F285671

General Info

Members Datasets Scaffolds Average Seq Length
186 138 372 184

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_100000334|Ga0070665_10000033418
Length 208
Sequence MATNGSALWPRTLPPMRPTGRRRKVIQIIVFYLFAAFVIASGVMTIASRNPVHSVLWLILAFFNAAGLFLLIGAEFLAFLLVIDFTELRSGIARYWPFGFGLAAVILTEIFFGVIAWNAGGIALSGRPAPAAAAQSNIVELGELLYTRYLFIFEAAGLVLLVAMIGAIVLTRRKRSDVRPQNVSAQVRRRPQDAVVNMQPGVGQGVDI

Samples

Sample ID Description Type Environment
1 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
29 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
34 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
52 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
53 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
54 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
55 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
89 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
90 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
91 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
92 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
93 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
94 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
95 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
96 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
97 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
98 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
99 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
100 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
101 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
102 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
103 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
104 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
105 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
106 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
107 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
108 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
109 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
110 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
111 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
112 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
113 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
114 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
115 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
116 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
117 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
118 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
119 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
120 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
121 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
122 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
123 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
124 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
125 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
126 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
127 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
128 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
129 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
130 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
131 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
132 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
133 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
134 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
135 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
136 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
137 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
138 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.39
Metatranscriptomes 0
Isolates 1.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.53
Nodule 0
Rhizoplane 1.08
Rhizosphere 80.65
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070665_100000334 3300005548 Bacteria 72297
2 JGI24739J22299_10054326 3300001989 Bacteria 1284
3 Ga0070658_10000001 3300005327 Bacteria 856789
4 Ga0070676_10021396 3300005328 Bacteria 3622
5 Ga0070683_100704913 3300005329 Bacteria 967
6 Ga0070683_100845605 3300005329 Bacteria 878
7 Ga0070690_100534590 3300005330 Bacteria 882
8 Ga0070670_100190638 3300005331 Bacteria 1781
9 Ga0070670_100765118 3300005331 Bacteria 871
10 Ga0070677_10000656 3300005333 Bacteria 11544
11 Ga0070680_100001856 3300005336 Bacteria 15485
12 Ga0068868_100000001 3300005338 Bacteria 282170
13 Ga0070660_100002909 3300005339 Bacteria 11787
14 Ga0070660_100251319 3300005339 Bacteria 1442
15 Ga0070661_100000014 3300005344 Bacteria 158652
16 Ga0070692_10020736 3300005345 Bacteria 3189
17 Ga0070668_100000262 3300005347 Bacteria 34868
18 Ga0070675_100059126 3300005354 Bacteria 3161
19 Ga0070671_100008396 3300005355 Bacteria 8278
20 Ga0070673_100023757 3300005364 Bacteria 4484
21 Ga0070673_100974268 3300005364 Bacteria 789
22 Ga0070659_100000001 3300005366 Bacteria 576390
23 Ga0070659_100188273 3300005366 Bacteria 1696
24 Ga0070700_100630849 3300005441 Bacteria 844
25 Ga0070681_10043497 3300005458 Bacteria 4500
26 Ga0070681_10588752 3300005458 Bacteria 1027
27 Ga0070679_100000007 3300005530 Bacteria 195373
28 Ga0070684_100872297 3300005535 Bacteria 843
29 Ga0068853_100072591 3300005539 Bacteria 2999
30 Ga0070686_100000597 3300005544 Bacteria 21352
31 Ga0070665_100000051 3300005548 Bacteria 249317
32 Ga0070665_100014421 3300005548 Bacteria 7931
33 Ga0070665_100187091 3300005548 Bacteria 2072
34 Ga0070704_100517823 3300005549 Bacteria 1038
35 Ga0068856_100037704 3300005614 Bacteria 4743
36 Ga0068859_100000812 3300005617 Bacteria 31775
37 Ga0068859_100250196 3300005617 Bacteria 1863
38 Ga0068861_100000052 3300005719 Bacteria 54577
39 Ga0068851_10002776 3300005834 Bacteria 7716
40 Ga0068863_100000122 3300005841 Bacteria 81534
41 Ga0068863_100106569 3300005841 Bacteria 2667
42 Ga0068860_100075746 3300005843 Bacteria 3200
43 Ga0068862_100013308 3300005844 Bacteria 6805
44 Ga0068862_100154143 3300005844 Bacteria 2047
45 Ga0081539_10008628 3300005985 Bacteria 8797
46 Ga0081539_10026723 3300005985 Bacteria 3673
47 Ga0075430_100048408 3300006846 Bacteria 3589
48 Ga0075434_100583862 3300006871 Bacteria 1137
49 Ga0097620_100000812 3300006931 Bacteria 31775
50 Ga0097620_100250166 3300006931 Bacteria 1863
51 Ga0105240_10015887 3300009093 Bacteria 10212
52 Ga0105245_10550044 3300009098 Bacteria 1176
53 Ga0105245_10845293 3300009098 Bacteria 955
54 Ga0105243_10010447 3300009148 Bacteria 7049
55 Ga0105248_10027949 3300009177 Bacteria 6281
56 Ga0105237_10003515 3300009545 Bacteria 18584
57 Ga0105237_10538451 3300009545 Bacteria 1174
58 Ga0105238_10398715 3300009551 Bacteria 1369
59 Ga0105249_11086893 3300009553 Bacteria 870
60 Ga0105239_10000037 3300010375 Bacteria 206779
61 Ga0105239_10049433 3300010375 Bacteria 4611
62 Ga0157373_10200475 3300013100 Bacteria 1407
63 Ga0157370_10034345 3300013104 Bacteria 4940
64 Ga0157369_10017317 3300013105 Bacteria 8100
65 Ga0157369_10194110 3300013105 Bacteria 2133
66 Ga0157378_10047145 3300013297 Bacteria 3830
67 Ga0157378_10470438 3300013297 Bacteria 1251
68 Ga0157372_10800195 3300013307 Bacteria 1095
69 Ga0157372_10893298 3300013307 Bacteria 1031
70 Ga0157375_10652615 3300013308 Bacteria 1208
71 Ga0157379_10224776 3300014968 Bacteria 1701
72 Ga0213873_10000025 3300021358 Bacteria 86171
73 Ga0213876_10000004 3300021384 Bacteria 943822
74 Ga0213876_10000234 3300021384 Bacteria 54188
75 Ga0213876_10013064 3300021384 Bacteria 4414
76 Ga0209025_1087984 3300025294 Bacteria 1026
77 Ga0207656_10009468 3300025321 Bacteria 3620
78 Ga0207682_10000833 3300025893 Bacteria 14256
79 Ga0207645_10049270 3300025907 Bacteria 2690
80 Ga0207645_10418856 3300025907 Bacteria 902
81 Ga0207705_10000002 3300025909 Bacteria 2046852
82 Ga0207707_10038815 3300025912 Bacteria 4161
83 Ga0207695_10001017 3300025913 Bacteria 49429
84 Ga0207671_10059415 3300025914 Bacteria 2835
85 Ga0207660_10000781 3300025917 Bacteria 21158
86 Ga0207657_10011635 3300025919 Bacteria 8725
87 Ga0207657_10044334 3300025919 Bacteria 3910
88 Ga0207649_10000613 3300025920 Bacteria 24131
89 Ga0207652_10000001 3300025921 Bacteria 1006643
90 Ga0207652_10000002 3300025921 Bacteria 878035
91 Ga0207681_10043544 3300025923 Bacteria 3005
92 Ga0207650_10665769 3300025925 Bacteria 878
93 Ga0207659_10039428 3300025926 Bacteria 3295
94 Ga0207687_10028339 3300025927 Bacteria 3763
95 Ga0207687_10099823 3300025927 Bacteria 2134
96 Ga0207687_10260770 3300025927 Bacteria 1382
97 Ga0207644_10000602 3300025931 Bacteria 22923
98 Ga0207690_10000051 3300025932 Bacteria 107367
99 Ga0207690_10036568 3300025932 Bacteria 3180
100 Ga0207690_10229303 3300025932 Bacteria 1425
101 Ga0207709_10028936 3300025935 Bacteria 3207
102 Ga0207691_10754391 3300025940 Bacteria 819
103 Ga0207711_10039257 3300025941 Bacteria 4027
104 Ga0207651_10339870 3300025960 Bacteria 1261
105 Ga0207668_10000342 3300025972 Bacteria 30270
106 Ga0207640_10322092 3300025981 Bacteria 1231
107 Ga0207677_10000013 3300026023 Bacteria 186519
108 Ga0207708_10604849 3300026075 Bacteria 929
109 Ga0207702_10007346 3300026078 Bacteria 9412
110 Ga0207641_10000001 3300026088 Bacteria 1180841
111 Ga0207641_10021141 3300026088 Bacteria 5349
112 Ga0207648_10932091 3300026089 Bacteria 812
113 Ga0207675_100000035 3300026118 Bacteria 95190
114 Ga0207698_10930687 3300026142 Bacteria 877
115 Ga0268266_10000002 3300028379 Bacteria 3059047
116 Ga0268266_10001119 3300028379 Bacteria 33470
117 Ga0268266_10001922 3300028379 Bacteria 23363
118 Ga0268266_10076211 3300028379 Bacteria 2914
119 Ga0268266_10824843 3300028379 Bacteria 896
120 Ga0268265_10010268 3300028380 Bacteria 6326
121 Ga0268264_10058422 3300028381 Bacteria 3230
122 Ga0268264_10570077 3300028381 Bacteria 1112
123 Ga0307517_10041988 3300028786 Bacteria 4921
124 Ga0307517_10088615 3300028786 Bacteria 2556
125 Ga0265327_10206015 3300031251 Bacteria 889
126 Ga0307513_10548852 3300031456 Bacteria 868
127 Ga0307408_100138517 3300031548 Bacteria 1907
128 Ga0307410_10078710 3300031852 Bacteria 2308
129 Ga0307412_10012588 3300031911 Bacteria 4936
130 Ga0307414_10417674 3300032004 Bacteria 1169
131 Ga0307414_10581100 3300032004 Bacteria 1002
132 Ga0307411_10295458 3300032005 Bacteria 1297
133 Ga0307510_10268359 3300033180 Bacteria 1184
134 Ga0436365_0644123 3300039437 Bacteria 36806
135 Ga0436365_1041421 3300039437 Bacteria 61116
136 Ga0436365_1152574 3300039437 Bacteria 2976
137 Ga0436365_1738069 3300039437 Bacteria 4662
138 Ga0436363_0571858 3300039450 Bacteria 1478
139 Ga0436362_1061615 3300039453 Bacteria 22504
140 Ga0450923_071090 3300042125 Bacteria 771
141 Ga0495650_0004591 3300046471 Bacteria 9387
142 Ga0495650_0142543 3300046471 Bacteria 866
143 Ga0495639_0222540 3300046475 Bacteria 928
144 Ga0495583_0123736 3300046506 Bacteria 1086
145 Ga0495583_0128744 3300046506 Bacteria 1060
146 Ga0495631_0160955 3300046518 Bacteria 963
147 Ga0495648_0119791 3300046524 Bacteria 1417
148 Ga0495648_0290774 3300046524 Bacteria 770
149 Ga0495642_0187009 3300046528 Bacteria 902
150 Ga0495625_0034027 3300046660 Bacteria 3762
151 Ga0495625_0265260 3300046660 Bacteria 1110
152 Ga0495625_0388306 3300046660 Bacteria 874
153 Ga0495669_0000257 3300046684 Bacteria 30725
154 Ga0495671_0045225 3300046692 Bacteria 2205
155 Ga0495600_0028150 3300046809 Bacteria 3635
156 Ga0495687_000224 3300047443 Bacteria 79719
157 Ga0495673_0077853 3300047469 Bacteria 1380
158 Ga0495686_0012404 3300047472 Bacteria 5961
159 Ga0495686_0261617 3300047472 Bacteria 968
160 Ga0496111_0142412 3300048914 Bacteria 1777
161 Ga0496118_0066395 3300048921 Bacteria 2633
162 Ga0496121_0062355 3300048924 Bacteria 3054
163 Ga0496121_0298069 3300048924 Bacteria 1095
164 Ga0496122_0023772 3300048925 Bacteria 5386
165 Ga0496123_0020959 3300048926 Bacteria 5094
166 Ga0496124_0028490 3300048927 Bacteria 4995
167 Ga0496126_0891402 3300048929 Bacteria 675
168 Ga0501048_0390733 3300049582 Bacteria 994
169 nmdc:mga0qj67_160621_c1 3300050509 Bacteria 1824
170 Ga0500610_0000071 3300053079 Bacteria 30806
171 Ga0495655_0112434 3300053083 Bacteria 820
172 Ga0500646_0057574 3300053090 Bacteria 1136
173 Ga0500583_0104850 3300053092 Bacteria 1388
174 Ga0500641_0128471 3300053096 Bacteria 1093
175 Ga0500595_013801 3300053119 Bacteria 3086
176 Ga0500568_0054055 3300053139 Bacteria 1572
177 Ga0500568_0054943 3300053139 Bacteria 1555
178 Ga0500604_0000078 3300053151 Bacteria 34635
179 Ga0500616_0000128 3300053153 Bacteria 134307
180 Ga0500636_0030741 3300053177 Bacteria 3178
181 Ga0500645_000009 3300053730 Bacteria 206177
182 Ga0500596_005982 3300053735 Bacteria 2093
183 Ga0500587_010074 3300053739 Bacteria 1201
184 2600201024 2599185354 Bacteria 4398675
185 2753765316 2751185897 Bacteria 5322941
186 8057104438 8057101203 Bacteria 5034064
187 Ga0070665_100000334
188 JGI24739J22299_10054326
189 Ga0070658_10000001
190 Ga0070676_10021396
191 Ga0070683_100704913
192 Ga0070683_100845605
193 Ga0070690_100534590
194 Ga0070670_100190638
195 Ga0070670_100765118
196 Ga0070677_10000656
197 Ga0070680_100001856
198 Ga0068868_100000001
199 Ga0070660_100002909
200 Ga0070660_100251319
201 Ga0070661_100000014
202 Ga0070692_10020736
203 Ga0070668_100000262
204 Ga0070675_100059126
205 Ga0070671_100008396
206 Ga0070673_100023757
207 Ga0070673_100974268
208 Ga0070659_100000001
209 Ga0070659_100188273
210 Ga0070700_100630849
211 Ga0070681_10043497
212 Ga0070681_10588752
213 Ga0070679_100000007
214 Ga0070684_100872297
215 Ga0068853_100072591
216 Ga0070686_100000597
217 Ga0070665_100000051
218 Ga0070665_100014421
219 Ga0070665_100187091
220 Ga0070704_100517823
221 Ga0068856_100037704
222 Ga0068859_100000812
223 Ga0068859_100250196
224 Ga0068861_100000052
225 Ga0068851_10002776
226 Ga0068863_100000122
227 Ga0068863_100106569
228 Ga0068860_100075746
229 Ga0068862_100013308
230 Ga0068862_100154143
231 Ga0081539_10008628
232 Ga0081539_10026723
233 Ga0075430_100048408
234 Ga0075434_100583862
235 Ga0097620_100000812
236 Ga0097620_100250166
237 Ga0105240_10015887
238 Ga0105245_10550044
239 Ga0105245_10845293
240 Ga0105243_10010447
241 Ga0105248_10027949
242 Ga0105237_10003515
243 Ga0105237_10538451
244 Ga0105238_10398715
245 Ga0105249_11086893
246 Ga0105239_10000037
247 Ga0105239_10049433
248 Ga0157373_10200475
249 Ga0157370_10034345
250 Ga0157369_10017317
251 Ga0157369_10194110
252 Ga0157378_10047145
253 Ga0157378_10470438
254 Ga0157372_10800195
255 Ga0157372_10893298
256 Ga0157375_10652615
257 Ga0157379_10224776
258 Ga0213873_10000025
259 Ga0213876_10000004
260 Ga0213876_10000234
261 Ga0213876_10013064
262 Ga0209025_1087984
263 Ga0207656_10009468
264 Ga0207682_10000833
265 Ga0207645_10049270
266 Ga0207645_10418856
267 Ga0207705_10000002
268 Ga0207707_10038815
269 Ga0207695_10001017
270 Ga0207671_10059415
271 Ga0207660_10000781
272 Ga0207657_10011635
273 Ga0207657_10044334
274 Ga0207649_10000613
275 Ga0207652_10000001
276 Ga0207652_10000002
277 Ga0207681_10043544
278 Ga0207650_10665769
279 Ga0207659_10039428
280 Ga0207687_10028339
281 Ga0207687_10099823
282 Ga0207687_10260770
283 Ga0207644_10000602
284 Ga0207690_10000051
285 Ga0207690_10036568
286 Ga0207690_10229303
287 Ga0207709_10028936
288 Ga0207691_10754391
289 Ga0207711_10039257
290 Ga0207651_10339870
291 Ga0207668_10000342
292 Ga0207640_10322092
293 Ga0207677_10000013
294 Ga0207708_10604849
295 Ga0207702_10007346
296 Ga0207641_10000001
297 Ga0207641_10021141
298 Ga0207648_10932091
299 Ga0207675_100000035
300 Ga0207698_10930687
301 Ga0268266_10000002
302 Ga0268266_10001119
303 Ga0268266_10001922
304 Ga0268266_10076211
305 Ga0268266_10824843
306 Ga0268265_10010268
307 Ga0268264_10058422
308 Ga0268264_10570077
309 Ga0307517_10041988
310 Ga0307517_10088615
311 Ga0265327_10206015
312 Ga0307513_10548852
313 Ga0307408_100138517
314 Ga0307410_10078710
315 Ga0307412_10012588
316 Ga0307414_10417674
317 Ga0307414_10581100
318 Ga0307411_10295458
319 Ga0307510_10268359
320 Ga0436365_0644123
321 Ga0436365_1041421
322 Ga0436365_1152574
323 Ga0436365_1738069
324 Ga0436363_0571858
325 Ga0436362_1061615
326 Ga0450923_071090
327 Ga0495650_0004591
328 Ga0495650_0142543
329 Ga0495639_0222540
330 Ga0495583_0123736
331 Ga0495583_0128744
332 Ga0495631_0160955
333 Ga0495648_0119791
334 Ga0495648_0290774
335 Ga0495642_0187009
336 Ga0495625_0034027
337 Ga0495625_0265260
338 Ga0495625_0388306
339 Ga0495669_0000257
340 Ga0495671_0045225
341 Ga0495600_0028150
342 Ga0495687_000224
343 Ga0495673_0077853
344 Ga0495686_0012404
345 Ga0495686_0261617
346 Ga0496111_0142412
347 Ga0496118_0066395
348 Ga0496121_0062355
349 Ga0496121_0298069
350 Ga0496122_0023772
351 Ga0496123_0020959
352 Ga0496124_0028490
353 Ga0496126_0891402
354 Ga0501048_0390733
355 nmdc:mga0qj67_160621_c1
356 Ga0500610_0000071
357 Ga0495655_0112434
358 Ga0500646_0057574
359 Ga0500583_0104850
360 Ga0500641_0128471
361 Ga0500595_013801
362 Ga0500568_0054055
363 Ga0500568_0054943
364 Ga0500604_0000078
365 Ga0500616_0000128
366 Ga0500636_0030741
367 Ga0500645_000009
368 Ga0500596_005982
369 Ga0500587_010074
370 2600201024
371 2753765316
372 8057104438

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00499

Oxidored_q3

NADH-ubiquinone/plastoquinone oxidoreductase chain 6

41

86

0.96

PF00499

Oxidored_q3

NADH-ubiquinone/plastoquinone oxidoreductase chain 6

79

170

0.75

Map