Bacteria 685
4 Ga0070658_10201279 3300005327 Bacteria 1680
5 Ga0070670_100215826 3300005331 Bacteria 1669
6 Ga0068869_100728388 3300005334 Bacteria 848
7 Ga0070680_100025124 3300005336 Bacteria 4760
8 Ga0070660_100071861 3300005339 Bacteria 2702
9 Ga0070660_100423575 3300005339 Bacteria 1102
10 Ga0070661_100528644 3300005344 Bacteria 947
11 Ga0070661_101554813 3300005344 Bacteria 559
12 Ga0070668_100000707 3300005347 Bacteria 22821
13 Ga0070669_100228428 3300005353 Bacteria 1474
14 Ga0070659_100000428 3300005366 Bacteria 31806
15 Ga0070659_100001955 3300005366 Bacteria 14725
16 Ga0070667_100003824 3300005367 Bacteria 12796
17 Ga0070667_100334814 3300005367 Bacteria 1368
18 Ga0070667_100460447 3300005367 Bacteria 1163
19 Ga0070662_101862953 3300005457 Bacteria 520
20 Ga0070681_10089932 3300005458 Bacteria 3021
21 Ga0068867_101515652 3300005459 Bacteria 625
22 Ga0070679_100000858 3300005530 Bacteria 26439
23 Ga0070684_102111206 3300005535 Unclassified 532
24 Ga0068853_100003157 3300005539 Bacteria 12598
25 Ga0068853_100466142 3300005539 Bacteria 1189
26 Ga0068853_101490847 3300005539 Bacteria 655
27 Ga0070665_100000593 3300005548 Bacteria 50386
28 Ga0070665_100000674 3300005548 Bacteria 45861
29 Ga0068855_100009421 3300005563 Bacteria 11794
30 Ga0068855_100980847 3300005563 Bacteria 889
31 Ga0068857_100218634 3300005577 Bacteria 1740
32 Ga0068854_100121458 3300005578 Bacteria 1984
33 Ga0068852_100617218 3300005616 Bacteria 1090
34 Ga0068852_101043794 3300005616 Bacteria 837
35 Ga0068852_101254275 3300005616 Bacteria 763
36 Ga0068863_102624300 3300005841 Bacteria 513
37 Ga0068860_102062380 3300005843 Bacteria 592
38 Ga0068862_100086387 3300005844 Bacteria 2727
39 Ga0068862_100722257 3300005844 Bacteria 967
40 Ga0068862_101512920 3300005844 Bacteria 677
41 Ga0075368_10001453 3300006042 Bacteria 7577
42 Ga0075363_100007989 3300006048 Bacteria 4903
43 Ga0075364_10000647 3300006051 Bacteria 17958
44 Ga0075362_10091845 3300006177 Bacteria 1410
45 Ga0075367_10006331 3300006178 Bacteria 5970
46 Ga0075369_10047891 3300006186 Bacteria 1844
47 Ga0075366_10060765 3300006195 Bacteria 2245
48 Ga0075366_10206875 3300006195 Bacteria 1194
49 Ga0075370_10109414 3300006353 Bacteria 1604
50 Ga0075370_10119839 3300006353 Bacteria 1531
51 Ga0105240_10054863 3300009093 Bacteria 4992
52 Ga0105240_10226346 3300009093 Bacteria 2176
53 Ga0105240_10858758 3300009093 Bacteria 979
54 Ga0105248_13404315 3300009177 Bacteria 505
55 Ga0105238_10440767 3300009551 Bacteria 1299
56 Ga0105238_10722648 3300009551 Bacteria 1009
57 Ga0105249_10065040 3300009553 Bacteria 3354
58 Ga0105239_10096362 3300010375 Bacteria 3269
59 Ga0105239_11964613 3300010375 Bacteria 679
60 Ga0105239_12064907 3300010375 Bacteria 662
61 Ga0157370_10298633 3300013104 Bacteria 1487
62 Ga0157372_11926565 3300013307 Bacteria 679
63 Ga0157372_12102206 3300013307 Unclassified 649
64 Ga0207680_10216551 3300025903 Bacteria 1311
65 Ga0207705_10000556 3300025909 Bacteria 31398
66 Ga0207705_10107492 3300025909 Bacteria 2058
67 Ga0207707_10030513 3300025912 Bacteria 4716
68 Ga0207695_10157029 3300025913 Bacteria 2209
69 Ga0207695_10636319 3300025913 Bacteria 948
70 Ga0207695_10773051 3300025913 Bacteria 841
71 Ga0207660_10006453 3300025917 Bacteria 7605
72 Ga0207657_10000693 3300025919 Bacteria 35842
73 Ga0207694_10011054 3300025924 Bacteria 6819
74 Ga0207694_10305909 3300025924 Bacteria 1310
75 Ga0207694_10438756 3300025924 Bacteria 1089
76 Ga0207694_11633654 3300025924 Bacteria 543
77 Ga0207690_10011914 3300025932 Bacteria 5200
78 Ga0207706_10712535 3300025933 Unclassified 857
79 Ga0207686_10119280 3300025934 Bacteria 1793
80 Ga0207711_10045691 3300025941 Bacteria 3743
81 Ga0207667_10045252 3300025949 Bacteria 4662
82 Ga0207667_10191768 3300025949 Bacteria 2097
83 Ga0207667_10352433 3300025949 Bacteria 1501
84 Ga0207667_11547884 3300025949 Bacteria 633
85 Ga0207712_10081650 3300025961 Bacteria 2354
86 Ga0207668_10000002 3300025972 Bacteria 209163
87 Ga0207668_10045587 3300025972 Bacteria 2991
88 Ga0207640_10094665 3300025981 Bacteria 2078
89 Ga0207658_10003349 3300025986 Bacteria 11367
90 Ga0207658_11008900 3300025986 Bacteria 759
91 Ga0207639_10012961 3300026041 Bacteria 5818
92 Ga0207639_12226802 3300026041 Bacteria 509
93 Ga0207678_10630941 3300026067 Bacteria 941
94 Ga0207674_10197878 3300026116 Bacteria 1959
95 Ga0207683_11931162 3300026121 Bacteria 539
96 Ga0207698_10685517 3300026142 Bacteria 1018
97 Ga0209981_1001207 3300027378 Bacteria 3274
98 Ga0209813_10382256 3300027866 Bacteria 564
99 Ga0268266_10000003 3300028379 Bacteria 1701703
100 Ga0268266_10012561 3300028379 Bacteria 7318
101 Ga0268265_10008007 3300028380 Bacteria 7136
102 Ga0268265_12664951 3300028380 Bacteria 505
103 Ga0268264_11277619 3300028381 Bacteria 744
104 Ga0268264_11986836 3300028381 Bacteria 591
105 Ga0265338_10391676 3300028800 Bacteria 992
106 Ga0265327_10106475 3300031251 Bacteria 1345
107 Ga0307513_10000077 3300031456 Bacteria 134167
108 Ga0307406_10241455 3300031901 Bacteria 1355
109 Ga0307409_101127351 3300031995 Bacteria 806
110 Ga0307510_10149582 3300033180 Bacteria 1958
111 Ga0373944_0202872 3300035089 Bacteria 718
112 Ga0373943_0071783 3300035170 Bacteria 1755
113 Ga0373931_0703563 3300035691 Bacteria 667
114 Ga0373927_0003482 3300035695 Bacteria 11271
115 Ga0373927_0873506 3300035695 Bacteria 594
116 Ga0373933_0499194 3300035724 Bacteria 797
117 Ga0373925_0000049 3300037068 Bacteria 128065
118 Ga0373925_0086796 3300037068 Bacteria 2388
119 Ga0395900_0000072 3300037418 Bacteria 187428
120 Ga0395900_0016154 3300037418 Bacteria 7604
121 Ga0395898_0008282 3300037466 Bacteria 10996
122 Ga0395905_0001727 3300037471 Bacteria 25583
123 Ga0395905_0010766 3300037471 Bacteria 8865
124 Ga0395905_0098120 3300037471 Bacteria 2751
125 Ga0395905_0208893 3300037471 Bacteria 1829
126 Ga0395905_0984887 3300037471 Bacteria 746
127 Ga0395901_0001358 3300038443 Bacteria 25609
128 Ga0395901_0211405 3300038443 Bacteria 2030
129 Ga0436360_0475644 3300039438 Bacteria 751
130 Ga0436361_0002704 3300039447 Bacteria 2642
131 Ga0436361_1180455 3300039447 Bacteria 1247
132 Ga0436361_1213796 3300039447 Bacteria 675
133 Ga0451787_022868 3300041441 Bacteria 627
134 Ga0451800_1565800 3300041459 Bacteria 535
135 Ga0439445_0142320 3300042004 Bacteria 696
136 Ga0439446_0053569 3300042156 Bacteria 1209
137 Ga0466969_0168286 3300044656 Bacteria 1005
138 Ga0466972_0278668 3300044658 Bacteria 781
139 Ga0466965_0085303 3300044683 Bacteria 1601
140 Ga0466965_0753566 3300044683 Bacteria 561
141 Ga0466968_0134033 3300044735 Bacteria 1129
142 Ga0466968_0533495 3300044735 Bacteria 587
143 Ga0466970_0105398 3300044765 Bacteria 1538
144 Ga0466957_0896973 3300044842 Bacteria 633
145 Ga0466959_0054881 3300045049 Bacteria 2910
146 Ga0495594_0058290 3300046499 Bacteria 2133
147 Ga0495606_0225980 3300046507 Bacteria 1052
148 Ga0495609_0018974 3300046538 Bacteria 3185
149 Ga0495668_0021748 3300046616 Bacteria 3672
150 Ga0495668_0044539 3300046616 Bacteria 2466
151 Ga0495625_0028524 3300046660 Bacteria 4186
152 Ga0495599_0201575 3300046678 Bacteria 1222
153 Ga0495669_0000353 3300046684 Bacteria 23496
154 Ga0495669_0012143 3300046684 Bacteria 3663
155 Ga0495624_0601554 3300046690 Bacteria 655
156 Ga0495581_0117286 3300047315 Bacteria 1548
157 Ga0495687_020444 3300047443 Bacteria 3225
158 Ga0496100_0605750 3300048903 Bacteria 851
159 Ga0496101_0711652 3300048904 Bacteria 793
160 Ga0496115_0006772 3300048918 Bacteria 8406
161 Ga0496115_0444719 3300048918 Bacteria 1048
162 Ga0496121_0490185 3300048924 Bacteria 783
163 Ga0501032_0038538 3300049569 Bacteria 3255
164 Ga0501047_0093244 3300049581 Bacteria 2890
165 Ga0501048_0695201 3300049582 Bacteria 730
166 Ga0501071_1578129 3300049587 Bacteria 507
167 Ga0501044_1206489 3300049823 Bacteria 624
168 nmdc:mga03683_494736_c1 3300050489 Bacteria 592
169 nmdc:mga03683_59660_c1 3300050489 Bacteria 1610
170 nmdc:mga03n38_4725_c1 3300050490 Bacteria 4550
171 nmdc:mga00v17_491_c1 3300050491 Bacteria 22189
172 nmdc:mga0k408_134967_c1 3300050493 Bacteria 1466
173 nmdc:mga0k408_6594_c1 3300050493 Bacteria 1893
174 nmdc:mga06z11_7184_c1 3300050494 Bacteria 4572
175 nmdc:mga04h51_101566_c1 3300050495 Bacteria 1049
176 nmdc:mga0sz30_147194_c1 3300050516 Bacteria 1041
177 Ga0500643_005318 3300053087 Bacteria 5570
178 Ga0500583_0008035 3300053092 Bacteria 3757
179 Ga0500562_000609 3300053108 Bacteria 8629
180 Ga0500562_001940 3300053108 Bacteria 5184
181 Ga0500608_001063 3300053122 Bacteria 9839
182 Ga0500559_0043994 3300053136 Bacteria 1952
183 Ga0500619_000501 3300053154 Bacteria 6809
184 Ga0500637_0035094 3300053178 Bacteria 2809
185 Ga0501082_1618076 3300060353 Bacteria 565
186 2898331043 2898329390 Bacteria 5168154
187 Ga0065165_1000264
188 Ga0065165_1012656
189 Ga0065165_1108752
190 Ga0070658_10201279
191 Ga0070670_100215826
192 Ga0068869_100728388
193 Ga0070680_100025124
194 Ga0070660_100071861
195 Ga0070660_100423575
196 Ga0070661_100528644
197 Ga0070661_101554813
198 Ga0070668_100000707
199 Ga0070669_100228428
200 Ga0070659_100000428
201 Ga0070659_100001955
202 Ga0070667_100003824
203 Ga0070667_100334814
204 Ga0070667_100460447
205 Ga0070662_101862953
206 Ga0070681_10089932
207 Ga0068867_101515652
208 Ga0070679_100000858
209 Ga0070684_102111206
210 Ga0068853_100003157
211 Ga0068853_100466142
212 Ga0068853_101490847
213 Ga0070665_100000593
214 Ga0070665_100000674
215 Ga0068855_100009421
216 Ga0068855_100980847
217 Ga0068857_100218634
218 Ga0068854_100121458
219 Ga0068852_100617218
220 Ga0068852_101043794
221 Ga0068852_101254275
222 Ga0068863_102624300
223 Ga0068860_102062380
224 Ga0068862_100086387
225 Ga0068862_100722257
226 Ga0068862_101512920
227 Ga0075368_10001453
228 Ga0075363_100007989
229 Ga0075364_10000647
230 Ga0075362_10091845
231 Ga0075367_10006331
232 Ga0075369_10047891
233 Ga0075366_10060765
234 Ga0075366_10206875
235 Ga0075370_10109414
236 Ga0075370_10119839
237 Ga0105240_10054863
238 Ga0105240_10226346
239 Ga0105240_10858758
240 Ga0105248_13404315
241 Ga0105238_10440767
242 Ga0105238_10722648
243 Ga0105249_10065040
244 Ga0105239_10096362
245 Ga0105239_11964613
246 Ga0105239_12064907
247 Ga0157370_10298633
248 Ga0157372_11926565
249 Ga0157372_12102206
250 Ga0207680_10216551
251 Ga0207705_10000556
252 Ga0207705_10107492
253 Ga0207707_10030513
254 Ga0207695_10157029
255 Ga0207695_10636319
256 Ga0207695_10773051
257 Ga0207660_10006453
258 Ga0207657_10000693
259 Ga0207694_10011054
260 Ga0207694_10305909
261 Ga0207694_10438756
262 Ga0207694_11633654
263 Ga0207690_10011914
264 Ga0207706_10712535
265 Ga0207686_10119280
266 Ga0207711_10045691
267 Ga0207667_10045252
268 Ga0207667_10191768
269 Ga0207667_10352433
270 Ga0207667_11547884
271 Ga0207712_10081650
272 Ga0207668_10000002
273 Ga0207668_10045587
274 Ga0207640_10094665
275 Ga0207658_10003349
276 Ga0207658_11008900
277 Ga0207639_10012961
278 Ga0207639_12226802
279 Ga0207678_10630941
280 Ga0207674_10197878
281 Ga0207683_11931162
282 Ga0207698_10685517
283 Ga0209981_1001207
284 Ga0209813_10382256
285 Ga0268266_10000003
286 Ga0268266_10012561
287 Ga0268265_10008007
288 Ga0268265_12664951
289 Ga0268264_11277619
290 Ga0268264_11986836
291 Ga0265338_10391676
292 Ga0265327_10106475
293 Ga0307513_10000077
294 Ga0307406_10241455
295 Ga0307409_101127351
296 Ga0307510_10149582
297 Ga0373944_0202872
298 Ga0373943_0071783
299 Ga0373931_0703563
300 Ga0373927_0003482
301 Ga0373927_0873506
302 Ga0373933_0499194
303 Ga0373925_0000049
304 Ga0373925_0086796
305 Ga0395900_0000072
306 Ga0395900_0016154
307 Ga0395898_0008282
308 Ga0395905_0001727
309 Ga0395905_0010766
310 Ga0395905_0098120
311 Ga0395905_0208893
312 Ga0395905_0984887
313 Ga0395901_0001358
314 Ga0395901_0211405
315 Ga0436360_0475644
316 Ga0436361_0002704
317 Ga0436361_1180455
318 Ga0436361_1213796
319 Ga0451787_022868
320 Ga0451800_1565800
321 Ga0439445_0142320
322 Ga0439446_0053569
323 Ga0466969_0168286
324 Ga0466972_0278668
325 Ga0466965_0085303
326 Ga0466965_0753566
327 Ga0466968_0134033
328 Ga0466968_0533495
329 Ga0466970_0105398
330 Ga0466957_0896973
331 Ga0466959_0054881
332 Ga0495594_0058290
333 Ga0495606_0225980
334 Ga0495609_0018974
335 Ga0495668_0021748
336 Ga0495668_0044539
337 Ga0495625_0028524
338 Ga0495599_0201575
339 Ga0495669_0000353
340 Ga0495669_0012143
341 Ga0495624_0601554
342 Ga0495581_0117286
343 Ga0495687_020444
344 Ga0496100_0605750
345 Ga0496101_0711652
346 Ga0496115_0006772
347 Ga0496115_0444719
348 Ga0496121_0490185
349 Ga0501032_0038538
350 Ga0501047_0093244
351 Ga0501048_0695201
352 Ga0501071_1578129
353 Ga0501044_1206489
354 nmdc:mga03683_494736_c1
355 nmdc:mga03683_59660_c1
356 nmdc:mga03n38_4725_c1
357 nmdc:mga00v17_491_c1
358 nmdc:mga0k408_134967_c1
359 nmdc:mga0k408_6594_c1
360 nmdc:mga06z11_7184_c1
361 nmdc:mga04h51_101566_c1
362 nmdc:mga0sz30_147194_c1
363 Ga0500643_005318
364 Ga0500583_0008035
365 Ga0500562_000609
366 Ga0500562_001940
367 Ga0500608_001063
368 Ga0500559_0043994
369 Ga0500619_000501
370 Ga0500637_0035094
371 Ga0501082_1618076
372 2898331043

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01809

YidD

Putative membrane protein insertion efficiency factor

11

77

0.96

Map