F286258

General Info

Members Datasets Scaffolds Average Seq Length
186 131 187 158

Family's Representative Sequence

Representative Sequence 3300031901|Ga0307406_10000102|Ga0307406_1000010222
Length 161
Sequence MAAKKSSRQAHKKGVKQPSAIVNRRASYDYALGDTVTVGVVLTGREVRAARDGRVQLKGSFVTVRQNELWLNNASFSLALNSKGQHETSVDTTARKLLASRKEIDELYARKQDGMSIVPLRLLTQGRFIKLVIALGKGKKNYDKRQAIKKRDQERDTARSL

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
24 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
25 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
26 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
27 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
28 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
29 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
30 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
31 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
32 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
33 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
36 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
37 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
38 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
41 3300009984 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG Metagenome Rhizosphere
42 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
43 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
46 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
47 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300013874 Rhizosphere microbial communities from switchgrass harvested rhizosphere in Austin, TX, USA - RS_213 Metagenome Rhizosphere
53 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
54 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
55 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
75 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
76 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
77 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
78 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
79 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
80 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
81 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
82 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
83 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
84 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
85 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
86 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
87 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
88 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
89 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
90 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
91 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
92 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
93 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
94 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
95 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
96 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
97 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
98 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
99 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
100 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
101 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
102 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
103 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
104 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
105 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
106 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
107 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
110 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
111 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
112 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
113 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
114 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
115 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
116 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
117 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
118 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
119 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
120 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
121 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
122 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
123 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
124 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
125 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
126 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
127 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
128 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
129 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
130 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
131 3300053738 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 26.34
Nodule 0
Rhizoplane 1.61
Rhizosphere 70.43
Stem 0
Stem Tuber 0
Unclassified 1.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10002697 3300001979 Bacteria 7968
2 JGI24739J22299_10000857 3300001989 Bacteria 11215
3 JGI24737J22298_10000452 3300001990 Bacteria 14115
4 JGI24743J22301_10013242 3300001991 Bacteria 1510
5 JGI24735J21928_10000054 3300002067 Bacteria 49038
6 JGI24738J21930_10001199 3300002075 Bacteria 7263
7 rootH1_10002360 3300003316 Bacteria 56099
8 rootH1_10002360 3300003323 Bacteria 3372
9 Ga0065712_10439985 3300005290 Unclassified 695
10 Ga0065715_10006403 3300005293 Bacteria 3638
11 Ga0070658_10000063 3300005327 Bacteria 107300
12 Ga0070683_100004853 3300005329 Bacteria 11137
13 Ga0070660_100052202 3300005339 Bacteria 3151
14 Ga0070661_100006621 3300005344 Bacteria 7991
15 Ga0070661_100269828 3300005344 Bacteria 1317
16 Ga0070692_10112707 3300005345 Bacteria 1506
17 Ga0070675_101210528 3300005354 Unclassified 695
18 Ga0070659_100001790 3300005366 Bacteria 15467
19 Ga0070659_100083254 3300005366 Unclassified 2557
20 Ga0068855_100000002 3300005563 Bacteria 616881
21 Ga0070664_100000051 3300005564 Bacteria 70646
22 Ga0068857_100246047 3300005577 Bacteria 1638
23 Ga0068854_100117124 3300005578 Bacteria 2017
24 Ga0068856_100000018 3300005614 Bacteria 151165
25 Ga0068856_100002398 3300005614 Bacteria 19281
26 Ga0068856_102041765 3300005614 Unclassified 583
27 Ga0068852_100000001 3300005616 Bacteria 716526
28 Ga0068852_100000045 3300005616 Bacteria 88494
29 Ga0075365_10000026 3300006038 Bacteria 61245
30 Ga0075365_10030320 3300006038 Unclassified 3463
31 Ga0075365_10071910 3300006038 Unclassified 2329
32 Ga0075365_10171769 3300006038 Bacteria 1513
33 Ga0075365_10226133 3300006038 Bacteria 1313
34 Ga0075368_10000128 3300006042 Bacteria 20142
35 Ga0075363_100007810 3300006048 Unclassified 4943
36 Ga0075364_10000781 3300006051 Bacteria 16736
37 Ga0075364_10020102 3300006051 Bacteria 4199
38 Ga0075367_10001381 3300006178 Bacteria 10368
39 Ga0075369_10001029 3300006186 Bacteria 9322
40 Ga0075369_10014929 3300006186 Bacteria 3110
41 Ga0075366_10001246 3300006195 Bacteria 12639
42 Ga0075370_10326988 3300006353 Bacteria 914
43 Ga0068871_100040160 3300006358 Bacteria 3747
44 Ga0068865_100001064 3300006881 Bacteria 15799
45 Ga0105244_10124255 3300009036 Unclassified 1248
46 Ga0105240_10001718 3300009093 Bacteria 36965
47 Ga0105240_10014184 3300009093 Bacteria 10884
48 Ga0105240_10201481 3300009093 Unclassified 2332
49 Ga0105245_10027872 3300009098 Bacteria 4978
50 Ga0105241_10067152 3300009174 Unclassified 2775
51 Ga0105248_12398527 3300009177 Unclassified 601
52 Ga0105237_10000002 3300009545 Bacteria 702357
53 Ga0105238_10002660 3300009551 Bacteria 17764
54 Ga0105032_100003 3300009979 Bacteria 186985
55 Ga0105029_100039 3300009984 Bacteria 6028
56 Ga0105029_106123 3300009984 Bacteria 854
57 Ga0105030_102326 3300009987 Bacteria 1663
58 Ga0105028_100932 3300009993 Bacteria 3086
59 Ga0105028_101087 3300009993 Unclassified 2872
60 Ga0105239_10000722 3300010375 Bacteria 46895
61 Ga0105239_10173355 3300010375 Bacteria 2413
62 Ga0105239_10181085 3300010375 Bacteria 2358
63 Ga0105246_10005353 3300011119 Bacteria 7812
64 Ga0105246_10400453 3300011119 Unclassified 1140
65 Ga0105246_10527062 3300011119 Bacteria 1008
66 Ga0105246_10754012 3300011119 Bacteria 859
67 Ga0157373_10016344 3300013100 Bacteria 5414
68 Ga0157371_10005390 3300013102 Bacteria 10802
69 Ga0157370_10007404 3300013104 Bacteria 11954
70 Ga0157369_10000024 3300013105 Bacteria 225851
71 Ga0157369_10005601 3300013105 Bacteria 14584
72 Ga0157369_10006357 3300013105 Bacteria 13711
73 Ga0157369_10008946 3300013105 Bacteria 11470
74 Ga0157369_10012651 3300013105 Bacteria 9570
75 Ga0157369_10652039 3300013105 Bacteria 1085
76 Ga0157374_10002360 3300013296 Bacteria 15919
77 Ga0157374_11201666 3300013296 Bacteria 779
78 Ga0157372_10000008 3300013307 Bacteria 305449
79 Ga0157372_10161804 3300013307 Bacteria 2587
80 Ga0157514_109437 3300013874 Bacteria 1393
81 Ga0157377_10000668 3300014745 Bacteria 14227
82 Ga0157376_10112409 3300014969 Bacteria 2400
83 Ga0207647_10000640 3300025904 Bacteria 27311
84 Ga0207705_10000093 3300025909 Bacteria 107314
85 Ga0207695_10002102 3300025913 Bacteria 30254
86 Ga0207695_10002605 3300025913 Bacteria 26438
87 Ga0207695_10140282 3300025913 Bacteria 2366
88 Ga0207695_10503336 3300025913 Unclassified 1093
89 Ga0207671_10000008 3300025914 Bacteria 798229
90 Ga0207657_10002779 3300025919 Bacteria 18849
91 Ga0207649_10010569 3300025920 Bacteria 5076
92 Ga0207694_10019228 3300025924 Bacteria 5164
93 Ga0207687_10091060 3300025927 Bacteria 2224
94 Ga0207690_10040820 3300025932 Bacteria 3036
95 Ga0207690_10060961 3300025932 Unclassified 2563
96 Ga0207706_10000209 3300025933 Bacteria 64890
97 Ga0207704_10000609 3300025938 Bacteria 15811
98 Ga0207661_10010521 3300025944 Bacteria 6663
99 Ga0207679_10001761 3300025945 Bacteria 13482
100 Ga0207667_10000005 3300025949 Bacteria 715503
101 Ga0207667_10000096 3300025949 Bacteria 143776
102 Ga0207640_10005721 3300025981 Bacteria 6772
103 Ga0207702_10000179 3300026078 Bacteria 76263
104 Ga0207702_10010516 3300026078 Bacteria 7739
105 Ga0207674_10028094 3300026116 Bacteria 5941
106 Ga0207674_10055610 3300026116 Unclassified 4022
107 Ga0207698_10000022 3300026142 Bacteria 131985
108 Ga0207698_10000165 3300026142 Bacteria 41957
109 Ga0210002_1007802 3300027617 Bacteria 1625
110 Ga0209974_10030847 3300027876 Bacteria 1775
111 Ga0314311_1140583 3300030733 Unclassified 2117
112 Ga0316179_1058425 3300030734 Bacteria 13049
113 Ga0316180_1168762 3300030736 Bacteria 1669
114 Ga0316183_1139918 3300030742 Bacteria 10398
115 Ga0316183_1168079 3300030742 Unclassified 2532
116 Ga0316181_1014881 3300030744 Bacteria 1667
117 Ga0316182_1017869 3300030745 Bacteria 3590
118 Ga0316182_1125898 3300030745 Bacteria 9786
119 Ga0316182_1366183 3300030745 Bacteria 7057
120 Ga0307516_10013501 3300031730 Bacteria 8694
121 Ga0307406_10000002 3300031901 Bacteria 255753
122 Ga0307406_10000102 3300031901 Bacteria 49288
123 Ga0307412_11023234 3300031911 Bacteria 731
124 Ga0395899_0015497 3300037312 Bacteria 5811
125 Ga0395899_0021442 3300037312 Bacteria 4901
126 Ga0395900_0000001 3300037418 Bacteria 931146
127 Ga0395900_0790826 3300037418 Bacteria 877
128 Ga0395898_0000002 3300037466 Bacteria 931013
129 Ga0395901_0000072 3300038443 Bacteria 140394
130 Ga0395901_0136321 3300038443 Bacteria 2580
131 Ga0439438_016598 3300041405 Bacteria 2139
132 Ga0439466_0096607 3300041411 Bacteria 923
133 Ga0439442_011509 3300042002 Bacteria 1802
134 Ga0439445_0002501 3300042004 Bacteria 4091
135 Ga0439432_013234 3300042006 Bacteria 2809
136 Ga0439462_0088233 3300042015 Bacteria 850
137 Ga0450919_009340 3300042121 Bacteria 1126
138 Ga0450920_031609 3300042122 Bacteria 1043
139 Ga0439446_0004417 3300042156 Unclassified 3568
140 Ga0450909_000943 3300042185 Bacteria 3972
141 Ga0439464_0000043 3300042439 Bacteria 16217
142 Ga0466972_0026749 3300044658 Bacteria 2858
143 Ga0466965_0000136 3300044683 Bacteria 21041
144 Ga0453684_1049331 3300044712 Unclassified 864
145 Ga0495660_0000175 3300046810 Bacteria 69454
146 Ga0496100_0182834 3300048903 Bacteria 1517
147 Ga0496109_0813840 3300048912 Bacteria 872
148 Ga0496115_0000007 3300048918 Bacteria 244991
149 Ga0496121_0579177 3300048924 Bacteria 697
150 Ga0501034_0000090 3300049571 Bacteria 165117
151 Ga0501037_0000001 3300049573 Bacteria 753276
152 Ga0501038_0015706 3300049574 Bacteria 6881
153 nmdc:mga03n38_100698_c1 3300050490 Bacteria 1393
154 nmdc:mga00v17_101_c1 3300050491 Bacteria 50798
155 nmdc:mga00v17_51227_c1 3300050491 Bacteria 2510
156 nmdc:mga0yw44_15_c2 3300050492 Bacteria 56226
157 nmdc:mga0yw44_233735_c1 3300050492 Unclassified 1220
158 nmdc:mga0yw44_444923_c1 3300050492 Bacteria 878
159 nmdc:mga0yw44_6_c1 3300050492 Bacteria 272478
160 nmdc:mga0k408_24002_c1 3300050493 Bacteria 3444
161 nmdc:mga06z11_111172_c1 3300050494 Bacteria 1517
162 nmdc:mga06z11_284_c1 3300050494 Bacteria 19699
163 nmdc:mga04h51_10424_c1 3300050495 Unclassified 2553
164 nmdc:mga07m45_364796_c1 3300050496 Bacteria 839
165 nmdc:mga07m45_509685_c1 3300050496 Unclassified 697
166 nmdc:mga07m45_978_c1 3300050496 Bacteria 12578
167 nmdc:mga0sz30_29687_c1 3300050516 Bacteria 2256
168 Ga0500643_015854 3300053087 Bacteria 2572
169 Ga0500643_039948 3300053087 Bacteria 1383
170 Ga0500644_0030265 3300053088 Bacteria 1711
171 Ga0500646_0000001 3300053090 Bacteria 273936
172 Ga0500646_0039198 3300053090 Bacteria 1328
173 Ga0500583_0023872 3300053092 Bacteria 2585
174 Ga0500583_0141365 3300053092 Bacteria 1196
175 Ga0500583_0491446 3300053092 Unclassified 577
176 Ga0500651_0000001 3300053093 Bacteria 529808
177 Ga0500641_0000001 3300053096 Bacteria 1115973
178 Ga0500650_0009862 3300053098 Bacteria 3853
179 Ga0500556_0051284 3300053104 Unclassified 1494
180 Ga0500594_0000004 3300053118 Bacteria 174508
181 Ga0500652_000007 3300053131 Bacteria 165913
182 Ga0500655_003384 3300053133 Bacteria 2884
183 Ga0500577_0047750 3300053142 Bacteria 1593
184 Ga0500616_0000067 3300053153 Bacteria 236311
185 Ga0500616_0076371 3300053153 Bacteria 1694
186 Ga0500616_0087619 3300053153 Bacteria 1549
187 Ga0500613_000849 3300053738 Unclassified 1893

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300030742 Ga0316183_1168079 Ga0316183_11680792 141
2 3300006353 Ga0075370_10326988 Ga0075370_103269882 146
3 3300050496 nmdc:mga07m45_364796_c1 nmdc:mga07m45_364796_c1_113_595 146
4 3300009993 Ga0105028_100932 Ga0105028_1009323 149
5 3300009984 Ga0105029_106123 Ga0105029_1061232 150
6 3300027617 Ga0210002_1007802 Ga0210002_10078022 152
7 3300027876 Ga0209974_10030847 Ga0209974_100308472 152
8 3300005345 Ga0070692_10112707 Ga0070692_101127072 153
9 3300006038 Ga0075365_10071910 Ga0075365_100719102 153
10 3300009993 Ga0105028_101087 Ga0105028_1010872 153
11 3300030733 Ga0314311_1140583 Ga0314311_11405831 153
12 3300005293 Ga0065715_10006403 Ga0065715_100064035 154
13 3300005563 Ga0068855_100000002 Ga0068855_10000000235 154
14 3300005577 Ga0068857_100246047 Ga0068857_1002460472 154
15 3300009093 Ga0105240_10201481 Ga0105240_102014814 154
16 3300025913 Ga0207695_10140282 Ga0207695_101402822 154
17 3300025913 Ga0207695_10503336 Ga0207695_105033362 154
18 3300025949 Ga0207667_10000005 Ga0207667_10000005147 154
19 3300026116 Ga0207674_10055610 Ga0207674_100556104 154
20 3300031901 Ga0307406_10000002 Ga0307406_10000002177 154
21 3300031901 Ga0307406_10000102 Ga0307406_1000010222 154
22 3300031911 Ga0307412_11023234 Ga0307412_110232342 154
23 3300041405 Ga0439438_016598 Ga0439438_016598_67_537 154
24 3300041411 Ga0439466_0096607 Ga0439466_0096607_108_578 154
25 3300042002 Ga0439442_011509 Ga0439442_011509_855_1325 154
26 3300042006 Ga0439432_013234 Ga0439432_013234_1441_1911 154
27 3300042015 Ga0439462_0088233 Ga0439462_0088233_46_516 154
28 3300042156 Ga0439446_0004417 Ga0439446_0004417_2507_2977 154
29 3300048903 Ga0496100_0182834 Ga0496100_0182834_792_1256 154
30 3300053104 Ga0500556_0051284 Ga0500556_0051284_512_982 154
31 3300053133 Ga0500655_003384 Ga0500655_003384_696_1160 154
32 3300003316 rootH1_10002360 rootH1_1000236047 155
33 3300005578 Ga0068854_100117124 Ga0068854_1001171243 155
34 3300011119 Ga0105246_10400453 Ga0105246_104004532 155
35 3300011119 Ga0105246_10527062 Ga0105246_105270622 155
36 3300013105 Ga0157369_10000024 Ga0157369_10000024161 155
37 3300025981 Ga0207640_10005721 Ga0207640_100057217 155
38 3300030734 Ga0316179_1058425 Ga0316179_105842514 155
39 3300030736 Ga0316180_1168762 Ga0316180_11687622 155
40 3300030742 Ga0316183_1139918 Ga0316183_113991810 155
41 3300030744 Ga0316181_1014881 Ga0316181_10148813 155
42 3300030745 Ga0316182_1366183 Ga0316182_13661839 155
43 3300042004 Ga0439445_0002501 Ga0439445_0002501_1707_2180 155
44 3300044658 Ga0466972_0026749 Ga0466972_0026749_726_1202 155
45 3300044683 Ga0466965_0000136 Ga0466965_0000136_17351_17827 155
46 3300048918 Ga0496115_0000007 Ga0496115_0000007_199022_199489 155
47 3300048924 Ga0496121_0579177 Ga0496121_0579177_120_593 155
48 3300053087 Ga0500643_015854 Ga0500643_015854_1265_1738 155
49 3300053087 Ga0500643_039948 Ga0500643_039948_113_589 155
50 3300005616 Ga0068852_100000001 Ga0068852_100000001731 156
51 3300006038 Ga0075365_10000026 Ga0075365_1000002634 156
52 3300006038 Ga0075365_10030320 Ga0075365_100303203 156
53 3300006038 Ga0075365_10171769 Ga0075365_101717692 156
54 3300006038 Ga0075365_10226133 Ga0075365_102261332 156
55 3300006042 Ga0075368_10000128 Ga0075368_100001285 156
56 3300006048 Ga0075363_100007810 Ga0075363_1000078105 156
57 3300006051 Ga0075364_10000781 Ga0075364_100007817 156
58 3300006178 Ga0075367_10001381 Ga0075367_1000138113 156
59 3300006186 Ga0075369_10001029 Ga0075369_100010293 156
60 3300009093 Ga0105240_10001718 Ga0105240_1000171837 156
61 3300009093 Ga0105240_10014184 Ga0105240_100141843 156
62 3300009174 Ga0105241_10067152 Ga0105241_100671522 156
63 3300009177 Ga0105248_12398527 Ga0105248_123985271 156
64 3300009545 Ga0105237_10000002 Ga0105237_10000002624 156
65 3300009551 Ga0105238_10002660 Ga0105238_1000266013 156
66 3300009979 Ga0105032_100003 Ga0105032_10000335 156
67 3300009984 Ga0105029_100039 Ga0105029_1000391 156
68 3300009987 Ga0105030_102326 Ga0105030_1023262 156
69 3300010375 Ga0105239_10173355 Ga0105239_101733554 156
70 3300010375 Ga0105239_10181085 Ga0105239_101810852 156
71 3300013105 Ga0157369_10006357 Ga0157369_1000635710 156
72 3300013105 Ga0157369_10008946 Ga0157369_100089467 156
73 3300013105 Ga0157369_10012651 Ga0157369_100126512 156
74 3300013105 Ga0157369_10652039 Ga0157369_106520392 156
75 3300013296 Ga0157374_11201666 Ga0157374_112016661 156
76 3300013307 Ga0157372_10000008 Ga0157372_10000008178 156
77 3300013874 Ga0157514_109437 Ga0157514_1094371 156
78 3300025913 Ga0207695_10002102 Ga0207695_100021023 156
79 3300025913 Ga0207695_10002605 Ga0207695_1000260524 156
80 3300025914 Ga0207671_10000008 Ga0207671_10000008730 156
81 3300025924 Ga0207694_10019228 Ga0207694_100192285 156
82 3300025949 Ga0207667_10000096 Ga0207667_10000096136 156
83 3300026116 Ga0207674_10028094 Ga0207674_100280946 156
84 3300026142 Ga0207698_10000022 Ga0207698_10000022141 156
85 3300030745 Ga0316182_1017869 Ga0316182_10178692 156
86 3300030745 Ga0316182_1125898 Ga0316182_11258989 156
87 3300031730 Ga0307516_10013501 Ga0307516_100135016 156
88 3300037312 Ga0395899_0021442 Ga0395899_0021442_4063_4539 156
89 3300037418 Ga0395900_0790826 Ga0395900_0790826_115_594 156
90 3300042121 Ga0450919_009340 Ga0450919_009340_458_940 156
91 3300042122 Ga0450920_031609 Ga0450920_031609_176_649 156
92 3300042185 Ga0450909_000943 Ga0450909_000943_3116_3589 156
93 3300044712 Ga0453684_1049331 Ga0453684_1049331_229_705 156
94 3300046810 Ga0495660_0000175 Ga0495660_0000175_37640_38119 156
95 3300048912 Ga0496109_0813840 Ga0496109_0813840_214_690 156
96 3300049571 Ga0501034_0000090 Ga0501034_0000090_8086_8562 156
97 3300049573 Ga0501037_0000001 Ga0501037_0000001_474859_475335 156
98 3300049574 Ga0501038_0015706 Ga0501038_0015706_2782_3258 156
99 3300050490 nmdc:mga03n38_100698_c1 nmdc:mga03n38_100698_c1_527_1006 156
100 3300050491 nmdc:mga00v17_101_c1 nmdc:mga00v17_101_c1_30183_30662 156
101 3300050492 nmdc:mga0yw44_15_c2 nmdc:mga0yw44_15_c2_769_1245 156
102 3300050492 nmdc:mga0yw44_233735_c1 nmdc:mga0yw44_233735_c1_661_1140 156
103 3300050492 nmdc:mga0yw44_444923_c1 nmdc:mga0yw44_444923_c1_320_799 156
104 3300050492 nmdc:mga0yw44_6_c1 nmdc:mga0yw44_6_c1_143374_143853 156
105 3300050494 nmdc:mga06z11_284_c1 nmdc:mga06z11_284_c1_16980_17459 156
106 3300050495 nmdc:mga04h51_10424_c1 nmdc:mga04h51_10424_c1_791_1270 156
107 3300050496 nmdc:mga07m45_509685_c1 nmdc:mga07m45_509685_c1_63_542 156
108 3300050516 nmdc:mga0sz30_29687_c1 nmdc:mga0sz30_29687_c1_1204_1683 156
109 3300053088 Ga0500644_0030265 Ga0500644_0030265_25_504 156
110 3300053090 Ga0500646_0000001 Ga0500646_0000001_31968_32447 156
111 3300053090 Ga0500646_0039198 Ga0500646_0039198_181_675 156
112 3300053092 Ga0500583_0023872 Ga0500583_0023872_195_674 156
113 3300053092 Ga0500583_0141365 Ga0500583_0141365_267_761 156
114 3300053092 Ga0500583_0491446 Ga0500583_0491446_33_515 156
115 3300053093 Ga0500651_0000001 Ga0500651_0000001_39223_39699 156
116 3300053096 Ga0500641_0000001 Ga0500641_0000001_394109_394588 156
117 3300053098 Ga0500650_0009862 Ga0500650_0009862_451_930 156
118 3300053118 Ga0500594_0000004 Ga0500594_0000004_173772_174248 156
119 3300053131 Ga0500652_000007 Ga0500652_000007_133789_134268 156
120 3300053142 Ga0500577_0047750 Ga0500577_0047750_883_1359 156
121 3300053153 Ga0500616_0000067 Ga0500616_0000067_6430_6930 156
122 3300053153 Ga0500616_0076371 Ga0500616_0076371_541_1023 156
123 3300053153 Ga0500616_0087619 Ga0500616_0087619_808_1290 156
124 3300053738 Ga0500613_000849 Ga0500613_000849_368_862 156
125 3300001979 JGI24740J21852_10002697 JGI24740J21852_100026975 157
126 3300001989 JGI24739J22299_10000857 JGI24739J22299_100008579 157
127 3300001990 JGI24737J22298_10000452 JGI24737J22298_1000045215 157
128 3300001991 JGI24743J22301_10013242 JGI24743J22301_100132422 157
129 3300002067 JGI24735J21928_10000054 JGI24735J21928_1000005435 157
130 3300002075 JGI24738J21930_10001199 JGI24738J21930_100011995 157
131 3300005290 Ga0065712_10439985 Ga0065712_104399851 157
132 3300005327 Ga0070658_10000063 Ga0070658_1000006374 157
133 3300005329 Ga0070683_100004853 Ga0070683_1000048538 157
134 3300005339 Ga0070660_100052202 Ga0070660_1000522022 157
135 3300005344 Ga0070661_100006621 Ga0070661_1000066212 157
136 3300005344 Ga0070661_100269828 Ga0070661_1002698282 157
137 3300005354 Ga0070675_101210528 Ga0070675_1012105281 157
138 3300005366 Ga0070659_100001790 Ga0070659_10000179011 157
139 3300005366 Ga0070659_100083254 Ga0070659_1000832543 157
140 3300005564 Ga0070664_100000051 Ga0070664_10000005171 157
141 3300005614 Ga0068856_100000018 Ga0068856_10000001883 157
142 3300005614 Ga0068856_100002398 Ga0068856_1000023988 157
143 3300005614 Ga0068856_102041765 Ga0068856_1020417651 157
144 3300005616 Ga0068852_100000045 Ga0068852_10000004512 157
145 3300006051 Ga0075364_10020102 Ga0075364_100201025 157
146 3300006186 Ga0075369_10014929 Ga0075369_100149293 157
147 3300006195 Ga0075366_10001246 Ga0075366_1000124613 157
148 3300006358 Ga0068871_100040160 Ga0068871_1000401603 157
149 3300006881 Ga0068865_100001064 Ga0068865_1000010647 157
150 3300009036 Ga0105244_10124255 Ga0105244_101242552 157
151 3300009098 Ga0105245_10027872 Ga0105245_100278725 157
152 3300010375 Ga0105239_10000722 Ga0105239_1000072219 157
153 3300011119 Ga0105246_10005353 Ga0105246_100053538 157
154 3300011119 Ga0105246_10754012 Ga0105246_107540122 157
155 3300013100 Ga0157373_10016344 Ga0157373_100163443 157
156 3300013102 Ga0157371_10005390 Ga0157371_100053909 157
157 3300013104 Ga0157370_10007404 Ga0157370_100074046 157
158 3300013105 Ga0157369_10005601 Ga0157369_100056018 157
159 3300013296 Ga0157374_10002360 Ga0157374_1000236014 157
160 3300013307 Ga0157372_10161804 Ga0157372_101618043 157
161 3300014745 Ga0157377_10000668 Ga0157377_100006684 157
162 3300014969 Ga0157376_10112409 Ga0157376_101124092 157
163 3300025904 Ga0207647_10000640 Ga0207647_1000064027 157
164 3300025909 Ga0207705_10000093 Ga0207705_1000009374 157
165 3300025919 Ga0207657_10002779 Ga0207657_100027796 157
166 3300025920 Ga0207649_10010569 Ga0207649_100105693 157
167 3300025927 Ga0207687_10091060 Ga0207687_100910603 157
168 3300025932 Ga0207690_10040820 Ga0207690_100408203 157
169 3300025932 Ga0207690_10060961 Ga0207690_100609612 157
170 3300025933 Ga0207706_10000209 Ga0207706_1000020915 157
171 3300025938 Ga0207704_10000609 Ga0207704_100006097 157
172 3300025944 Ga0207661_10010521 Ga0207661_100105215 157
173 3300025945 Ga0207679_10001761 Ga0207679_100017613 157
174 3300026078 Ga0207702_10000179 Ga0207702_100001796 157
175 3300026078 Ga0207702_10010516 Ga0207702_100105164 157
176 3300026142 Ga0207698_10000165 Ga0207698_1000016523 157
177 3300037312 Ga0395899_0015497 Ga0395899_0015497_1498_1971 157
178 3300037418 Ga0395900_0000001 Ga0395900_0000001_893625_894098 157
179 3300037466 Ga0395898_0000002 Ga0395898_0000002_211908_212381 157
180 3300038443 Ga0395901_0000072 Ga0395901_0000072_49575_50048 157
181 3300038443 Ga0395901_0136321 Ga0395901_0136321_18_491 157
182 3300042439 Ga0439464_0000043 Ga0439464_0000043_4810_5283 157
183 3300050491 nmdc:mga00v17_51227_c1 nmdc:mga00v17_51227_c1_192_665 157
184 3300050493 nmdc:mga0k408_24002_c1 nmdc:mga0k408_24002_c1_267_740 157
185 3300050494 nmdc:mga06z11_111172_c1 nmdc:mga06z11_111172_c1_40_513 157
186 3300050496 nmdc:mga07m45_978_c1 nmdc:mga07m45_978_c1_6251_6724 157

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01668

SmpB

SmpB protein

20

161

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ljp-assembly2.cif.gz_B structure of thermotoga maritima smpb 0.8495 16 134
1p6v-assembly2.cif.gz_C crystal structure of the trna domain of transfer-messenger rna in complex with smpb 0.849 14 135
1wjx-assembly1.cif.gz_A crystal sturucture of tt0801 from thermus thermophilus 0.8332 15 134
2ob7-assembly1.cif.gz_B structure of tmrna-(smpb)2 complex as inferred from cryo-em 0.8263 14 135
2ob7-assembly1.cif.gz_C structure of tmrna-(smpb)2 complex as inferred from cryo-em 0.8199 14 130
ID Description Score Start End Superfamily
af_P0A832_7_135_2.40.280.10 Mainly Beta;Beta Barrel;Small Protein B; Chain: A;;Small protein B 0.906 16 136 2.40.280.10
2czjC00 Mainly Beta;Beta Barrel;Small Protein B; Chain: A;;Small protein B 0.8541 12 134 2.40.280.10
2czjC00 Mainly Beta;Beta Barrel;Small Protein B; Chain: A;;Small protein B 0.8473 12 134 2.40.280.10
af_P0A832_7_135_2.40.280.10 Mainly Beta;Beta Barrel;Small Protein B; Chain: A;;Small protein B 0.8382 16 136 2.40.280.10
1j1hA00 Mainly Beta;Beta Barrel;Small Protein B; Chain: A;;Small protein B 0.6428 13 134 2.40.280.10
ID Description Score Start End GO Terms
AF-A0A381Z638-F1-model_v4 SsrA-binding protein 0.8978 16 134 GO:0003723
GO:0005829
AF-A0A660ZPQ7-F1-model_v4 SsrA-binding protein 0.8968 16 135 GO:0003723
GO:0005829
AF-A0A1F8BBW5-F1-model_v4 SsrA-binding protein 0.8939 14 142 GO:0003723
GO:0005829
AF-A0A3C2AI62-F1-model_v4 SsrA-binding protein 0.8929 16 135 GO:0003723
GO:0005829
AF-A0A3B9P471-F1-model_v4 SsrA-binding protein 0.8894 14 138 GO:0003723
GO:0005829

Feature Viewer

pLDDT pTM Quality
81.76 0.68 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map