F285658

General Info

Members Datasets Scaffolds Average Seq Length
186 136 372 154

Family's Representative Sequence

Representative Sequence 3300005539|Ga0068853_100655593|Ga0068853_1006555931
Length 176
Sequence LFCHVFLSLFVITAQNEFNMERLTFKDAPDVYQALKHGQNYVDNCGLDKKLIELMNFRISQINSCAYCLDMHYKEAIHAGETPLRLISVSAWRETPYYTPKEQAVLAFAEHLTHMPAEENSDTIHDGLKKHFSKEEIANLTMAVIQMNSWNRLVRSFGPTPGLYKVPETAAAAQKV

Samples

Sample ID Description Type Environment
1 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
11 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
12 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
13 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
14 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
39 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
47 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
48 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
56 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
57 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
58 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
60 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
62 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
63 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
65 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
87 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
88 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
89 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
90 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
91 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
92 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
93 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
94 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
95 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
96 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
97 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
98 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
99 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
100 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
101 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
102 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
103 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
104 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
105 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
106 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
107 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
108 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
109 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
110 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
111 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
112 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
113 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
114 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
119 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
120 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
121 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
122 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
123 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
124 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
125 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
126 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
127 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
128 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
129 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
130 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
131 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
132 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
133 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
134 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
135 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
136 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.92
Metatranscriptomes 0.54
Isolates 0.54

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.51
Nodule 0
Rhizoplane 1.61
Rhizosphere 67.2
Stem 0
Stem Tuber 0
Unclassified 20.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068853_100655593 3300005539 Bacteria 999
2 SwRhRL2b_contig_2741210 2162886007 Bacteria 17720
3 JGI24739J22299_10009367 3300001989 Bacteria 3650
4 JGI24737J22298_10148074 3300001990 Bacteria 693
5 JGI25153J46596_10017656 3300003215 Unclassified 2803
6 JGI25153J46596_10026088 3300003215 Unclassified 2076
7 rootH1_10023128 3300003316 Bacteria 1675
8 rootH2_10053307 3300003320 Bacteria 4645
9 rootH2_10168356 3300003320 Bacteria 2473
10 rootL2_10089095 3300003322 Unclassified 3066
11 rootL2_10158991 3300003322 Unclassified 1558
12 rootL2_10177110 3300003322 Bacteria 2159
13 rootH1_10023903 3300003323 Bacteria 28004
14 rootH1_10241073 3300003323 Bacteria 1272
15 JGI25160J50197_1000611 3300003354 Bacteria 20043
16 JGI25160J50197_1001437 3300003354 Bacteria 11912
17 Ga0055526_1025498 3300003771 Unclassified 1896
18 Ga0055526_1040020 3300003771 Bacteria 1186
19 Ga0055526_1057314 3300003771 Bacteria 849
20 Ga0055528_1000235 3300003790 Bacteria 46469
21 Ga0055530_10002912 3300003791 Bacteria 10367
22 Ga0055531_10036521 3300003794 Bacteria 1514
23 Ga0065165_1000019 3300005262 Bacteria 271815
24 Ga0065704_10000206 3300005289 Bacteria 121672
25 Ga0070676_10821349 3300005328 Bacteria 687
26 Ga0070683_100031719 3300005329 Bacteria 4808
27 Ga0070670_100491008 3300005331 Bacteria 1091
28 Ga0068869_100378562 3300005334 Bacteria 1159
29 Ga0068868_101101355 3300005338 Bacteria 731
30 Ga0070661_101099571 3300005344 Bacteria 662
31 Ga0070661_101462017 3300005344 Unclassified 576
32 Ga0070663_100271996 3300005455 Bacteria 1347
33 Ga0070681_10101857 3300005458 Bacteria 2817
34 Ga0068867_100017106 3300005459 Bacteria 5151
35 Ga0070679_100115499 3300005530 Bacteria 2670
36 Ga0070684_101068094 3300005535 Bacteria 758
37 Ga0068853_100080747 3300005539 Unclassified 2846
38 Ga0070672_101438540 3300005543 Unclassified 617
39 Ga0068855_100008058 3300005563 Bacteria 12732
40 Ga0068857_100124800 3300005577 Bacteria 2319
41 Ga0068857_100356467 3300005577 Bacteria 1355
42 Ga0068856_100071978 3300005614 Bacteria 3423
43 Ga0068852_100532905 3300005616 Bacteria 1173
44 Ga0068852_100704409 3300005616 Bacteria 1020
45 Ga0068864_100263566 3300005618 Bacteria 1604
46 Ga0068864_100350960 3300005618 Bacteria 1392
47 Ga0068864_101091346 3300005618 Bacteria 794
48 Ga0068866_10254589 3300005718 Unclassified 1076
49 Ga0068858_101644710 3300005842 Bacteria 634
50 Ga0068860_100029210 3300005843 Bacteria 5303
51 Ga0068862_100708739 3300005844 Bacteria 976
52 Ga0075366_10073106 3300006195 Unclassified 2044
53 Ga0075366_10391611 3300006195 Bacteria 855
54 Ga0075366_10558331 3300006195 Bacteria 709
55 Ga0068865_101671815 3300006881 Unclassified 573
56 Ga0105240_10049691 3300009093 Bacteria 5292
57 Ga0114129_10020843 3300009147 Bacteria 9312
58 Ga0105241_10136374 3300009174 Unclassified 1993
59 Ga0105242_10400795 3300009176 Bacteria 1280
60 Ga0105237_10005458 3300009545 Bacteria 14337
61 Ga0105237_10148512 3300009545 Bacteria 2339
62 Ga0105239_10003343 3300010375 Bacteria 19714
63 Ga0105239_10014519 3300010375 Bacteria 8738
64 Ga0105239_10736579 3300010375 Bacteria 1128
65 Ga0105246_10680185 3300011119 Bacteria 899
66 Ga0157373_10064170 3300013100 Bacteria 2600
67 Ga0157371_10009220 3300013102 Bacteria 7787
68 Ga0157371_10335600 3300013102 Bacteria 1099
69 Ga0157371_11105270 3300013102 Bacteria 608
70 Ga0157374_10067882 3300013296 Bacteria 3353
71 Ga0157374_10270740 3300013296 Bacteria 1675
72 Ga0157378_10075065 3300013297 Bacteria 3043
73 Ga0157378_10362361 3300013297 Bacteria 1419
74 Ga0163162_10129339 3300013306 Bacteria 2633
75 Ga0163162_10186039 3300013306 Bacteria 2204
76 Ga0157372_10029497 3300013307 Bacteria 5991
77 Ga0157372_10092475 3300013307 Bacteria 3441
78 Ga0157372_10211506 3300013307 Unclassified 2247
79 Ga0157372_10470450 3300013307 Unclassified 1465
80 Ga0157372_10620332 3300013307 Unclassified 1260
81 Ga0157372_11158159 3300013307 Bacteria 894
82 Ga0157375_10665022 3300013308 Bacteria 1197
83 Ga0163163_10630781 3300014325 Bacteria 1135
84 Ga0157379_10901448 3300014968 Bacteria 839
85 Ga0157376_10694066 3300014969 Bacteria 1022
86 Ga0182006_1003612 3300015261 Bacteria 7857
87 Ga0206354_11664068 3300020081 Bacteria 600
88 Ga0209565_1029735 3300025263 Unclassified 1072
89 Ga0209673_1000183 3300025273 Bacteria 126175
90 Ga0209564_1003598 3300025295 Bacteria 10321
91 Ga0209564_1005087 3300025295 Bacteria 7669
92 Ga0209564_1046259 3300025295 Bacteria 1111
93 Ga0209758_1001739 3300025297 Bacteria 24272
94 Ga0209758_1004276 3300025297 Bacteria 12060
95 Ga0209050_1000305 3300025298 Bacteria 100790
96 Ga0207426_1000032 3300025302 Bacteria 457997
97 Ga0207426_1000566 3300025302 Bacteria 50036
98 Ga0207426_1023680 3300025302 Bacteria 2093
99 Ga0209257_1000783 3300025304 Bacteria 46807
100 Ga0207647_10179268 3300025904 Bacteria 1231
101 Ga0207654_10166435 3300025911 Bacteria 1428
102 Ga0207707_10197196 3300025912 Bacteria 1756
103 Ga0207695_10466943 3300025913 Bacteria 1145
104 Ga0207671_10030422 3300025914 Bacteria 4027
105 Ga0207671_10060108 3300025914 Bacteria 2819
106 Ga0207704_11521769 3300025938 Unclassified 574
107 Ga0207689_10204727 3300025942 Bacteria 1630
108 Ga0207667_10003652 3300025949 Bacteria 18976
109 Ga0207667_10264773 3300025949 Bacteria 1758
110 Ga0207640_10283823 3300025981 Bacteria 1302
111 Ga0207640_10941612 3300025981 Bacteria 757
112 Ga0207678_10081261 3300026067 Bacteria 2774
113 Ga0207702_10436378 3300026078 Bacteria 1268
114 Ga0207648_10015668 3300026089 Bacteria 6961
115 Ga0207676_11243224 3300026095 Bacteria 739
116 Ga0207674_10107555 3300026116 Unclassified 2766
117 Ga0207674_10601693 3300026116 Bacteria 1062
118 Ga0207698_11309228 3300026142 Unclassified 739
119 Ga0209995_1057024 3300027471 Bacteria 664
120 Ga0209983_1042572 3300027665 Bacteria 984
121 Ga0209974_10333415 3300027876 Bacteria 586
122 Ga0268266_11229263 3300028379 Bacteria 724
123 Ga0268265_10386062 3300028380 Unclassified 1290
124 Ga0307513_10179835 3300031456 Bacteria 1980
125 Ga0307509_10295289 3300031507 Bacteria 1372
126 Ga0307509_10447748 3300031507 Bacteria 986
127 Ga0307408_100000481 3300031548 Bacteria 34941
128 Ga0307413_11142634 3300031824 Bacteria 675
129 Ga0307412_10000001 3300031911 Bacteria 822691
130 Ga0307414_10146717 3300032004 Bacteria 1855
131 Ga0307414_10988083 3300032004 Unclassified 774
132 Ga0307414_11172092 3300032004 Unclassified 711
133 Ga0307414_12297478 3300032004 Bacteria 504
134 Ga0307415_102003568 3300032126 Unclassified 564
135 Ga0373927_0057777 3300035695 Bacteria 2509
136 Ga0395900_0898591 3300037418 Unclassified 809
137 Ga0395901_0827846 3300038443 Bacteria 913
138 Ga0395901_1013217 3300038443 Bacteria 806
139 Ga0436365_0231318 3300039437 Bacteria 17390
140 Ga0451798_0521951 3300041458 Bacteria 873
141 Ga0451800_1315018 3300041459 Unclassified 1057
142 Ga0451807_2619156 3300041486 Unclassified 676
143 Ga0451837_1367409 3300041494 Bacteria 1096
144 Ga0451841_0075717 3300041498 Bacteria 866
145 Ga0451849_1131200 3300041505 Unclassified 1165
146 Ga0451843_0490370 3300041509 Unclassified 1051
147 Ga0451855_0323902 3300041511 Bacteria 687
148 Ga0451853_2434158 3300041512 Bacteria 1790
149 Ga0439431_0003146 3300041997 Bacteria 3628
150 Ga0466969_0000320 3300044656 Bacteria 26530
151 Ga0466966_0012892 3300044684 Bacteria 5536
152 Ga0466968_0020567 3300044735 Bacteria 2666
153 Ga0466957_0013026 3300044842 Unclassified 4817
154 Ga0466959_0000034 3300045049 Bacteria 108946
155 Ga0495668_0002984 3300046616 Bacteria 13224
156 Ga0495672_0207574 3300047320 Bacteria 975
157 Ga0501034_0135721 3300049571 Bacteria 2441
158 Ga0501034_1326880 3300049571 Unclassified 596
159 Ga0501046_0309700 3300049580 Unclassified 1152
160 Ga0501047_0308968 3300049581 Bacteria 1422
161 Ga0501048_0590355 3300049582 Unclassified 797
162 Ga0501208_037392 3300049655 Bacteria 885
163 Ga0501217_021489 3300049661 Bacteria 1524
164 Ga0501235_026959 3300049669 Unclassified 1289
165 Ga0501235_042259 3300049669 Unclassified 1044
166 Ga0501257_076661 3300049686 Bacteria 859
167 Ga0501257_190860 3300049686 Bacteria 585
168 Ga0501225_0001024 3300049705 Bacteria 8760
169 Ga0501044_0002817 3300049823 Bacteria 19817
170 nmdc:mga0k408_118436_c1 3300050493 Unclassified 1567
171 nmdc:mga0k408_213250_c1 3300050493 Bacteria 1153
172 nmdc:mga05p37_34924_c1 3300050507 Bacteria 6162
173 Ga0500646_0008608 3300053090 Bacteria 2612
174 Ga0500646_0019129 3300053090 Bacteria 1810
175 Ga0500583_0000069 3300053092 Bacteria 61106
176 Ga0500583_0000330 3300053092 Bacteria 15790
177 Ga0500652_262057 3300053131 Bacteria 681
178 Ga0500568_0044209 3300053139 Bacteria 1778
179 Ga0500588_0239723 3300053146 Bacteria 679
180 Ga0500589_023349 3300053147 Bacteria 2850
181 Ga0500604_0244951 3300053151 Unclassified 620
182 Ga0500616_0061775 3300053153 Bacteria 1938
183 Ga0500622_0056161 3300053156 Unclassified 2016
184 Ga0500622_0389958 3300053156 Unclassified 568
185 Ga0466962_0195551 3300061719 Unclassified 987
186 2896111093 2896109856 Bacteria 7140722
187 Ga0068853_100655593
188 SwRhRL2b_contig_2741210
189 JGI24739J22299_10009367
190 JGI24737J22298_10148074
191 JGI25153J46596_10017656
192 JGI25153J46596_10026088
193 rootH1_10023128
194 rootH2_10053307
195 rootH2_10168356
196 rootL2_10089095
197 rootL2_10158991
198 rootL2_10177110
199 rootH1_10023903
200 rootH1_10241073
201 JGI25160J50197_1000611
202 JGI25160J50197_1001437
203 Ga0055526_1025498
204 Ga0055526_1040020
205 Ga0055526_1057314
206 Ga0055528_1000235
207 Ga0055530_10002912
208 Ga0055531_10036521
209 Ga0065165_1000019
210 Ga0065704_10000206
211 Ga0070676_10821349
212 Ga0070683_100031719
213 Ga0070670_100491008
214 Ga0068869_100378562
215 Ga0068868_101101355
216 Ga0070661_101099571
217 Ga0070661_101462017
218 Ga0070663_100271996
219 Ga0070681_10101857
220 Ga0068867_100017106
221 Ga0070679_100115499
222 Ga0070684_101068094
223 Ga0068853_100080747
224 Ga0070672_101438540
225 Ga0068855_100008058
226 Ga0068857_100124800
227 Ga0068857_100356467
228 Ga0068856_100071978
229 Ga0068852_100532905
230 Ga0068852_100704409
231 Ga0068864_100263566
232 Ga0068864_100350960
233 Ga0068864_101091346
234 Ga0068866_10254589
235 Ga0068858_101644710
236 Ga0068860_100029210
237 Ga0068862_100708739
238 Ga0075366_10073106
239 Ga0075366_10391611
240 Ga0075366_10558331
241 Ga0068865_101671815
242 Ga0105240_10049691
243 Ga0114129_10020843
244 Ga0105241_10136374
245 Ga0105242_10400795
246 Ga0105237_10005458
247 Ga0105237_10148512
248 Ga0105239_10003343
249 Ga0105239_10014519
250 Ga0105239_10736579
251 Ga0105246_10680185
252 Ga0157373_10064170
253 Ga0157371_10009220
254 Ga0157371_10335600
255 Ga0157371_11105270
256 Ga0157374_10067882
257 Ga0157374_10270740
258 Ga0157378_10075065
259 Ga0157378_10362361
260 Ga0163162_10129339
261 Ga0163162_10186039
262 Ga0157372_10029497
263 Ga0157372_10092475
264 Ga0157372_10211506
265 Ga0157372_10470450
266 Ga0157372_10620332
267 Ga0157372_11158159
268 Ga0157375_10665022
269 Ga0163163_10630781
270 Ga0157379_10901448
271 Ga0157376_10694066
272 Ga0182006_1003612
273 Ga0206354_11664068
274 Ga0209565_1029735
275 Ga0209673_1000183
276 Ga0209564_1003598
277 Ga0209564_1005087
278 Ga0209564_1046259
279 Ga0209758_1001739
280 Ga0209758_1004276
281 Ga0209050_1000305
282 Ga0207426_1000032
283 Ga0207426_1000566
284 Ga0207426_1023680
285 Ga0209257_1000783
286 Ga0207647_10179268
287 Ga0207654_10166435
288 Ga0207707_10197196
289 Ga0207695_10466943
290 Ga0207671_10030422
291 Ga0207671_10060108
292 Ga0207704_11521769
293 Ga0207689_10204727
294 Ga0207667_10003652
295 Ga0207667_10264773
296 Ga0207640_10283823
297 Ga0207640_10941612
298 Ga0207678_10081261
299 Ga0207702_10436378
300 Ga0207648_10015668
301 Ga0207676_11243224
302 Ga0207674_10107555
303 Ga0207674_10601693
304 Ga0207698_11309228
305 Ga0209995_1057024
306 Ga0209983_1042572
307 Ga0209974_10333415
308 Ga0268266_11229263
309 Ga0268265_10386062
310 Ga0307513_10179835
311 Ga0307509_10295289
312 Ga0307509_10447748
313 Ga0307408_100000481
314 Ga0307413_11142634
315 Ga0307412_10000001
316 Ga0307414_10146717
317 Ga0307414_10988083
318 Ga0307414_11172092
319 Ga0307414_12297478
320 Ga0307415_102003568
321 Ga0373927_0057777
322 Ga0395900_0898591
323 Ga0395901_0827846
324 Ga0395901_1013217
325 Ga0436365_0231318
326 Ga0451798_0521951
327 Ga0451800_1315018
328 Ga0451807_2619156
329 Ga0451837_1367409
330 Ga0451841_0075717
331 Ga0451849_1131200
332 Ga0451843_0490370
333 Ga0451855_0323902
334 Ga0451853_2434158
335 Ga0439431_0003146
336 Ga0466969_0000320
337 Ga0466966_0012892
338 Ga0466968_0020567
339 Ga0466957_0013026
340 Ga0466959_0000034
341 Ga0495668_0002984
342 Ga0495672_0207574
343 Ga0501034_0135721
344 Ga0501034_1326880
345 Ga0501046_0309700
346 Ga0501047_0308968
347 Ga0501048_0590355
348 Ga0501208_037392
349 Ga0501217_021489
350 Ga0501235_026959
351 Ga0501235_042259
352 Ga0501257_076661
353 Ga0501257_190860
354 Ga0501225_0001024
355 Ga0501044_0002817
356 nmdc:mga0k408_118436_c1
357 nmdc:mga0k408_213250_c1
358 nmdc:mga05p37_34924_c1
359 Ga0500646_0008608
360 Ga0500646_0019129
361 Ga0500583_0000069
362 Ga0500583_0000330
363 Ga0500652_262057
364 Ga0500568_0044209
365 Ga0500588_0239723
366 Ga0500589_023349
367 Ga0500604_0244951
368 Ga0500616_0061775
369 Ga0500622_0056161
370 Ga0500622_0389958
371 Ga0466962_0195551
372 2896111093

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02627

CMD

Carboxymuconolactone decarboxylase family

27

111

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
7xw1-assembly1.cif.gz_A the crystal structure of ahpd from pseudomonas aeruginosa 0.9325 23 144
2ijc-assembly2.cif.gz_I structure of a conserved protein of unknown function pa0269 from pseudomonas aeruginosa 0.9243 12 152
2gmy-assembly1.cif.gz_C crystal structure of a protein of unknown function atu0492 from agrobacterium tumefaciens, putative antioxidant defence protein ahpd 0.9069 12 155
2ijc-assembly2.cif.gz_I structure of a conserved protein of unknown function pa0269 from pseudomonas aeruginosa 0.8942 12 152
2gmy-assembly1.cif.gz_C crystal structure of a protein of unknown function atu0492 from agrobacterium tumefaciens, putative antioxidant defence protein ahpd 0.8895 12 155
ID Description Score Start End Superfamily
af_Q2FVE0_2_139_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9299 13 144 1.20.1290.10
2ijcF00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9225 20 144 1.20.1290.10
2o4dA00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.921 20 144 1.20.1290.10
2gmyF00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9021 12 156 1.20.1290.10
2gmyF00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8849 12 156 1.20.1290.10
ID Description Score Start End GO Terms
AF-A0A1I2CI56-F1-model_v4 Alkylhydroperoxidase AhpD family core domain-containing protein 0.9629 24 156 GO:0051920
AF-A0A7X6Q7T9-F1-model_v4 Carboxymuconolactone decarboxylase family protein 0.9503 48 158 GO:0051920
AF-A0A2A5B005-F1-model_v4 Carboxymuconolactone decarboxylase 0.9501 12 152 GO:0051920
AF-A0A522QC02-F1-model_v4 Carboxymuconolactone decarboxylase family protein 0.9501 37 157 GO:0051920
AF-A0A7V9HI84-F1-model_v4 Carboxymuconolactone decarboxylase family protein 0.9484 19 158 GO:0051920

Map