F285606

General Info

Members Datasets Scaffolds Average Seq Length
186 98 372 198

Family's Representative Sequence

Representative Sequence 3300005458|Ga0070681_10039677|Ga0070681_100396772
Length 217
Sequence MGYDDLIHEEGEHEVREPAIAYGKSRFTIEEYLEMERASNEKHEYYQGEIFTMSGASPGHIIIFRNLYGDLAYRSKRKPCRPYGNDMRIYIPENTLFTYPDISIFCNEIHYYDKEKDSAIGPTGLIEILSPSTRRYDRGRKFDLYQQIPSLKEYILVDSQTVHVQLFHPCGDGHWGLREYKQLDDKIEVDVIGIDLLLADIYDGTTASEQKCTPSAR

Samples

Sample ID Description Type Environment
1 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
46 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
49 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
55 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
56 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
57 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
86 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
87 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
88 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
89 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
90 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
91 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
92 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
93 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
94 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
96 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
97 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
98 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.54
Nodule 0
Rhizoplane 0
Rhizosphere 94.62
Stem 0
Stem Tuber 0
Unclassified 9.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070681_10039677 3300005458 Bacteria 4719
2 JGI25406J46586_10001359 3300003203 Bacteria 11519
3 rootH2_10119818 3300003320 Unclassified 2374
4 rootL2_10007346 3300003322 Bacteria 2628
5 rootL2_10267534 3300003322 Bacteria 2348
6 rootH1_10019738 3300003323 Bacteria 9141
7 Ga0070658_10071745 3300005327 Bacteria 2837
8 Ga0070658_10203307 3300005327 Bacteria 1672
9 Ga0070683_100000292 3300005329 Bacteria 34475
10 Ga0070683_100025863 3300005329 Bacteria 5278
11 Ga0070683_100179834 3300005329 Bacteria 2007
12 Ga0070683_100446796 3300005329 Bacteria 1234
13 Ga0070690_100041771 3300005330 Bacteria 2904
14 Ga0070690_100481555 3300005330 Bacteria 925
15 Ga0070690_100756566 3300005330 Bacteria 750
16 Ga0068869_100497453 3300005334 Bacteria 1017
17 Ga0070682_100054371 3300005337 Unclassified 2512
18 Ga0070682_100179832 3300005337 Bacteria 1476
19 Ga0070682_100204795 3300005337 Bacteria 1394
20 Ga0070682_100424408 3300005337 Bacteria 1011
21 Ga0068868_100075824 3300005338 Unclassified 2688
22 Ga0068868_100338340 3300005338 Bacteria 1286
23 Ga0070660_100000807 3300005339 Bacteria 20768
24 Ga0070660_100004961 3300005339 Bacteria 9202
25 Ga0070660_100220724 3300005339 Bacteria 1541
26 Ga0070660_100373688 3300005339 Unclassified 1176
27 Ga0070661_100000350 3300005344 Bacteria 36459
28 Ga0070661_100090558 3300005344 Bacteria 2265
29 Ga0070661_100461522 3300005344 Bacteria 1012
30 Ga0070675_100454472 3300005354 Bacteria 1149
31 Ga0070671_100041470 3300005355 Bacteria 3826
32 Ga0070671_100494258 3300005355 Bacteria 1052
33 Ga0070673_100199876 3300005364 Bacteria 1721
34 Ga0070673_100671943 3300005364 Unclassified 949
35 Ga0070659_100025044 3300005366 Bacteria 4580
36 Ga0070659_100062476 3300005366 Bacteria 2944
37 Ga0070659_100243704 3300005366 Bacteria 1488
38 Ga0070667_100069834 3300005367 Bacteria 2990
39 Ga0070663_100487687 3300005455 Bacteria 1021
40 Ga0070678_100448794 3300005456 Bacteria 1129
41 Ga0070678_100610585 3300005456 Bacteria 975
42 Ga0070662_100008860 3300005457 Bacteria 6558
43 Ga0070662_100080388 3300005457 Unclassified 2426
44 Ga0070681_10082588 3300005458 Bacteria 3168
45 Ga0070681_10197106 3300005458 Bacteria 1932
46 Ga0068867_100487339 3300005459 Bacteria 1057
47 Ga0068867_100508443 3300005459 Bacteria 1037
48 Ga0068867_100959709 3300005459 Bacteria 773
49 Ga0070679_100042363 3300005530 Bacteria 4533
50 Ga0070679_100147143 3300005530 Bacteria 2333
51 Ga0070679_100421237 3300005530 Bacteria 1280
52 Ga0070684_100000508 3300005535 Bacteria 26690
53 Ga0070684_100160682 3300005535 Bacteria 2038
54 Ga0070684_100438076 3300005535 Bacteria 1207
55 Ga0068853_100002640 3300005539 Bacteria 13503
56 Ga0068853_100011559 3300005539 Bacteria 7177
57 Ga0068853_100022426 3300005539 Bacteria 5273
58 Ga0068853_100239024 3300005539 Bacteria 1664
59 Ga0070693_100545067 3300005547 Unclassified 829
60 Ga0068855_100025559 3300005563 Bacteria 7063
61 Ga0068855_100036334 3300005563 Bacteria 5864
62 Ga0070664_100017117 3300005564 Bacteria 5950
63 Ga0070664_100026856 3300005564 Bacteria 4781
64 Ga0070664_100088462 3300005564 Bacteria 2678
65 Ga0068857_100002838 3300005577 Bacteria 14243
66 Ga0068857_100067209 3300005577 Bacteria 3190
67 Ga0068854_100018560 3300005578 Bacteria 4673
68 Ga0068854_100090195 3300005578 Bacteria 2279
69 Ga0068854_100184915 3300005578 Bacteria 1629
70 Ga0068856_100004037 3300005614 Bacteria 14698
71 Ga0068856_100064185 3300005614 Bacteria 3628
72 Ga0068856_100222358 3300005614 Bacteria 1903
73 Ga0068852_100274466 3300005616 Bacteria 1623
74 Ga0068852_100979075 3300005616 Bacteria 864
75 Ga0068859_100072657 3300005617 Bacteria 3477
76 Ga0068863_100431742 3300005841 Unclassified 1291
77 Ga0068860_100007308 3300005843 Bacteria 11044
78 Ga0068862_100236104 3300005844 Bacteria 1660
79 Ga0081539_10000037 3300005985 Bacteria 296160
80 Ga0081539_10145667 3300005985 Bacteria 1145
81 Ga0097621_100249171 3300006237 Bacteria 1555
82 Ga0068871_100060258 3300006358 Bacteria 3096
83 Ga0068871_100238767 3300006358 Bacteria 1579
84 Ga0068871_100459367 3300006358 Bacteria 1143
85 Ga0097620_100072663 3300006931 Bacteria 3477
86 Ga0114129_10001007 3300009147 Bacteria 36711
87 Ga0105241_10003646 3300009174 Bacteria 11434
88 Ga0105237_10016737 3300009545 Bacteria 7613
89 Ga0105239_10016717 3300010375 Bacteria 8109
90 Ga0157373_10012922 3300013100 Bacteria 6130
91 Ga0157373_10065030 3300013100 Bacteria 2581
92 Ga0157373_10117771 3300013100 Bacteria 1867
93 Ga0157373_10194504 3300013100 Bacteria 1429
94 Ga0157371_10014336 3300013102 Bacteria 5985
95 Ga0157371_10169630 3300013102 Bacteria 1559
96 Ga0157371_10350722 3300013102 Unclassified 1074
97 Ga0157369_10004228 3300013105 Bacteria 17006
98 Ga0157369_10073754 3300013105 Bacteria 3661
99 Ga0157374_10012102 3300013296 Bacteria 7493
100 Ga0157374_10080697 3300013296 Bacteria 3086
101 Ga0157374_10400903 3300013296 Bacteria 1368
102 Ga0157378_10018212 3300013297 Bacteria 6166
103 Ga0157378_10092320 3300013297 Unclassified 2754
104 Ga0163162_10451060 3300013306 Unclassified 1418
105 Ga0163162_10463495 3300013306 Bacteria 1399
106 Ga0163162_10961019 3300013306 Bacteria 965
107 Ga0163162_11391276 3300013306 Bacteria 798
108 Ga0157372_10007572 3300013307 Bacteria 11546
109 Ga0157372_10047218 3300013307 Bacteria 4784
110 Ga0157372_10170041 3300013307 Bacteria 2521
111 Ga0157372_10345998 3300013307 Bacteria 1732
112 Ga0157372_10550944 3300013307 Bacteria 1344
113 Ga0157375_11452904 3300013308 Unclassified 808
114 Ga0163163_10168586 3300014325 Bacteria 2236
115 Ga0157377_10264282 3300014745 Bacteria 1121
116 Ga0163161_10252679 3300017792 Unclassified 1374
117 Ga0213876_10001693 3300021384 Bacteria 13411
118 Ga0213876_10010894 3300021384 Bacteria 4869
119 Ga0207705_10142036 3300025909 Bacteria 1794
120 Ga0207705_10352256 3300025909 Unclassified 1134
121 Ga0207654_10005565 3300025911 Bacteria 6372
122 Ga0207707_10134524 3300025912 Bacteria 2162
123 Ga0207707_10317984 3300025912 Bacteria 1344
124 Ga0207657_10002612 3300025919 Bacteria 19465
125 Ga0207657_10009492 3300025919 Bacteria 9774
126 Ga0207657_10320394 3300025919 Bacteria 1226
127 Ga0207657_10387794 3300025919 Bacteria 1099
128 Ga0207649_10012992 3300025920 Bacteria 4640
129 Ga0207649_10139743 3300025920 Bacteria 1656
130 Ga0207652_10307635 3300025921 Bacteria 1430
131 Ga0207650_10252570 3300025925 Bacteria 1428
132 Ga0207650_10657787 3300025925 Bacteria 883
133 Ga0207644_10491935 3300025931 Bacteria 1011
134 Ga0207644_10984108 3300025931 Unclassified 708
135 Ga0207690_10138460 3300025932 Bacteria 1790
136 Ga0207690_10582253 3300025932 Bacteria 912
137 Ga0207706_10013718 3300025933 Bacteria 7353
138 Ga0207706_10041794 3300025933 Bacteria 4063
139 Ga0207689_10109826 3300025942 Bacteria 2266
140 Ga0207661_10019370 3300025944 Bacteria 5072
141 Ga0207661_10151062 3300025944 Bacteria 2008
142 Ga0207661_10517133 3300025944 Bacteria 1091
143 Ga0207679_10007958 3300025945 Bacteria 6739
144 Ga0207679_10125755 3300025945 Bacteria 2048
145 Ga0207679_10821135 3300025945 Bacteria 848
146 Ga0207651_10303243 3300025960 Bacteria 1329
147 Ga0207640_10153118 3300025981 Unclassified 1696
148 Ga0207658_10122046 3300025986 Bacteria 2079
149 Ga0207658_10400242 3300025986 Bacteria 1207
150 Ga0207677_10153455 3300026023 Bacteria 1780
151 Ga0207703_11483957 3300026035 Bacteria 652
152 Ga0207639_10017196 3300026041 Bacteria 5126
153 Ga0207639_10057975 3300026041 Bacteria 2976
154 Ga0207639_10114271 3300026041 Bacteria 2206
155 Ga0207639_10552362 3300026041 Bacteria 1057
156 Ga0207702_10299658 3300026078 Unclassified 1525
157 Ga0207641_10644780 3300026088 Bacteria 1040
158 Ga0207648_10076528 3300026089 Bacteria 2917
159 Ga0207676_10353669 3300026095 Bacteria 1359
160 Ga0207674_10004795 3300026116 Bacteria 16200
161 Ga0207674_10200793 3300026116 Bacteria 1943
162 Ga0207674_10800850 3300026116 Bacteria 909
163 Ga0207674_10849945 3300026116 Bacteria 880
164 Ga0207683_10110892 3300026121 Bacteria 2456
165 Ga0207698_10064140 3300026142 Bacteria 2878
166 Ga0207698_11509116 3300026142 Bacteria 687
167 Ga0268265_10640522 3300028380 Bacteria 1020
168 Ga0268264_10072201 3300028381 Bacteria 2926
169 Ga0265327_10000254 3300031251 Bacteria 106076
170 Ga0307508_10003548 3300031616 Bacteria 15725
171 Ga0265314_10126240 3300031711 Bacteria 1602
172 Ga0373935_0236923 3300035692 Bacteria 1273
173 Ga0395901_0847204 3300038443 Bacteria 900
174 Ga0436365_1143821 3300039437 Bacteria 24571
175 Ga0436365_1525650 3300039437 Bacteria 10436
176 Ga0439455_0077117 3300042012 Bacteria 902
177 Ga0451576_0583086 3300045051 Bacteria 1175
178 Ga0466967_0009108 3300045976 Bacteria 7342
179 Ga0466967_0325246 3300045976 Bacteria 1484
180 Ga0501034_0047245 3300049571 Bacteria 4348
181 Ga0501034_0053432 3300049571 Bacteria 4067
182 Ga0501034_0787602 3300049571 Bacteria 844
183 Ga0501043_0325777 3300049579 Bacteria 1171
184 Ga0501035_0058715 3300049822 Bacteria 3427
185 nmdc:mga05p37_829_c1 3300050507 Bacteria 34660
186 Ga0500646_0005681 3300053090 Unclassified 3158
187 Ga0070681_10039677
188 JGI25406J46586_10001359
189 rootH2_10119818
190 rootL2_10007346
191 rootL2_10267534
192 rootH1_10019738
193 Ga0070658_10071745
194 Ga0070658_10203307
195 Ga0070683_100000292
196 Ga0070683_100025863
197 Ga0070683_100179834
198 Ga0070683_100446796
199 Ga0070690_100041771
200 Ga0070690_100481555
201 Ga0070690_100756566
202 Ga0068869_100497453
203 Ga0070682_100054371
204 Ga0070682_100179832
205 Ga0070682_100204795
206 Ga0070682_100424408
207 Ga0068868_100075824
208 Ga0068868_100338340
209 Ga0070660_100000807
210 Ga0070660_100004961
211 Ga0070660_100220724
212 Ga0070660_100373688
213 Ga0070661_100000350
214 Ga0070661_100090558
215 Ga0070661_100461522
216 Ga0070675_100454472
217 Ga0070671_100041470
218 Ga0070671_100494258
219 Ga0070673_100199876
220 Ga0070673_100671943
221 Ga0070659_100025044
222 Ga0070659_100062476
223 Ga0070659_100243704
224 Ga0070667_100069834
225 Ga0070663_100487687
226 Ga0070678_100448794
227 Ga0070678_100610585
228 Ga0070662_100008860
229 Ga0070662_100080388
230 Ga0070681_10082588
231 Ga0070681_10197106
232 Ga0068867_100487339
233 Ga0068867_100508443
234 Ga0068867_100959709
235 Ga0070679_100042363
236 Ga0070679_100147143
237 Ga0070679_100421237
238 Ga0070684_100000508
239 Ga0070684_100160682
240 Ga0070684_100438076
241 Ga0068853_100002640
242 Ga0068853_100011559
243 Ga0068853_100022426
244 Ga0068853_100239024
245 Ga0070693_100545067
246 Ga0068855_100025559
247 Ga0068855_100036334
248 Ga0070664_100017117
249 Ga0070664_100026856
250 Ga0070664_100088462
251 Ga0068857_100002838
252 Ga0068857_100067209
253 Ga0068854_100018560
254 Ga0068854_100090195
255 Ga0068854_100184915
256 Ga0068856_100004037
257 Ga0068856_100064185
258 Ga0068856_100222358
259 Ga0068852_100274466
260 Ga0068852_100979075
261 Ga0068859_100072657
262 Ga0068863_100431742
263 Ga0068860_100007308
264 Ga0068862_100236104
265 Ga0081539_10000037
266 Ga0081539_10145667
267 Ga0097621_100249171
268 Ga0068871_100060258
269 Ga0068871_100238767
270 Ga0068871_100459367
271 Ga0097620_100072663
272 Ga0114129_10001007
273 Ga0105241_10003646
274 Ga0105237_10016737
275 Ga0105239_10016717
276 Ga0157373_10012922
277 Ga0157373_10065030
278 Ga0157373_10117771
279 Ga0157373_10194504
280 Ga0157371_10014336
281 Ga0157371_10169630
282 Ga0157371_10350722
283 Ga0157369_10004228
284 Ga0157369_10073754
285 Ga0157374_10012102
286 Ga0157374_10080697
287 Ga0157374_10400903
288 Ga0157378_10018212
289 Ga0157378_10092320
290 Ga0163162_10451060
291 Ga0163162_10463495
292 Ga0163162_10961019
293 Ga0163162_11391276
294 Ga0157372_10007572
295 Ga0157372_10047218
296 Ga0157372_10170041
297 Ga0157372_10345998
298 Ga0157372_10550944
299 Ga0157375_11452904
300 Ga0163163_10168586
301 Ga0157377_10264282
302 Ga0163161_10252679
303 Ga0213876_10001693
304 Ga0213876_10010894
305 Ga0207705_10142036
306 Ga0207705_10352256
307 Ga0207654_10005565
308 Ga0207707_10134524
309 Ga0207707_10317984
310 Ga0207657_10002612
311 Ga0207657_10009492
312 Ga0207657_10320394
313 Ga0207657_10387794
314 Ga0207649_10012992
315 Ga0207649_10139743
316 Ga0207652_10307635
317 Ga0207650_10252570
318 Ga0207650_10657787
319 Ga0207644_10491935
320 Ga0207644_10984108
321 Ga0207690_10138460
322 Ga0207690_10582253
323 Ga0207706_10013718
324 Ga0207706_10041794
325 Ga0207689_10109826
326 Ga0207661_10019370
327 Ga0207661_10151062
328 Ga0207661_10517133
329 Ga0207679_10007958
330 Ga0207679_10125755
331 Ga0207679_10821135
332 Ga0207651_10303243
333 Ga0207640_10153118
334 Ga0207658_10122046
335 Ga0207658_10400242
336 Ga0207677_10153455
337 Ga0207703_11483957
338 Ga0207639_10017196
339 Ga0207639_10057975
340 Ga0207639_10114271
341 Ga0207639_10552362
342 Ga0207702_10299658
343 Ga0207641_10644780
344 Ga0207648_10076528
345 Ga0207676_10353669
346 Ga0207674_10004795
347 Ga0207674_10200793
348 Ga0207674_10800850
349 Ga0207674_10849945
350 Ga0207683_10110892
351 Ga0207698_10064140
352 Ga0207698_11509116
353 Ga0268265_10640522
354 Ga0268264_10072201
355 Ga0265327_10000254
356 Ga0307508_10003548
357 Ga0265314_10126240
358 Ga0373935_0236923
359 Ga0395901_0847204
360 Ga0436365_1143821
361 Ga0436365_1525650
362 Ga0439455_0077117
363 Ga0451576_0583086
364 Ga0466967_0009108
365 Ga0466967_0325246
366 Ga0501034_0047245
367 Ga0501034_0053432
368 Ga0501034_0787602
369 Ga0501043_0325777
370 Ga0501035_0058715
371 nmdc:mga05p37_829_c1
372 Ga0500646_0005681

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05685

Uma2

Putative restriction endonuclease

29

199

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
6okh-assembly1.cif.gz_B structure of an uncharacterized protein from leptospira borgpetersenii serovar hardjo-bovis (strain jb197) 0.8578 18 189
3ot2-assembly1.cif.gz_B crystal structure of a putative nuclease belonging to duf820 (ava_3926) from anabaena variabilis atcc 29413 at 1.96 a resolution 0.8335 15 190
6okh-assembly1.cif.gz_B structure of an uncharacterized protein from leptospira borgpetersenii serovar hardjo-bovis (strain jb197) 0.8172 18 189
5w8m-assembly6.cif.gz_F error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8149 150 168
3ot2-assembly1.cif.gz_B crystal structure of a putative nuclease belonging to duf820 (ava_3926) from anabaena variabilis atcc 29413 at 1.96 a resolution 0.808 15 190
ID Description Score Start End Superfamily
af_Q54MA5_7_76_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.8869 150 168 2.30.29.30
af_F1QN54_8_360_3.40.850.10 Alpha Beta;3-Layer(aba) Sandwich;Kinesin;Kinesin motor domain 0.8419 150 167 3.40.850.10
af_Q04925_77_315_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8339 150 169 2.130.10.10
af_Q57852_48_524_2.140.10.30 Mainly Beta;8 Propeller;Methanol Dehydrogenase; Chain A;Dipeptidylpeptidase IV, N-terminal domain 0.8198 151 168 2.140.10.30
3ot2B00 Alpha Beta;Alpha-Beta Complex;tt1808, chain A;tt1808, chain A 0.806 15 190 3.90.1570.10
ID Description Score Start End GO Terms
AF-A0A4U1IWD1-F1-model_v4 Uma2 family endonuclease 0.9816 15 192 GO:0004519
AF-A0A1V9EB55-F1-model_v4 Putative restriction endonuclease domain-containing protein 0.9814 23 196
AF-A0A257WYG7-F1-model_v4 Putative restriction endonuclease domain-containing protein 0.9813 15 158
AF-A0A3C0N5Q9-F1-model_v4 Putative restriction endonuclease domain-containing protein 0.9812 12 194
AF-A0A2P8FUC6-F1-model_v4 Uma2 family endonuclease 0.9806 15 194 GO:0004519

Map